F448809

General Info

Members Datasets Scaffolds Average Seq Length
461 273 922 230

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0053208|Ga0501047_0053208_3181_3903
Length 240
Sequence MPSKARVLVVDDEPQMHRFLGPALNAAGYEHVRSETGRQALAEMARRPPDAVVLDLGLPDIDGQEVLRKARDFYEGPIVILSARDREMEKIEALDAGADDYVEKPFRVGELLARLRVAMRRQARHAEAPPPVIEAGDLVIDLPRRLVTRHGEAVRLSPKEYDLLAKLAEADGKVLTHKELLLSLWGPAHLHDMQYLRVFIGQLRQKIETDPAEPKLILTQPGIGYRFMADAIRAGPLSPS

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
58 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
59 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
96 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
97 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
101 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
102 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
112 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
126 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
127 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
130 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
131 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
137 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
138 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
139 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
140 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
141 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
142 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
143 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
144 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
145 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
146 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
147 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
148 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
149 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
150 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
151 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
152 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
160 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
161 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
164 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
165 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
166 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
176 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
188 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
189 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
190 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
191 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
195 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
196 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
197 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
198 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
199 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
200 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
201 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
202 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
203 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
204 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
205 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
206 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
207 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
208 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
209 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
210 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
211 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
212 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
213 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
214 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
215 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
216 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
217 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
218 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
219 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
220 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
221 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
222 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
223 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
224 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
225 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
226 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
227 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
228 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
229 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
230 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
231 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
232 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
233 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
234 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
235 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
237 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
238 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
239 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
240 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
241 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
242 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
243 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
244 2643221583 Caulobacter sp. Root655 Isolate Unclassified
245 2643221584 Caulobacter sp. Root656 Isolate Unclassified
246 2643221640 Caulobacter sp. Root342 Isolate Unclassified
247 2643221642 Caulobacter sp. Root343 Isolate Unclassified
248 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
249 2643221736 Bosea sp. Root483D1 Isolate Unclassified
250 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
251 2818991435 Caulobacter henricii 536 Isolate Unclassified
252 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
253 2841760612 Bosea sp. Tri-49 Isolate Nodule
254 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
255 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
256 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
257 2844104063 Bosea sp. Tri-39 Isolate Nodule
258 2849560528 Caulobacter zeae 410 Isolate Unclassified
259 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
260 2851153111 Caulobacter radicis 736 Isolate Unclassified
261 2851182111 Bosea sp. Tri-44 Isolate Nodule
262 2851246043 Bosea sp. Tri-54 Isolate Nodule
263 2857472729 Cohnella sp. R-74144 Isolate Unclassified
264 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
265 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
266 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
267 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
268 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
269 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
270 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
271 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
272 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
273 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.32
Metatranscriptomes 0.43
Isolates 8.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 32.75
Nodule 1.52
Rhizoplane 2.39
Rhizosphere 52.93
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0053208 3300049581 Bacteria 3914
2 SwRhRL2b_contig_1033251 2162886007 Bacteria 14331
3 rootH1_10001606 3300003316 Bacteria 5745
4 rootL2_10009547 3300003322 Bacteria 13883
5 Ga0006562J51391_1040738 3300003578 Bacteria 5980
6 Ga0006562J51391_1040739 3300003578 Bacteria 5840
7 Ga0055537_1021099 3300003773 Bacteria 975
8 Ga0055536_1000492 3300003781 Bacteria 27396
9 Ga0055528_1003284 3300003790 Bacteria 8223
10 Ga0055530_10002951 3300003791 Bacteria 10267
11 Ga0055530_10003766 3300003791 Bacteria 8369
12 Ga0055540_1024070 3300003792 Bacteria 1519
13 Ga0055531_10000526 3300003794 Bacteria 34418
14 Ga0055531_10001323 3300003794 Bacteria 18554
15 Ga0055531_10001503 3300003794 Bacteria 17129
16 Ga0055531_10007028 3300003794 Bacteria 6231
17 Ga0055541_1002814 3300003841 Bacteria 3374
18 Ga0065165_1000089 3300005262 Bacteria 150859
19 Ga0065165_1000602 3300005262 Bacteria 52602
20 Ga0065165_1000615 3300005262 Bacteria 51725
21 Ga0070670_100064766 3300005331 Bacteria 3136
22 Ga0070666_10119359 3300005335 Bacteria 1828
23 Ga0070666_10201822 3300005335 Bacteria 1399
24 Ga0070668_100006229 3300005347 Bacteria 8836
25 Ga0070668_100006525 3300005347 Bacteria 8649
26 Ga0070671_100113386 3300005355 Bacteria 2278
27 Ga0070667_100000169 3300005367 Bacteria 81539
28 Ga0070667_100008230 3300005367 Bacteria 8644
29 Ga0070663_100554777 3300005455 Bacteria 961
30 Ga0070684_100654636 3300005535 Bacteria 978
31 Ga0068853_100216163 3300005539 Bacteria 1749
32 Ga0070665_100000610 3300005548 Bacteria 49084
33 Ga0070664_100817217 3300005564 Bacteria 872
34 Ga0068856_100083863 3300005614 Bacteria 3165
35 Ga0068859_100009457 3300005617 Bacteria 9841
36 Ga0068864_100000182 3300005618 Bacteria 58155
37 Ga0068864_100000220 3300005618 Bacteria 51737
38 Ga0068864_100159005 3300005618 Bacteria 2053
39 Ga0068864_100376671 3300005618 Bacteria 1344
40 Ga0068863_100000101 3300005841 Bacteria 92384
41 Ga0068863_100000185 3300005841 Bacteria 66169
42 Ga0068863_100010741 3300005841 Bacteria 8886
43 Ga0068863_100342728 3300005841 Bacteria 1454
44 Ga0068863_100361988 3300005841 Bacteria 1414
45 Ga0068858_100000260 3300005842 Bacteria 56470
46 Ga0068858_100005192 3300005842 Bacteria 12758
47 Ga0068860_100000211 3300005843 Bacteria 91286
48 Ga0068860_100002211 3300005843 Bacteria 20477
49 Ga0068862_100000514 3300005844 Bacteria 41173
50 Ga0068862_100026586 3300005844 Bacteria 4865
51 Ga0075365_10149476 3300006038 Bacteria 1625
52 Ga0075368_10020939 3300006042 Bacteria 2480
53 Ga0075364_10000257 3300006051 Bacteria 25641
54 Ga0075362_10115414 3300006177 Bacteria 1267
55 Ga0075367_10002033 3300006178 Bacteria 9046
56 Ga0075369_10007218 3300006186 Bacteria 4224
57 Ga0075366_10174258 3300006195 Bacteria 1306
58 Ga0075366_10269351 3300006195 Bacteria 1040
59 Ga0075370_10118531 3300006353 Bacteria 1540
60 Ga0075370_10216460 3300006353 Bacteria 1131
61 Ga0075370_10226669 3300006353 Bacteria 1105
62 Ga0075428_100183654 3300006844 Bacteria 2263
63 Ga0075429_100067367 3300006880 Bacteria 3115
64 Ga0068865_100003518 3300006881 Bacteria 9388
65 Ga0097620_100009457 3300006931 Bacteria 9841
66 Ga0105240_10008146 3300009093 Bacteria 15030
67 Ga0105240_10016466 3300009093 Bacteria 10006
68 Ga0105247_10057676 3300009101 Bacteria 2401
69 Ga0114129_10009638 3300009147 Bacteria 13779
70 Ga0105248_10000685 3300009177 Bacteria 38290
71 Ga0105248_10013274 3300009177 Bacteria 9068
72 Ga0105248_10133470 3300009177 Bacteria 2801
73 Ga0105248_10165309 3300009177 Bacteria 2495
74 Ga0105248_10356436 3300009177 Bacteria 1647
75 Ga0105249_10001221 3300009553 Bacteria 22640
76 Ga0105249_10366527 3300009553 Bacteria 1463
77 Ga0105239_10207045 3300010375 Bacteria 2198
78 Ga0105239_10557786 3300010375 Bacteria 1305
79 Ga0157371_10002938 3300013102 Bacteria 15895
80 Ga0157369_10063047 3300013105 Bacteria 3994
81 Ga0157374_10171320 3300013296 Bacteria 2118
82 Ga0163162_10049558 3300013306 Bacteria 4209
83 Ga0163163_10049337 3300014325 Bacteria 4142
84 Ga0163163_10159130 3300014325 Bacteria 2303
85 Ga0163163_10223899 3300014325 Bacteria 1930
86 Ga0213872_10003853 3300021361 Bacteria 8152
87 Ga0213876_10000544 3300021384 Bacteria 28326
88 Ga0209566_100627 3300025225 Bacteria 21729
89 Ga0209026_1001342 3300025250 Bacteria 11023
90 Ga0209026_1019398 3300025250 Bacteria 1066
91 Ga0209233_1019891 3300025261 Bacteria 1773
92 Ga0209565_1002647 3300025263 Bacteria 6302
93 Ga0209455_1028377 3300025272 Bacteria 979
94 Ga0209673_1000941 3300025273 Bacteria 36504
95 Ga0209673_1025428 3300025273 Bacteria 1969
96 Ga0209130_1000087 3300025284 Bacteria 155407
97 Ga0209675_1007043 3300025291 Bacteria 4384
98 Ga0209676_1000057 3300025292 Bacteria 361061
99 Ga0209676_1000468 3300025292 Bacteria 67646
100 Ga0209025_1001185 3300025294 Bacteria 36914
101 Ga0209025_1017267 3300025294 Bacteria 4180
102 Ga0209025_1031095 3300025294 Bacteria 2535
103 Ga0209564_1000818 3300025295 Bacteria 42378
104 Ga0209564_1008755 3300025295 Bacteria 4935
105 Ga0209758_1001974 3300025297 Bacteria 22165
106 Ga0209758_1008396 3300025297 Bacteria 6706
107 Ga0209050_1000098 3300025298 Bacteria 236717
108 Ga0209050_1000486 3300025298 Bacteria 69279
109 Ga0209050_1000522 3300025298 Bacteria 63985
110 Ga0209050_1022224 3300025298 Bacteria 2278
111 Ga0209050_1053425 3300025298 Bacteria 1004
112 Ga0209256_1000641 3300025299 Bacteria 47608
113 Ga0209256_1004707 3300025299 Bacteria 8363
114 Ga0209256_1005553 3300025299 Bacteria 7201
115 Ga0207426_1026477 3300025302 Bacteria 1942
116 Ga0209051_1036036 3300025303 Bacteria 1833
117 Ga0209257_1000235 3300025304 Bacteria 129620
118 Ga0209257_1000350 3300025304 Bacteria 95008
119 Ga0209257_1000520 3300025304 Bacteria 66890
120 Ga0209257_1001269 3300025304 Bacteria 30981
121 Ga0209257_1015918 3300025304 Bacteria 3083
122 Ga0207680_10049955 3300025903 Bacteria 2493
123 Ga0207705_10339660 3300025909 Bacteria 1156
124 Ga0207654_10358291 3300025911 Bacteria 1006
125 Ga0207695_10001222 3300025913 Bacteria 44042
126 Ga0207695_10017426 3300025913 Bacteria 8359
127 Ga0207694_10602971 3300025924 Bacteria 924
128 Ga0207694_10878890 3300025924 Bacteria 758
129 Ga0207650_10000160 3300025925 Bacteria 81491
130 Ga0207650_10307073 3300025925 Bacteria 1297
131 Ga0207644_10178900 3300025931 Bacteria 1661
132 Ga0207704_10000680 3300025938 Bacteria 15055
133 Ga0207711_10028739 3300025941 Bacteria 4683
134 Ga0207711_10058478 3300025941 Bacteria 3318
135 Ga0207711_10206467 3300025941 Bacteria 1794
136 Ga0207711_10459954 3300025941 Bacteria 1185
137 Ga0207712_10000203 3300025961 Bacteria 59867
138 Ga0207712_10133775 3300025961 Bacteria 1893
139 Ga0207668_10000116 3300025972 Bacteria 56072
140 Ga0207668_10030398 3300025972 Bacteria 3549
141 Ga0207658_10000341 3300025986 Bacteria 46166
142 Ga0207658_10011222 3300025986 Bacteria 6104
143 Ga0207703_10000113 3300026035 Bacteria 96214
144 Ga0207703_10003627 3300026035 Bacteria 12877
145 Ga0207703_10098925 3300026035 Bacteria 2468
146 Ga0207639_10862855 3300026041 Bacteria 845
147 Ga0207678_10380836 3300026067 Bacteria 1220
148 Ga0207678_10553633 3300026067 Bacteria 1006
149 Ga0207702_10124634 3300026078 Bacteria 2311
150 Ga0207641_10000109 3300026088 Bacteria 121126
151 Ga0207641_10005917 3300026088 Bacteria 10368
152 Ga0207641_10007409 3300026088 Bacteria 9128
153 Ga0207641_10048774 3300026088 Bacteria 3576
154 Ga0207676_10000337 3300026095 Bacteria 40385
155 Ga0207676_10000588 3300026095 Bacteria 29881
156 Ga0207676_10333249 3300026095 Bacteria 1397
157 Ga0207675_100046221 3300026118 Bacteria 4066
158 Ga0207675_100707847 3300026118 Bacteria 1016
159 Ga0268266_10561452 3300028379 Bacteria 1094
160 Ga0268265_10002154 3300028380 Bacteria 15249
161 Ga0268264_10000270 3300028381 Bacteria 90954
162 Ga0268264_10367226 3300028381 Bacteria 1374
163 Ga0265319_1107584 3300028563 Bacteria 873
164 Ga0265318_10084373 3300028577 Bacteria 1172
165 Ga0307517_10001670 3300028786 Bacteria 36710
166 Ga0307517_10032853 3300028786 Bacteria 5983
167 Ga0307517_10151375 3300028786 Bacteria 1590
168 Ga0307515_10032462 3300028794 Bacteria 8650
169 Ga0307515_10034337 3300028794 Bacteria 8310
170 Ga0307515_10125610 3300028794 Bacteria 2869
171 Ga0265338_10020391 3300028800 Bacteria 6974
172 Ga0265338_10025565 3300028800 Bacteria 5988
173 Ga0265338_10085751 3300028800 Bacteria 2624
174 Ga0265338_10099785 3300028800 Bacteria 2370
175 Ga0265338_10180698 3300028800 Bacteria 1609
176 Ga0265324_10049320 3300029957 Bacteria 1448
177 Ga0265328_10000812 3300031239 Bacteria 14422
178 Ga0265328_10041171 3300031239 Bacteria 1701
179 Ga0265320_10091249 3300031240 Bacteria 1411
180 Ga0265327_10017720 3300031251 Bacteria 4451
181 Ga0265327_10062736 3300031251 Bacteria 1890
182 Ga0307513_10004606 3300031456 Bacteria 18358
183 Ga0265314_10239850 3300031711 Bacteria 1047
184 Ga0307516_10000022 3300031730 Bacteria 191854
185 Ga0307405_10155522 3300031731 Bacteria 1613
186 Ga0307416_100319115 3300032002 Bacteria 1555
187 Ga0307414_10018647 3300032004 Bacteria 4279
188 Ga0307414_10075260 3300032004 Bacteria 2449
189 Ga0307414_10223003 3300032004 Bacteria 1549
190 Ga0307411_10101058 3300032005 Bacteria 2040
191 Ga0307510_10019492 3300033180 Bacteria 7957
192 Ga0373944_0034969 3300035089 Bacteria 1529
193 Ga0373927_0013837 3300035695 Bacteria 5355
194 Ga0373925_0000760 3300037068 Bacteria 29657
195 Ga0395899_0000003 3300037312 Bacteria 1232684
196 Ga0395899_0000516 3300037312 Bacteria 42796
197 Ga0395899_0001452 3300037312 Bacteria 20214
198 Ga0395899_0002510 3300037312 Bacteria 14876
199 Ga0395899_0116065 3300037312 Bacteria 1921
200 Ga0395900_0000010 3300037418 Bacteria 461364
201 Ga0395898_0002619 3300037466 Bacteria 20927
202 Ga0395905_0147882 3300037471 Bacteria 2210
203 Ga0436364_1236068 3300037853 Bacteria 1510
204 Ga0436364_1562220 3300037853 Bacteria 2373
205 Ga0395901_0000007 3300038443 Bacteria 497408
206 Ga0237819_08123 3300038705 Bacteria 1466
207 Ga0436365_1544656 3300039437 Bacteria 122419
208 Ga0436361_0064356 3300039447 Bacteria 3999
209 Ga0436363_0406098 3300039450 Bacteria 4367
210 Ga0436362_0966972 3300039453 Bacteria 913
211 Ga0439435_0006182 3300042436 Bacteria 2680
212 Ga0466965_0060547 3300044683 Bacteria 1891
213 Ga0466966_0047836 3300044684 Bacteria 2726
214 Ga0453684_0209930 3300044712 Unclassified 2264
215 Ga0453684_0234750 3300044712 Bacteria 2115
216 Ga0453684_0478082 3300044712 Bacteria 1382
217 Ga0453684_0512899 3300044712 Bacteria 1326
218 Ga0466971_0308242 3300044719 Bacteria 761
219 Ga0466968_0085866 3300044735 Bacteria 1389
220 Ga0466959_0003037 3300045049 Bacteria 10850
221 Ga0466959_0020496 3300045049 Bacteria 4872
222 Ga0451576_0000058 3300045051 Bacteria 298769
223 Ga0495590_0006738 3300046457 Bacteria 4467
224 Ga0495629_0037061 3300046459 Bacteria 3437
225 Ga0495629_0294681 3300046459 Bacteria 1111
226 Ga0495638_0000419 3300046460 Bacteria 51336
227 Ga0495638_0000443 3300046460 Bacteria 49906
228 Ga0495638_0002701 3300046460 Bacteria 14266
229 Ga0495638_0019659 3300046460 Bacteria 4467
230 Ga0495650_0000007 3300046471 Bacteria 718072
231 Ga0495650_0026021 3300046471 Bacteria 2730
232 Ga0495650_0124336 3300046471 Bacteria 946
233 Ga0495583_0000037 3300046506 Bacteria 244437
234 Ga0495583_0136595 3300046506 Bacteria 1023
235 Ga0495606_0001606 3300046507 Bacteria 29482
236 Ga0495606_0081722 3300046507 Bacteria 2008
237 Ga0495606_0087496 3300046507 Bacteria 1923
238 Ga0495606_0153099 3300046507 Bacteria 1352
239 Ga0495606_0259839 3300046507 Bacteria 959
240 Ga0495610_0000040 3300046512 Bacteria 165165
241 Ga0495610_0003437 3300046512 Bacteria 12345
242 Ga0495616_0000026 3300046513 Bacteria 141705
243 Ga0495620_0020050 3300046515 Bacteria 3273
244 Ga0495620_0022786 3300046515 Bacteria 3009
245 Ga0495631_0007680 3300046518 Bacteria 5475
246 Ga0495632_0004616 3300046519 Bacteria 9326
247 Ga0495632_0013381 3300046519 Bacteria 4684
248 Ga0495632_0034618 3300046519 Bacteria 2583
249 Ga0495637_0010129 3300046520 Bacteria 4573
250 Ga0495637_0011340 3300046520 Bacteria 4285
251 Ga0495643_0004412 3300046522 Bacteria 9852
252 Ga0495648_0000068 3300046524 Bacteria 138518
253 Ga0495654_0000095 3300046530 Bacteria 100179
254 Ga0495609_0071528 3300046538 Bacteria 1524
255 Ga0495609_0072879 3300046538 Bacteria 1507
256 Ga0495609_0095937 3300046538 Bacteria 1287
257 Ga0495597_0005410 3300046542 Bacteria 6762
258 Ga0495597_0006234 3300046542 Bacteria 6186
259 Ga0495597_0016365 3300046542 Bacteria 3501
260 Ga0495622_0000804 3300046557 Bacteria 17378
261 Ga0495633_0002973 3300046558 Bacteria 11589
262 Ga0495668_0000019 3300046616 Bacteria 416042
263 Ga0495668_0018873 3300046616 Bacteria 3984
264 Ga0495668_0037233 3300046616 Bacteria 2722
265 Ga0495668_0175065 3300046616 Bacteria 1175
266 Ga0495611_0001049 3300046648 Bacteria 14612
267 Ga0495625_0000080 3300046660 Bacteria 156895
268 Ga0495625_0000759 3300046660 Bacteria 44970
269 Ga0495625_0000793 3300046660 Bacteria 43797
270 Ga0495625_0013830 3300046660 Bacteria 6465
271 Ga0495625_0073911 3300046660 Bacteria 2388
272 Ga0495625_0137256 3300046660 Bacteria 1652
273 Ga0495599_0348233 3300046678 Bacteria 888
274 Ga0495669_0022824 3300046684 Bacteria 2720
275 Ga0495669_0180754 3300046684 Bacteria 1005
276 Ga0495613_0003661 3300046689 Bacteria 11519
277 Ga0495613_0114214 3300046689 Bacteria 1944
278 Ga0495671_0032336 3300046692 Bacteria 2671
279 Ga0495671_0093056 3300046692 Bacteria 1475
280 Ga0495649_0000928 3300046694 Bacteria 23215
281 Ga0495660_0001672 3300046810 Bacteria 14854
282 Ga0495660_0019582 3300046810 Bacteria 3885
283 Ga0495660_0106441 3300046810 Bacteria 1437
284 Ga0495672_0002465 3300047320 Bacteria 17011
285 Ga0495672_0073275 3300047320 Bacteria 1932
286 Ga0495683_0076173 3300047323 Bacteria 1642
287 Ga0495687_040951 3300047443 Bacteria 2037
288 Ga0495673_0000132 3300047469 Bacteria 138001
289 Ga0495673_0003359 3300047469 Bacteria 10587
290 Ga0495681_0027795 3300047470 Bacteria 2921
291 Ga0495686_0000617 3300047472 Bacteria 49100
292 Ga0495686_0012381 3300047472 Bacteria 5968
293 Ga0495686_0040540 3300047472 Bacteria 2969
294 Ga0495686_0151438 3300047472 Bacteria 1361
295 Ga0495593_0024086 3300047673 Bacteria 3377
296 Ga0496102_0050630 3300048905 Bacteria 3783
297 Ga0496102_0083525 3300048905 Bacteria 2947
298 Ga0496103_0463438 3300048906 Bacteria 812
299 Ga0496106_0045878 3300048909 Bacteria 3284
300 Ga0496106_0556840 3300048909 Bacteria 920
301 Ga0496107_0000023 3300048910 Bacteria 125918
302 Ga0496107_0228297 3300048910 Bacteria 1385
303 Ga0496111_0122981 3300048914 Bacteria 1917
304 Ga0496115_0042016 3300048918 Bacteria 3641
305 Ga0496115_0410857 3300048918 Bacteria 1097
306 Ga0496115_0717676 3300048918 Bacteria 784
307 Ga0496116_0107799 3300048919 Bacteria 1646
308 Ga0496119_0047442 3300048922 Bacteria 2672
309 Ga0496121_0000009 3300048924 Bacteria 836971
310 Ga0496121_0001031 3300048924 Bacteria 49668
311 Ga0496124_0014207 3300048927 Bacteria 7714
312 Ga0496125_0000481 3300048928 Bacteria 70594
313 Ga0496125_0002840 3300048928 Bacteria 21805
314 Ga0496125_0073185 3300048928 Bacteria 2666
315 Ga0496126_0022224 3300048929 Bacteria 6175
316 Ga0496126_0200258 3300048929 Bacteria 1687
317 Ga0495678_001686 3300049459 Bacteria 16735
318 Ga0501033_0429051 3300049570 Bacteria 920
319 Ga0501034_0846645 3300049571 Bacteria 805
320 Ga0501047_0012301 3300049581 Bacteria 8099
321 Ga0501047_0203312 3300049581 Bacteria 1841
322 Ga0501047_0326588 3300049581 Bacteria 1373
323 Ga0501238_001946 3300049671 Bacteria 2420
324 Ga0501238_005737 3300049671 Bacteria 1583
325 Ga0501035_0217067 3300049822 Bacteria 1634
326 Ga0501044_0068331 3300049823 Bacteria 3620
327 nmdc:mga00v17_436_c1 3300050491 Bacteria 23432
328 nmdc:mga0yw44_110499_c1 3300050492 Bacteria 1760
329 nmdc:mga0k408_106040_c1 3300050493 Bacteria 1660
330 nmdc:mga0k408_213293_c1 3300050493 Bacteria 1153
331 nmdc:mga0k408_75081_c1 3300050493 Bacteria 1975
332 nmdc:mga06z11_27994_c1 3300050494 Bacteria 2700
333 nmdc:mga07m45_138263_c1 3300050496 Bacteria 1410
334 nmdc:mga07m45_268780_c1 3300050496 Bacteria 992
335 nmdc:mga07m45_340_c1 3300050496 Bacteria 18991
336 nmdc:mga05p37_24481_c1 3300050507 Bacteria 7338
337 nmdc:mga09592_78745_c1 3300050508 Bacteria 2805
338 nmdc:mga0sz30_4001_c1 3300050516 Bacteria 5308
339 Ga0500635_0000107 3300053080 Bacteria 49911
340 Ga0500635_0000131 3300053080 Bacteria 43413
341 Ga0500578_0002245 3300053086 Bacteria 16755
342 Ga0500578_0176383 3300053086 Bacteria 1319
343 Ga0500643_000233 3300053087 Bacteria 51480
344 Ga0500643_007205 3300053087 Bacteria 4538
345 Ga0500644_0000015 3300053088 Bacteria 108763
346 Ga0500644_0019867 3300053088 Bacteria 1989
347 Ga0500647_0006311 3300053091 Bacteria 4999
348 Ga0500647_0013773 3300053091 Bacteria 3663
349 Ga0500583_0008213 3300053092 Bacteria 3730
350 Ga0500651_0017672 3300053093 Bacteria 4406
351 Ga0500651_0066558 3300053093 Bacteria 2244
352 Ga0500566_0006578 3300053094 Bacteria 6889
353 Ga0500566_0056532 3300053094 Bacteria 2231
354 Ga0500641_0000807 3300053096 Bacteria 11307
355 Ga0500641_0006587 3300053096 Bacteria 4123
356 Ga0500554_012967 3300053102 Bacteria 2111
357 Ga0500556_0000178 3300053104 Bacteria 52397
358 Ga0500556_0004634 3300053104 Bacteria 3905
359 Ga0500557_002030 3300053105 Bacteria 3577
360 Ga0500562_001309 3300053108 Bacteria 6143
361 Ga0500562_008560 3300053108 Bacteria 2584
362 Ga0500562_027778 3300053108 Bacteria 1485
363 Ga0500569_000805 3300053109 Bacteria 5524
364 Ga0500569_001888 3300053109 Bacteria 4041
365 Ga0500594_0000362 3300053118 Bacteria 10110
366 Ga0500594_0117074 3300053118 Bacteria 834
367 Ga0500595_000877 3300053119 Bacteria 17141
368 Ga0500595_001682 3300053119 Bacteria 11621
369 Ga0500595_028144 3300053119 Bacteria 1918
370 Ga0500607_208957 3300053121 Bacteria 828
371 Ga0500608_000154 3300053122 Bacteria 28470
372 Ga0500608_013256 3300053122 Bacteria 3648
373 Ga0500608_081960 3300053122 Bacteria 1521
374 Ga0500614_001436 3300053123 Bacteria 5704
375 Ga0500614_005773 3300053123 Bacteria 2599
376 Ga0500658_0002450 3300053134 Bacteria 7173
377 Ga0500658_0051394 3300053134 Bacteria 1685
378 Ga0500559_0000002 3300053136 Bacteria 262002
379 Ga0500559_0000005 3300053136 Bacteria 230231
380 Ga0500559_0001879 3300053136 Bacteria 11415
381 Ga0500559_0004143 3300053136 Bacteria 6956
382 Ga0500559_0010229 3300053136 Bacteria 4032
383 Ga0500559_0017143 3300053136 Bacteria 3057
384 Ga0500559_0041053 3300053136 Bacteria 2016
385 Ga0500559_0202564 3300053136 Bacteria 936
386 Ga0500564_000018 3300053138 Bacteria 52235
387 Ga0500573_0040977 3300053140 Bacteria 2674
388 Ga0500577_0010572 3300053142 Bacteria 2722
389 Ga0500590_007454 3300053148 Bacteria 5403
390 Ga0500603_016231 3300053150 Bacteria 1764
391 Ga0500616_0026665 3300053153 Bacteria 3196
392 Ga0500616_0066337 3300053153 Bacteria 1853
393 Ga0500616_0100637 3300053153 Bacteria 1413
394 Ga0500619_020771 3300053154 Bacteria 1882
395 Ga0500620_009524 3300053155 Bacteria 2512
396 Ga0500622_0001016 3300053156 Bacteria 23549
397 Ga0500622_0011115 3300053156 Bacteria 4916
398 Ga0500622_0015139 3300053156 Bacteria 4135
399 Ga0500622_0027830 3300053156 Bacteria 2978
400 Ga0500622_0035604 3300053156 Bacteria 2605
401 Ga0500624_003119 3300053157 Bacteria 2184
402 Ga0500633_0021348 3300053160 Bacteria 1968
403 Ga0500633_0088099 3300053160 Bacteria 1131
404 Ga0500639_095523 3300053163 Bacteria 1473
405 Ga0500636_0000923 3300053177 Bacteria 15824
406 Ga0500636_0012546 3300053177 Bacteria 4967
407 Ga0500636_0013651 3300053177 Bacteria 4773
408 Ga0500636_0169322 3300053177 Bacteria 1183
409 Ga0500637_0000997 3300053178 Bacteria 11565
410 Ga0500637_0003641 3300053178 Bacteria 7164
411 Ga0500637_0003954 3300053178 Bacteria 6933
412 Ga0500637_0019629 3300053178 Bacteria 3647
413 Ga0500576_040431 3300053725 Bacteria 2100
414 Ga0500576_141388 3300053725 Bacteria 914
415 Ga0500625_048835 3300053729 Bacteria 1963
416 Ga0500645_000566 3300053730 Bacteria 24221
417 Ga0500645_001125 3300053730 Bacteria 14567
418 Ga0500645_001571 3300053730 Bacteria 11367
419 Ga0500609_000785 3300053731 Bacteria 4757
420 Ga0500596_000724 3300053735 Bacteria 6462
421 Ga0500596_001473 3300053735 Bacteria 4758
422 Ga0500601_012862 3300053737 Bacteria 945
423 Ga0530510_0012603 3300061734 Bacteria 5943
424 2511122430 2510917020 Bacteria 5657507
425 2585147986 2582581279 Bacteria 4980720
426 2585153822 2582581280 Bacteria 5994497
427 2585198035 2582581293 Bacteria 5907401
428 2587917861 2585428106 Bacteria 5179711
429 2643750430 2643221545 Bacteria 5083237
430 2643778475 2643221552 Bacteria 5708754
431 2643924886 2643221583 Bacteria 5218014
432 2643931371 2643221584 Bacteria 5511711
433 2644226012 2643221640 Bacteria 5258820
434 2644235501 2643221642 Bacteria 5357871
435 2644507320 2643221691 Bacteria 5093099
436 2644747341 2643221736 Bacteria 6608466
437 2792462774 2791355048 Bacteria 5832535
438 2819537997 2818991435 Bacteria 5433759
439 2819648442 2818991454 Bacteria 5563326
440 2841761898 2841760612 Bacteria 6454112
441 2841916609 2841911363 Bacteria 6173697
442 2841922506 2841917233 Bacteria 6173500
443 2843749498 2843744320 Bacteria 5659202
444 2844104923 2844104063 Bacteria 6440972
445 2849562461 2849560528 Bacteria 5393480
446 2849574926 2849573788 Bacteria 5421256
447 2851155713 2851153111 Bacteria 5542585
448 2851184883 2851182111 Bacteria 6047226
449 2851247911 2851246043 Bacteria 6439203
450 2857475153 2857472729 Bacteria 6568124
451 2857509103 2857504554 Bacteria 5369913
452 2883579411 2883577096 Bacteria 4709178
453 2884963357 2884960567 Bacteria 5437054
454 2884964937 2884960567 Bacteria 5437054
455 2898332259 2898329390 Bacteria 5168154
456 2928535188 2928531327 Bacteria 5101314
457 2928973225 2928972540 Bacteria 3058286
458 2941488251 2941485952 Bacteria 3591484
459 2977242998 2977240413 Bacteria 3191065
460 2980186047 2980182181 Bacteria 9454109
461 8057529935 8057529695 Bacteria 6306553
462 Ga0501047_0053208
463 SwRhRL2b_contig_1033251
464 rootH1_10001606
465 rootL2_10009547
466 Ga0006562J51391_1040738
467 Ga0006562J51391_1040739
468 Ga0055537_1021099
469 Ga0055536_1000492
470 Ga0055528_1003284
471 Ga0055530_10002951
472 Ga0055530_10003766
473 Ga0055540_1024070
474 Ga0055531_10000526
475 Ga0055531_10001323
476 Ga0055531_10001503
477 Ga0055531_10007028
478 Ga0055541_1002814
479 Ga0065165_1000089
480 Ga0065165_1000602
481 Ga0065165_1000615
482 Ga0070670_100064766
483 Ga0070666_10119359
484 Ga0070666_10201822
485 Ga0070668_100006229
486 Ga0070668_100006525
487 Ga0070671_100113386
488 Ga0070667_100000169
489 Ga0070667_100008230
490 Ga0070663_100554777
491 Ga0070684_100654636
492 Ga0068853_100216163
493 Ga0070665_100000610
494 Ga0070664_100817217
495 Ga0068856_100083863
496 Ga0068859_100009457
497 Ga0068864_100000182
498 Ga0068864_100000220
499 Ga0068864_100159005
500 Ga0068864_100376671
501 Ga0068863_100000101
502 Ga0068863_100000185
503 Ga0068863_100010741
504 Ga0068863_100342728
505 Ga0068863_100361988
506 Ga0068858_100000260
507 Ga0068858_100005192
508 Ga0068860_100000211
509 Ga0068860_100002211
510 Ga0068862_100000514
511 Ga0068862_100026586
512 Ga0075365_10149476
513 Ga0075368_10020939
514 Ga0075364_10000257
515 Ga0075362_10115414
516 Ga0075367_10002033
517 Ga0075369_10007218
518 Ga0075366_10174258
519 Ga0075366_10269351
520 Ga0075370_10118531
521 Ga0075370_10216460
522 Ga0075370_10226669
523 Ga0075428_100183654
524 Ga0075429_100067367
525 Ga0068865_100003518
526 Ga0097620_100009457
527 Ga0105240_10008146
528 Ga0105240_10016466
529 Ga0105247_10057676
530 Ga0114129_10009638
531 Ga0105248_10000685
532 Ga0105248_10013274
533 Ga0105248_10133470
534 Ga0105248_10165309
535 Ga0105248_10356436
536 Ga0105249_10001221
537 Ga0105249_10366527
538 Ga0105239_10207045
539 Ga0105239_10557786
540 Ga0157371_10002938
541 Ga0157369_10063047
542 Ga0157374_10171320
543 Ga0163162_10049558
544 Ga0163163_10049337
545 Ga0163163_10159130
546 Ga0163163_10223899
547 Ga0213872_10003853
548 Ga0213876_10000544
549 Ga0209566_100627
550 Ga0209026_1001342
551 Ga0209026_1019398
552 Ga0209233_1019891
553 Ga0209565_1002647
554 Ga0209455_1028377
555 Ga0209673_1000941
556 Ga0209673_1025428
557 Ga0209130_1000087
558 Ga0209675_1007043
559 Ga0209676_1000057
560 Ga0209676_1000468
561 Ga0209025_1001185
562 Ga0209025_1017267
563 Ga0209025_1031095
564 Ga0209564_1000818
565 Ga0209564_1008755
566 Ga0209758_1001974
567 Ga0209758_1008396
568 Ga0209050_1000098
569 Ga0209050_1000486
570 Ga0209050_1000522
571 Ga0209050_1022224
572 Ga0209050_1053425
573 Ga0209256_1000641
574 Ga0209256_1004707
575 Ga0209256_1005553
576 Ga0207426_1026477
577 Ga0209051_1036036
578 Ga0209257_1000235
579 Ga0209257_1000350
580 Ga0209257_1000520
581 Ga0209257_1001269
582 Ga0209257_1015918
583 Ga0207680_10049955
584 Ga0207705_10339660
585 Ga0207654_10358291
586 Ga0207695_10001222
587 Ga0207695_10017426
588 Ga0207694_10602971
589 Ga0207694_10878890
590 Ga0207650_10000160
591 Ga0207650_10307073
592 Ga0207644_10178900
593 Ga0207704_10000680
594 Ga0207711_10028739
595 Ga0207711_10058478
596 Ga0207711_10206467
597 Ga0207711_10459954
598 Ga0207712_10000203
599 Ga0207712_10133775
600 Ga0207668_10000116
601 Ga0207668_10030398
602 Ga0207658_10000341
603 Ga0207658_10011222
604 Ga0207703_10000113
605 Ga0207703_10003627
606 Ga0207703_10098925
607 Ga0207639_10862855
608 Ga0207678_10380836
609 Ga0207678_10553633
610 Ga0207702_10124634
611 Ga0207641_10000109
612 Ga0207641_10005917
613 Ga0207641_10007409
614 Ga0207641_10048774
615 Ga0207676_10000337
616 Ga0207676_10000588
617 Ga0207676_10333249
618 Ga0207675_100046221
619 Ga0207675_100707847
620 Ga0268266_10561452
621 Ga0268265_10002154
622 Ga0268264_10000270
623 Ga0268264_10367226
624 Ga0265319_1107584
625 Ga0265318_10084373
626 Ga0307517_10001670
627 Ga0307517_10032853
628 Ga0307517_10151375
629 Ga0307515_10032462
630 Ga0307515_10034337
631 Ga0307515_10125610
632 Ga0265338_10020391
633 Ga0265338_10025565
634 Ga0265338_10085751
635 Ga0265338_10099785
636 Ga0265338_10180698
637 Ga0265324_10049320
638 Ga0265328_10000812
639 Ga0265328_10041171
640 Ga0265320_10091249
641 Ga0265327_10017720
642 Ga0265327_10062736
643 Ga0307513_10004606
644 Ga0265314_10239850
645 Ga0307516_10000022
646 Ga0307405_10155522
647 Ga0307416_100319115
648 Ga0307414_10018647
649 Ga0307414_10075260
650 Ga0307414_10223003
651 Ga0307411_10101058
652 Ga0307510_10019492
653 Ga0373944_0034969
654 Ga0373927_0013837
655 Ga0373925_0000760
656 Ga0395899_0000003
657 Ga0395899_0000516
658 Ga0395899_0001452
659 Ga0395899_0002510
660 Ga0395899_0116065
661 Ga0395900_0000010
662 Ga0395898_0002619
663 Ga0395905_0147882
664 Ga0436364_1236068
665 Ga0436364_1562220
666 Ga0395901_0000007
667 Ga0237819_08123
668 Ga0436365_1544656
669 Ga0436361_0064356
670 Ga0436363_0406098
671 Ga0436362_0966972
672 Ga0439435_0006182
673 Ga0466965_0060547
674 Ga0466966_0047836
675 Ga0453684_0209930
676 Ga0453684_0234750
677 Ga0453684_0478082
678 Ga0453684_0512899
679 Ga0466971_0308242
680 Ga0466968_0085866
681 Ga0466959_0003037
682 Ga0466959_0020496
683 Ga0451576_0000058
684 Ga0495590_0006738
685 Ga0495629_0037061
686 Ga0495629_0294681
687 Ga0495638_0000419
688 Ga0495638_0000443
689 Ga0495638_0002701
690 Ga0495638_0019659
691 Ga0495650_0000007
692 Ga0495650_0026021
693 Ga0495650_0124336
694 Ga0495583_0000037
695 Ga0495583_0136595
696 Ga0495606_0001606
697 Ga0495606_0081722
698 Ga0495606_0087496
699 Ga0495606_0153099
700 Ga0495606_0259839
701 Ga0495610_0000040
702 Ga0495610_0003437
703 Ga0495616_0000026
704 Ga0495620_0020050
705 Ga0495620_0022786
706 Ga0495631_0007680
707 Ga0495632_0004616
708 Ga0495632_0013381
709 Ga0495632_0034618
710 Ga0495637_0010129
711 Ga0495637_0011340
712 Ga0495643_0004412
713 Ga0495648_0000068
714 Ga0495654_0000095
715 Ga0495609_0071528
716 Ga0495609_0072879
717 Ga0495609_0095937
718 Ga0495597_0005410
719 Ga0495597_0006234
720 Ga0495597_0016365
721 Ga0495622_0000804
722 Ga0495633_0002973
723 Ga0495668_0000019
724 Ga0495668_0018873
725 Ga0495668_0037233
726 Ga0495668_0175065
727 Ga0495611_0001049
728 Ga0495625_0000080
729 Ga0495625_0000759
730 Ga0495625_0000793
731 Ga0495625_0013830
732 Ga0495625_0073911
733 Ga0495625_0137256
734 Ga0495599_0348233
735 Ga0495669_0022824
736 Ga0495669_0180754
737 Ga0495613_0003661
738 Ga0495613_0114214
739 Ga0495671_0032336
740 Ga0495671_0093056
741 Ga0495649_0000928
742 Ga0495660_0001672
743 Ga0495660_0019582
744 Ga0495660_0106441
745 Ga0495672_0002465
746 Ga0495672_0073275
747 Ga0495683_0076173
748 Ga0495687_040951
749 Ga0495673_0000132
750 Ga0495673_0003359
751 Ga0495681_0027795
752 Ga0495686_0000617
753 Ga0495686_0012381
754 Ga0495686_0040540
755 Ga0495686_0151438
756 Ga0495593_0024086
757 Ga0496102_0050630
758 Ga0496102_0083525
759 Ga0496103_0463438
760 Ga0496106_0045878
761 Ga0496106_0556840
762 Ga0496107_0000023
763 Ga0496107_0228297
764 Ga0496111_0122981
765 Ga0496115_0042016
766 Ga0496115_0410857
767 Ga0496115_0717676
768 Ga0496116_0107799
769 Ga0496119_0047442
770 Ga0496121_0000009
771 Ga0496121_0001031
772 Ga0496124_0014207
773 Ga0496125_0000481
774 Ga0496125_0002840
775 Ga0496125_0073185
776 Ga0496126_0022224
777 Ga0496126_0200258
778 Ga0495678_001686
779 Ga0501033_0429051
780 Ga0501034_0846645
781 Ga0501047_0012301
782 Ga0501047_0203312
783 Ga0501047_0326588
784 Ga0501238_001946
785 Ga0501238_005737
786 Ga0501035_0217067
787 Ga0501044_0068331
788 nmdc:mga00v17_436_c1
789 nmdc:mga0yw44_110499_c1
790 nmdc:mga0k408_106040_c1
791 nmdc:mga0k408_213293_c1
792 nmdc:mga0k408_75081_c1
793 nmdc:mga06z11_27994_c1
794 nmdc:mga07m45_138263_c1
795 nmdc:mga07m45_268780_c1
796 nmdc:mga07m45_340_c1
797 nmdc:mga05p37_24481_c1
798 nmdc:mga09592_78745_c1
799 nmdc:mga0sz30_4001_c1
800 Ga0500635_0000107
801 Ga0500635_0000131
802 Ga0500578_0002245
803 Ga0500578_0176383
804 Ga0500643_000233
805 Ga0500643_007205
806 Ga0500644_0000015
807 Ga0500644_0019867
808 Ga0500647_0006311
809 Ga0500647_0013773
810 Ga0500583_0008213
811 Ga0500651_0017672
812 Ga0500651_0066558
813 Ga0500566_0006578
814 Ga0500566_0056532
815 Ga0500641_0000807
816 Ga0500641_0006587
817 Ga0500554_012967
818 Ga0500556_0000178
819 Ga0500556_0004634
820 Ga0500557_002030
821 Ga0500562_001309
822 Ga0500562_008560
823 Ga0500562_027778
824 Ga0500569_000805
825 Ga0500569_001888
826 Ga0500594_0000362
827 Ga0500594_0117074
828 Ga0500595_000877
829 Ga0500595_001682
830 Ga0500595_028144
831 Ga0500607_208957
832 Ga0500608_000154
833 Ga0500608_013256
834 Ga0500608_081960
835 Ga0500614_001436
836 Ga0500614_005773
837 Ga0500658_0002450
838 Ga0500658_0051394
839 Ga0500559_0000002
840 Ga0500559_0000005
841 Ga0500559_0001879
842 Ga0500559_0004143
843 Ga0500559_0010229
844 Ga0500559_0017143
845 Ga0500559_0041053
846 Ga0500559_0202564
847 Ga0500564_000018
848 Ga0500573_0040977
849 Ga0500577_0010572
850 Ga0500590_007454
851 Ga0500603_016231
852 Ga0500616_0026665
853 Ga0500616_0066337
854 Ga0500616_0100637
855 Ga0500619_020771
856 Ga0500620_009524
857 Ga0500622_0001016
858 Ga0500622_0011115
859 Ga0500622_0015139
860 Ga0500622_0027830
861 Ga0500622_0035604
862 Ga0500624_003119
863 Ga0500633_0021348
864 Ga0500633_0088099
865 Ga0500639_095523
866 Ga0500636_0000923
867 Ga0500636_0012546
868 Ga0500636_0013651
869 Ga0500636_0169322
870 Ga0500637_0000997
871 Ga0500637_0003641
872 Ga0500637_0003954
873 Ga0500637_0019629
874 Ga0500576_040431
875 Ga0500576_141388
876 Ga0500625_048835
877 Ga0500645_000566
878 Ga0500645_001125
879 Ga0500645_001571
880 Ga0500609_000785
881 Ga0500596_000724
882 Ga0500596_001473
883 Ga0500601_012862
884 Ga0530510_0012603
885 2511122430
886 2585147986
887 2585153822
888 2585198035
889 2587917861
890 2643750430
891 2643778475
892 2643924886
893 2643931371
894 2644226012
895 2644235501
896 2644507320
897 2644747341
898 2792462774
899 2819537997
900 2819648442
901 2841761898
902 2841916609
903 2841922506
904 2843749498
905 2844104923
906 2849562461
907 2849574926
908 2851155713
909 2851184883
910 2851247911
911 2857475153
912 2857509103
913 2883579411
914 2884963357
915 2884964937
916 2898332259
917 2928535188
918 2928973225
919 2941488251
920 2977242998
921 2980186047
922 8057529935

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

151

227

0.98

PF00072

Response_reg

Response regulator receiver domain

7

116

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9893 6 122
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9886 6 122
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9876 6 122
1zh4-assembly1.cif.gz_A crystal structure of the mg+2/bef3-bound receiver domain of kdp potassium transport system response regulator kdpe 0.9823 6 123
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9797 6 123
ID Description Score Start End Superfamily
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9989 6 81 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9879 6 81 3.40.50.2300
af_P9WGM7_2_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9875 6 81 3.40.50.2300
af_Q2FWH6_1_124_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9832 6 124 3.40.50.2300
1nxoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9743 6 123 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1U1M754-F1-model_v4 deleted 0.8602 27 228
AF-A0A7C4KIW9-F1-model_v4 Response regulator transcription factor 0.8568 1 174 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A2U3MV66-F1-model_v4 KDP operon transcriptional regulatory protein KdpE 0.8555 3 227 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-B0T7K3-F1-model_v4 Two component transcriptional regulator, winged helix family 0.8472 42 226 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A2U3MV66-F1-model_v4 KDP operon transcriptional regulatory protein KdpE 0.8422 3 227 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map