F448819

General Info

Members Datasets Scaffolds Average Seq Length
461 285 461 210

Family's Representative Sequence

Representative Sequence 3300050514|nmdc:mga08x19_1357_c1|nmdc:mga08x19_1357_c1_910_1626
Length 238
Sequence MSPDAKSARSPSKTSTSQSAHRRLPRVLRIVRARPRLFIAAALGTVVGVALPAEWRPVMRVLIGWDTCVVIYLALALQAMADCDIARMRRRAAQLDEDRIAFLVLPALAALASLGAIVAELGAKDAAHAPAHLALALATIILSWAFTHTIFALHYAHEFYIEARAEDGGLAFPGKQQPDYWDFLYFSLVIGMTSQVSDVAVTAQSVRRTVAAHGVVSFFFNATLLALMVNIAAGALAG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
160 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
161 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
162 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
163 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
164 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
165 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
166 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
167 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
174 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
175 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
176 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
177 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
178 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
179 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
180 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
182 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
183 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
184 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
188 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
199 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
202 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
203 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
212 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
213 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
214 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
217 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
218 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
219 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
220 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
221 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
226 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
227 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
232 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
233 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
259 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
260 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
261 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
268 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
269 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
270 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
271 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
272 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
273 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
277 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
278 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
279 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
280 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
281 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
282 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
285 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.42
Nodule 0
Rhizoplane 8.03
Rhizosphere 85.25
Stem 0
Stem Tuber 0
Unclassified 1.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10055099 3300005327 Bacteria 3230
2 Ga0070658_10115781 3300005327 Bacteria 2224
3 Ga0070676_10059345 3300005328 Bacteria 2269
4 Ga0070676_10256347 3300005328 Bacteria 1169
5 Ga0070690_100010821 3300005330 Bacteria 5321
6 Ga0070690_100614953 3300005330 Bacteria 826
7 Ga0070670_100743992 3300005331 Unclassified 883
8 Ga0068869_100007595 3300005334 Bacteria 6938
9 Ga0068869_100314111 3300005334 Bacteria 1269
10 Ga0068868_100038216 3300005338 Plasmid 3726
11 Ga0068868_100154574 3300005338 Bacteria 1891
12 Ga0070660_100302808 3300005339 Bacteria 1311
13 Ga0070689_100019555 3300005340 Bacteria 5010
14 Ga0070691_10185947 3300005341 Bacteria 1084
15 Ga0070687_100006064 3300005343 Bacteria 4931
16 Ga0070687_100027699 3300005343 Bacteria 2741
17 Ga0070692_10118823 3300005345 Bacteria 1471
18 Ga0070668_100462860 3300005347 Bacteria 1092
19 Ga0070669_100097180 3300005353 Bacteria 2216
20 Ga0070669_100127630 3300005353 Bacteria 1948
21 Ga0070669_100262379 3300005353 Bacteria 1379
22 Ga0070669_100335939 3300005353 Bacteria 1223
23 Ga0070675_100040621 3300005354 Bacteria 3798
24 Ga0070675_100112644 3300005354 Bacteria 2304
25 Ga0070671_100088307 3300005355 Bacteria 2594
26 Ga0070671_100172853 3300005355 Bacteria 1827
27 Ga0070674_100085149 3300005356 Bacteria 2268
28 Ga0070674_100334239 3300005356 Bacteria 1218
29 Ga0070674_100385649 3300005356 Bacteria 1141
30 Ga0070674_100666300 3300005356 Bacteria 886
31 Ga0070673_100379790 3300005364 Bacteria 1259
32 Ga0070688_100098053 3300005365 Bacteria 1927
33 Ga0070659_100612548 3300005366 Bacteria 936
34 Ga0070667_100230043 3300005367 Unclassified 1653
35 Ga0070667_100483691 3300005367 Bacteria 1133
36 Ga0070713_100190276 3300005436 Bacteria 1849
37 Ga0070713_100695108 3300005436 Bacteria 971
38 Ga0070713_100941016 3300005436 Unclassified 832
39 Ga0070710_10164414 3300005437 Bacteria 1379
40 Ga0070701_10042285 3300005438 Bacteria 2325
41 Ga0070700_100482541 3300005441 Bacteria 950
42 Ga0070694_100608381 3300005444 Bacteria 881
43 Ga0070708_100038350 3300005445 Bacteria 4186
44 Ga0070708_100064690 3300005445 Bacteria 3277
45 Ga0070678_100035721 3300005456 Bacteria 3473
46 Ga0070678_100454486 3300005456 Unclassified 1122
47 Ga0070662_100727105 3300005457 Unclassified 841
48 Ga0070681_10018284 3300005458 Bacteria 7006
49 Ga0068867_100083532 3300005459 Bacteria 2411
50 Ga0068867_100107087 3300005459 Bacteria 2142
51 Ga0070685_10006291 3300005466 Bacteria 6051
52 Ga0070706_100034351 3300005467 Bacteria 4684
53 Ga0070706_100522047 3300005467 Bacteria 1105
54 Ga0070707_100054696 3300005468 Bacteria 3827
55 Ga0070707_100128742 3300005468 Bacteria 2460
56 Ga0070698_100004886 3300005471 Bacteria 14713
57 Ga0070698_100278636 3300005471 Bacteria 1604
58 Ga0070699_100005366 3300005518 Bacteria 11242
59 Ga0070699_100405612 3300005518 Bacteria 1233
60 Ga0070679_100053825 3300005530 Bacteria 4006
61 Ga0070697_100005980 3300005536 Bacteria 9407
62 Ga0068853_100705329 3300005539 Bacteria 963
63 Ga0070672_100388550 3300005543 Bacteria 1195
64 Ga0070686_100244563 3300005544 Bacteria 1308
65 Ga0070686_100335858 3300005544 Bacteria 1131
66 Ga0070695_100086845 3300005545 Bacteria 2080
67 Ga0070696_100253289 3300005546 Bacteria 1332
68 Ga0070693_100322028 3300005547 Bacteria 1049
69 Ga0070665_100262869 3300005548 Bacteria 1727
70 Ga0070665_100389176 3300005548 Bacteria 1402
71 Ga0070704_100228072 3300005549 Bacteria 1518
72 Ga0068855_100000490 3300005563 Bacteria 48844
73 Ga0070664_100728059 3300005564 Bacteria 925
74 Ga0068857_100083172 3300005577 Bacteria 2859
75 Ga0068857_100835690 3300005577 Bacteria 881
76 Ga0068856_100609286 3300005614 Bacteria 1113
77 Ga0070702_100204715 3300005615 Bacteria 1309
78 Ga0068852_100483956 3300005616 Bacteria 1230
79 Ga0068852_100758884 3300005616 Bacteria 982
80 Ga0068859_100039120 3300005617 Bacteria 4757
81 Ga0068859_100132355 3300005617 Bacteria 2566
82 Ga0068864_100061132 3300005618 Bacteria 3263
83 Ga0068864_100278721 3300005618 Bacteria 1560
84 Ga0068864_100281434 3300005618 Bacteria 1552
85 Ga0068866_10151746 3300005718 Bacteria 1342
86 Ga0068861_100127274 3300005719 Bacteria 2063
87 Ga0068861_100293100 3300005719 Bacteria 1406
88 Ga0068863_100022927 3300005841 Bacteria 5966
89 Ga0068863_100955005 3300005841 Bacteria 859
90 Ga0068858_100129354 3300005842 Bacteria 2366
91 Ga0068860_100256607 3300005843 Bacteria 1703
92 Ga0068862_100010983 3300005844 Bacteria 7478
93 Ga0068862_100752646 3300005844 Unclassified 948
94 Ga0081455_10030484 3300005937 Bacteria 4897
95 Ga0081455_10143213 3300005937 Bacteria 1853
96 Ga0081538_10002854 3300005981 Bacteria 16521
97 Ga0081538_10034218 3300005981 Bacteria 3363
98 Ga0081540_1054033 3300005983 Bacteria 1965
99 Ga0081539_10056597 3300005985 Bacteria 2175
100 Ga0070717_10142541 3300006028 Bacteria 2068
101 Ga0070717_10271658 3300006028 Bacteria 1502
102 Ga0075365_10001359 3300006038 Bacteria 10973
103 Ga0075365_10150259 3300006038 Bacteria 1620
104 Ga0075368_10135713 3300006042 Bacteria 1024
105 Ga0075363_100285515 3300006048 Bacteria 956
106 Ga0070715_10091184 3300006163 Bacteria 1403
107 Ga0070716_100216590 3300006173 Bacteria 1283
108 Ga0070716_100253625 3300006173 Bacteria 1200
109 Ga0070712_100188261 3300006175 Bacteria 1613
110 Ga0070712_100606398 3300006175 Bacteria 927
111 Ga0075362_10125569 3300006177 Bacteria 1217
112 Ga0075367_10053344 3300006178 Bacteria 2395
113 Ga0075367_10227156 3300006178 Bacteria 1169
114 Ga0075369_10290774 3300006186 Bacteria 762
115 Ga0075366_10022896 3300006195 Bacteria 3637
116 Ga0075366_10040610 3300006195 Bacteria 2752
117 Ga0075366_10108919 3300006195 Bacteria 1666
118 Ga0097621_100005768 3300006237 Bacteria 8740
119 Ga0097621_100615138 3300006237 Unclassified 994
120 Ga0097621_100709418 3300006237 Bacteria 927
121 Ga0068871_100447069 3300006358 Bacteria 1158
122 Ga0075428_100112286 3300006844 Bacteria 2968
123 Ga0075428_100181760 3300006844 Bacteria 2276
124 Ga0075434_100013807 3300006871 Bacteria 7701
125 Ga0075434_100026845 3300006871 Bacteria 5648
126 Ga0075434_100153262 3300006871 Bacteria 2325
127 Ga0075434_100673671 3300006871 Unclassified 1052
128 Ga0068865_100171746 3300006881 Bacteria 1663
129 Ga0068865_100400168 3300006881 Bacteria 1124
130 Ga0068865_100625019 3300006881 Unclassified 913
131 Ga0075436_100395339 3300006914 Bacteria 1001
132 Ga0097620_100039121 3300006931 Bacteria 4757
133 Ga0097620_100132350 3300006931 Bacteria 2566
134 Ga0075435_100159311 3300007076 Bacteria 1900
135 Ga0075435_100291275 3300007076 Bacteria 1395
136 Ga0075435_100399997 3300007076 Unclassified 1181
137 Ga0099795_10009343 3300007788 Bacteria 2841
138 Ga0105251_10134873 3300009011 Bacteria 1118
139 Ga0105244_10183058 3300009036 Bacteria 993
140 Ga0111539_11203367 3300009094 Bacteria 880
141 Ga0105245_10085585 3300009098 Bacteria 2890
142 Ga0105245_10384308 3300009098 Bacteria 1399
143 Ga0105245_10507723 3300009098 Bacteria 1223
144 Ga0105247_10152842 3300009101 Bacteria 1522
145 Ga0105243_10220115 3300009148 Bacteria 1677
146 Ga0105243_10377600 3300009148 Bacteria 1310
147 Ga0105243_10518016 3300009148 Unclassified 1133
148 Ga0105241_10580925 3300009174 Bacteria 1010
149 Ga0105242_10478829 3300009176 Bacteria 1179
150 Ga0105242_10741329 3300009176 Bacteria 966
151 Ga0105248_10002898 3300009177 Bacteria 19034
152 Ga0105248_10021568 3300009177 Bacteria 7135
153 Ga0105248_10311931 3300009177 Bacteria 1771
154 Ga0105237_10132728 3300009545 Bacteria 2484
155 Ga0105237_10613764 3300009545 Bacteria 1094
156 Ga0105238_10125713 3300009551 Bacteria 2543
157 Ga0105238_10536808 3300009551 Bacteria 1173
158 Ga0105249_10313108 3300009553 Bacteria 1579
159 Ga0105249_10405081 3300009553 Bacteria 1395
160 Ga0105239_10163399 3300010375 Bacteria 2489
161 Ga0105239_10266529 3300010375 Bacteria 1926
162 Ga0105239_11131220 3300010375 Bacteria 902
163 Ga0105246_10023189 3300011119 Bacteria 4013
164 Ga0157370_10018965 3300013104 Bacteria 6917
165 Ga0157374_10740444 3300013296 Bacteria 997
166 Ga0157378_10047051 3300013297 Unclassified 3835
167 Ga0157378_10293652 3300013297 Bacteria 1571
168 Ga0157378_10503601 3300013297 Bacteria 1210
169 Ga0163162_10077518 3300013306 Bacteria 3388
170 Ga0163162_10747135 3300013306 Bacteria 1098
171 Ga0157372_10863844 3300013307 Bacteria 1050
172 Ga0157375_10184089 3300013308 Bacteria 2241
173 Ga0163163_10010340 3300014325 Bacteria 8384
174 Ga0157380_10308459 3300014326 Bacteria 1461
175 Ga0157380_10583506 3300014326 Bacteria 1103
176 Ga0157380_10857701 3300014326 Bacteria 930
177 Ga0157379_10130282 3300014968 Bacteria 2263
178 Ga0157379_10262427 3300014968 Bacteria 1570
179 Ga0157376_10026378 3300014969 Unclassified 4591
180 Ga0157376_10153214 3300014969 Bacteria 2081
181 Ga0213875_10000036 3300021388 Bacteria 166707
182 Ga0209758_1000921 3300025297 Bacteria 39784
183 Ga0207697_10063765 3300025315 Bacteria 1536
184 Ga0207710_10218478 3300025900 Bacteria 946
185 Ga0207688_10001807 3300025901 Bacteria 11384
186 Ga0207680_10033521 3300025903 Bacteria 2930
187 Ga0207680_10129628 3300025903 Bacteria 1661
188 Ga0207680_10404997 3300025903 Unclassified 964
189 Ga0207680_10611987 3300025903 Bacteria 779
190 Ga0207647_10063640 3300025904 Bacteria 2243
191 Ga0207685_10010784 3300025905 Bacteria 2717
192 Ga0207645_10033010 3300025907 Bacteria 3327
193 Ga0207643_10000613 3300025908 Bacteria 22494
194 Ga0207684_10001023 3300025910 Bacteria 31386
195 Ga0207684_10464854 3300025910 Bacteria 1086
196 Ga0207654_10447658 3300025911 Bacteria 905
197 Ga0207707_10065413 3300025912 Bacteria 3167
198 Ga0207663_10116148 3300025916 Bacteria 1824
199 Ga0207662_10002982 3300025918 Bacteria 8619
200 Ga0207662_10042914 3300025918 Bacteria 2667
201 Ga0207657_10195096 3300025919 Bacteria 1632
202 Ga0207649_10121443 3300025920 Bacteria 1762
203 Ga0207652_10165998 3300025921 Unclassified 1980
204 Ga0207646_10001026 3300025922 Bacteria 35667
205 Ga0207646_10046854 3300025922 Bacteria 3879
206 Ga0207681_10075004 3300025923 Bacteria 2371
207 Ga0207681_10198534 3300025923 Bacteria 1539
208 Ga0207681_10421935 3300025923 Bacteria 1081
209 Ga0207650_10812018 3300025925 Unclassified 793
210 Ga0207659_10044866 3300025926 Bacteria 3113
211 Ga0207659_10086357 3300025926 Bacteria 2333
212 Ga0207700_10183685 3300025928 Bacteria 1753
213 Ga0207700_10830897 3300025928 Bacteria 826
214 Ga0207644_10022156 3300025931 Bacteria 4338
215 Ga0207644_10158017 3300025931 Bacteria 1760
216 Ga0207690_10297243 3300025932 Bacteria 1262
217 Ga0207686_10421089 3300025934 Bacteria 1021
218 Ga0207709_10147026 3300025935 Bacteria 1627
219 Ga0207709_10201715 3300025935 Bacteria 1421
220 Ga0207670_10001838 3300025936 Bacteria 11075
221 Ga0207670_10122779 3300025936 Bacteria 1891
222 Ga0207670_10123289 3300025936 Bacteria 1887
223 Ga0207669_10060700 3300025937 Bacteria 2319
224 Ga0207669_10178298 3300025937 Bacteria 1520
225 Ga0207669_10248327 3300025937 Unclassified 1323
226 Ga0207669_10385532 3300025937 Unclassified 1093
227 Ga0207704_10036725 3300025938 Unclassified 2821
228 Ga0207704_10342235 3300025938 Bacteria 1161
229 Ga0207665_10031304 3300025939 Bacteria 3519
230 Ga0207691_10023057 3300025940 Bacteria 5864
231 Ga0207691_10060991 3300025940 Bacteria 3426
232 Ga0207711_10015412 3300025941 Bacteria 6343
233 Ga0207711_10064116 3300025941 Bacteria 3172
234 Ga0207711_10496352 3300025941 Bacteria 1137
235 Ga0207689_10009969 3300025942 Bacteria 8194
236 Ga0207689_10022751 3300025942 Bacteria 5266
237 Ga0207667_10038536 3300025949 Bacteria 5103
238 Ga0207651_10437783 3300025960 Bacteria 1119
239 Ga0207712_10307622 3300025961 Bacteria 1303
240 Ga0207668_10276943 3300025972 Bacteria 1374
241 Ga0207658_10382940 3300025986 Bacteria 1232
242 Ga0207677_10061026 3300026023 Bacteria 2609
243 Ga0207677_10101963 3300026023 Bacteria 2114
244 Ga0207677_10505000 3300026023 Bacteria 1046
245 Ga0207703_10130666 3300026035 Bacteria 2168
246 Ga0207708_10278417 3300026075 Bacteria 1355
247 Ga0207641_10766257 3300026088 Bacteria 953
248 Ga0207648_10011963 3300026089 Bacteria 8146
249 Ga0207648_10046730 3300026089 Bacteria 3795
250 Ga0207648_10559752 3300026089 Bacteria 1051
251 Ga0207648_10948208 3300026089 Unclassified 805
252 Ga0207676_10034795 3300026095 Bacteria 3816
253 Ga0207676_10075241 3300026095 Bacteria 2723
254 Ga0207674_10089000 3300026116 Bacteria 3080
255 Ga0207675_100048218 3300026118 Bacteria 3977
256 Ga0207675_100101229 3300026118 Bacteria 2714
257 Ga0207675_100112315 3300026118 Bacteria 2571
258 Ga0207683_10022345 3300026121 Bacteria 5429
259 Ga0207683_10202095 3300026121 Bacteria 1807
260 Ga0207683_10219334 3300026121 Bacteria 1733
261 Ga0207683_10258379 3300026121 Bacteria 1590
262 Ga0209813_10117973 3300027866 Bacteria 921
263 Ga0268265_10028490 3300028380 Unclassified 3999
264 Ga0268264_10458900 3300028381 Bacteria 1236
265 Ga0265332_10000089 3300031238 Bacteria 79796
266 Ga0265332_10000616 3300031238 Bacteria 23188
267 Ga0265328_10005245 3300031239 Bacteria 5567
268 Ga0265320_10047465 3300031240 Bacteria 2100
269 Ga0265320_10112239 3300031240 Bacteria 1248
270 Ga0265325_10005177 3300031241 Bacteria 8102
271 Ga0265325_10020694 3300031241 Bacteria 3623
272 Ga0265325_10105754 3300031241 Bacteria 1373
273 Ga0265329_10006809 3300031242 Bacteria 4492
274 Ga0265340_10001157 3300031247 Bacteria 15092
275 Ga0265340_10040971 3300031247 Bacteria 2279
276 Ga0265340_10065124 3300031247 Bacteria 1736
277 Ga0265339_10001689 3300031249 Bacteria 16287
278 Ga0265339_10020335 3300031249 Bacteria 3879
279 Ga0265331_10000032 3300031250 Bacteria 210525
280 Ga0265331_10054970 3300031250 Unclassified 1895
281 Ga0265316_10000104 3300031344 Bacteria 91614
282 Ga0307408_100326374 3300031548 Bacteria 1295
283 Ga0265313_10001715 3300031595 Bacteria 20184
284 Ga0265314_10000215 3300031711 Bacteria 85711
285 Ga0265314_10109518 3300031711 Unclassified 1758
286 Ga0265342_10000139 3300031712 Bacteria 81785
287 Ga0265342_10097337 3300031712 Bacteria 1680
288 Ga0307416_100701813 3300032002 Bacteria 1101
289 Ga0373930_0014678 3300034816 Bacteria 1462
290 Ga0373948_0007698 3300034817 Bacteria 1819
291 Ga0373958_0044772 3300034819 Bacteria 917
292 Ga0373959_0022595 3300034820 Bacteria 1217
293 Ga0373929_0014816 3300035085 Bacteria 1510
294 Ga0373934_0073677 3300035086 Bacteria 1367
295 Ga0373951_0134406 3300035091 Unclassified 682
296 Ga0373936_0047375 3300035113 Bacteria 1733
297 Ga0373936_0238794 3300035113 Bacteria 810
298 Ga0373939_0067248 3300035114 Bacteria 1157
299 Ga0373939_0130882 3300035114 Unclassified 895
300 Ga0373941_0131370 3300035115 Unclassified 902
301 Ga0373945_0224230 3300035116 Bacteria 787
302 Ga0373954_0118112 3300035118 Bacteria 1286
303 Ga0373954_0248626 3300035118 Bacteria 875
304 Ga0373943_0052990 3300035170 Bacteria 2002
305 Ga0373955_0163314 3300035172 Bacteria 1316
306 Ga0373961_0006333 3300035241 Bacteria 2846
307 Ga0373962_0002857 3300035242 Bacteria 4134
308 Ga0373931_0002195 3300035691 Bacteria 8620
309 Ga0373931_0002855 3300035691 Bacteria 7702
310 Ga0373931_0024442 3300035691 Bacteria 3061
311 Ga0373935_0013611 3300035692 Bacteria 4911
312 Ga0373935_0014558 3300035692 Bacteria 4747
313 Ga0373935_0187414 3300035692 Bacteria 1423
314 Ga0373935_0307555 3300035692 Bacteria 1122
315 Ga0373927_0035826 3300035695 Unclassified 3228
316 Ga0373927_0220142 3300035695 Bacteria 1247
317 Ga0373927_0302897 3300035695 Bacteria 1052
318 Ga0373927_0306473 3300035695 Bacteria 1045
319 Ga0373927_0474621 3300035695 Bacteria 826
320 Ga0373933_0160638 3300035724 Bacteria 1426
321 Ga0373933_0274911 3300035724 Bacteria 1088
322 Ga0373947_0032093 3300035725 Bacteria 3094
323 Ga0373947_0389423 3300035725 Bacteria 939
324 Ga0373937_0001940 3300036401 Bacteria 17308
325 Ga0373937_0480096 3300036401 Bacteria 1181
326 Ga0373925_0017723 3300037068 Bacteria 5167
327 Ga0373925_0036365 3300037068 Bacteria 3634
328 Ga0373925_0253097 3300037068 Unclassified 1413
329 Ga0373925_0255732 3300037068 Bacteria 1406
330 Ga0373925_0642231 3300037068 Bacteria 874
331 Ga0436364_0245439 3300037853 Bacteria 33775
332 Ga0436364_1223108 3300037853 Bacteria 3679
333 Ga0436365_1676454 3300039437 Unclassified 2576
334 Ga0436360_0355420 3300039438 Bacteria 853
335 Ga0451845_0750059 3300041501 Bacteria 1035
336 Ga0451853_0475501 3300041512 Bacteria 836
337 Ga0451577_0011400 3300042876 Bacteria 8411
338 Ga0453683_0045670 3300044673 Bacteria 2746
339 Ga0466961_0109817 3300044693 Bacteria 1736
340 Ga0453684_0062644 3300044712 Bacteria 4762
341 Ga0466957_0177553 3300044842 Bacteria 1389
342 Ga0451576_0081076 3300045051 Bacteria 3375
343 Ga0495590_0033150 3300046457 Bacteria 1806
344 Ga0495629_0020215 3300046459 Bacteria 4755
345 Ga0495641_0010843 3300046461 Bacteria 5241
346 Ga0495639_0127609 3300046475 Bacteria 1216
347 Ga0495584_0105600 3300046491 Bacteria 1424
348 Ga0495585_0025534 3300046492 Bacteria 3382
349 Ga0495585_0074855 3300046492 Bacteria 1842
350 Ga0495596_0123287 3300046500 Bacteria 1006
351 Ga0495618_0261418 3300046514 Bacteria 1084
352 Ga0495628_0090624 3300046516 Bacteria 2367
353 Ga0495637_0144753 3300046520 Bacteria 900
354 Ga0495637_0167948 3300046520 Bacteria 820
355 Ga0495652_0531988 3300046529 Bacteria 811
356 Ga0495665_0202396 3300046531 Bacteria 1029
357 Ga0495640_0095896 3300046533 Bacteria 1952
358 Ga0495598_0068137 3300046537 Bacteria 1114
359 Ga0495659_0099594 3300046664 Bacteria 1124
360 Ga0495599_0230856 3300046678 Bacteria 1130
361 Ga0495658_0167998 3300046683 Bacteria 1356
362 Ga0495613_0186124 3300046689 Bacteria 1469
363 Ga0495671_0056723 3300046692 Bacteria 1939
364 Ga0495649_0203756 3300046694 Bacteria 1027
365 Ga0495660_0249021 3300046810 Bacteria 825
366 Ga0495581_0058775 3300047315 Bacteria 2221
367 Ga0495674_0338589 3300047319 Bacteria 1223
368 Ga0495674_0349159 3300047319 Bacteria 1201
369 Ga0495674_0448262 3300047319 Bacteria 1037
370 Ga0495680_0107756 3300047322 Bacteria 2069
371 Ga0495675_0075860 3300047444 Bacteria 2119
372 Ga0495593_0078192 3300047673 Unclassified 1714
373 Ga0495602_0038047 3300048088 Bacteria 4455
374 Ga0495602_0298724 3300048088 Bacteria 1179
375 Ga0496100_0007392 3300048903 Bacteria 6060
376 Ga0496100_0703921 3300048903 Bacteria 788
377 Ga0496101_0001698 3300048904 Bacteria 13177
378 Ga0496101_0451185 3300048904 Bacteria 1014
379 Ga0496102_0006852 3300048905 Bacteria 9724
380 Ga0496102_0794924 3300048905 Unclassified 868
381 Ga0496103_0227144 3300048906 Bacteria 1200
382 Ga0496103_0302388 3300048906 Unclassified 1029
383 Ga0496104_0004221 3300048907 Bacteria 12478
384 Ga0496104_0231863 3300048907 Bacteria 1758
385 Ga0496105_0020192 3300048908 Bacteria 5380
386 Ga0496105_0024665 3300048908 Bacteria 4887
387 Ga0496105_0071009 3300048908 Bacteria 2878
388 Ga0496106_0003354 3300048909 Bacteria 11939
389 Ga0496106_0016334 3300048909 Bacteria 5492
390 Ga0496106_0187348 3300048909 Bacteria 1644
391 Ga0496107_0003003 3300048910 Bacteria 11176
392 Ga0496107_0103514 3300048910 Bacteria 2088
393 Ga0496107_0400219 3300048910 Bacteria 1021
394 Ga0496107_0510647 3300048910 Unclassified 891
395 Ga0496108_0006129 3300048911 Bacteria 9726
396 Ga0496108_0007574 3300048911 Bacteria 8793
397 Ga0496108_0246050 3300048911 Bacteria 1555
398 Ga0496109_0038830 3300048912 Bacteria 4306
399 Ga0496109_0116188 3300048912 Bacteria 2490
400 Ga0496109_0797360 3300048912 Bacteria 882
401 Ga0496110_0003430 3300048913 Bacteria 12132
402 Ga0496110_0037247 3300048913 Bacteria 4227
403 Ga0496111_0041160 3300048914 Bacteria 3315
404 Ga0496111_0128129 3300048914 Bacteria 1877
405 Ga0496112_0087727 3300048915 Bacteria 3078
406 Ga0496112_0113340 3300048915 Bacteria 2682
407 Ga0496113_0186965 3300048916 Bacteria 1643
408 Ga0496113_0202325 3300048916 Bacteria 1578
409 Ga0496114_0029829 3300048917 Bacteria 4484
410 Ga0496114_0146378 3300048917 Bacteria 2048
411 Ga0496115_0360023 3300048918 Bacteria 1185
412 Ga0501033_0055821 3300049570 Bacteria 2919
413 Ga0501034_0064129 3300049571 Bacteria 3688
414 Ga0501034_0082996 3300049571 Bacteria 3206
415 Ga0501036_0006160 3300049572 Bacteria 9729
416 Ga0501038_0001565 3300049574 Bacteria 21184
417 Ga0501038_0061334 3300049574 Bacteria 3216
418 Ga0501042_0053479 3300049578 Bacteria 2881
419 Ga0501043_0012827 3300049579 Bacteria 6549
420 Ga0501046_0017926 3300049580 Bacteria 5901
421 Ga0501047_0110532 3300049581 Bacteria 2631
422 Ga0501069_0001963 3300049585 Bacteria 10267
423 Ga0501071_0009884 3300049587 Bacteria 6371
424 Ga0501074_0018888 3300049590 Bacteria 5006
425 Ga0501077_0340134 3300049593 Unclassified 957
426 Ga0501079_0036323 3300049741 Bacteria 3796
427 Ga0501080_0020553 3300049742 Bacteria 6114
428 Ga0501083_0000817 3300049744 Bacteria 20380
429 Ga0501035_0050063 3300049822 Bacteria 3744
430 Ga0501035_0479717 3300049822 Bacteria 1026
431 Ga0501044_0000509 3300049823 Bacteria 47320
432 Ga0501045_0047633 3300049824 Bacteria 3123
433 nmdc:mga03683_197188_c1 3300050489 Bacteria 923
434 nmdc:mga0yw44_10992_c1 3300050492 Bacteria 4647
435 nmdc:mga0yw44_26339_c1 3300050492 Bacteria 3320
436 nmdc:mga0k408_53649_c1 3300050493 Bacteria 2337
437 nmdc:mga0k408_61425_c1 3300050493 Bacteria 2184
438 nmdc:mga0k408_73074_c1 3300050493 Bacteria 2003
439 nmdc:mga06z11_161812_c1 3300050494 Bacteria 1280
440 nmdc:mga06z11_35075_c1 3300050494 Bacteria 1081
441 nmdc:mga06z11_3813_c1 3300050494 Bacteria 5872
442 nmdc:mga07m45_372051_c1 3300050496 Bacteria 830
443 nmdc:mga06r32_431764_c1 3300050510 Bacteria 1298
444 nmdc:mga08y16_331592_c1 3300050511 Bacteria 1565
445 nmdc:mga0n895_151047_c1 3300050512 Bacteria 2353
446 nmdc:mga0n895_646931_c1 3300050512 Unclassified 1056
447 nmdc:mga0n895_6815_c1 3300050512 Bacteria 9754
448 nmdc:mga0rr50_42377_c1 3300050513 Bacteria 3323
449 nmdc:mga08x19_1357_c1 3300050514 Bacteria 15172
450 nmdc:mga0sz30_226992_c1 3300050516 Bacteria 830
451 Ga0495601_0001331 3300053077 Bacteria 13569
452 Ga0495601_0280443 3300053077 Bacteria 1086
453 Ga0495612_0041712 3300053078 Bacteria 1872
454 Ga0495655_0007229 3300053083 Bacteria 2055
455 Ga0495595_0111926 3300053084 Bacteria 1324
456 Ga0495619_0019233 3300053085 Bacteria 4340
457 Ga0495619_0020949 3300053085 Bacteria 4170
458 Ga0495619_0181263 3300053085 Bacteria 1457
459 Ga0495619_0363557 3300053085 Unclassified 1000
460 Ga0500552_002709 3300053733 Unclassified 1744
461 Ga0501084_0053593 3300054114 Bacteria 3374

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046492 Ga0495585_0025534 Ga0495585_0025534_747_1421 169
2 3300046537 Ga0495598_0068137 Ga0495598_0068137_371_1045 169
3 3300046692 Ga0495671_0056723 Ga0495671_0056723_915_1589 169
4 3300046461 Ga0495641_0010843 Ga0495641_0010843_1089_1763 178
5 3300005616 Ga0068852_100758884 Ga0068852_1007588842 179
6 3300005618 Ga0068864_100281434 Ga0068864_1002814342 179
7 3300005843 Ga0068860_100256607 Ga0068860_1002566072 179
8 3300006237 Ga0097621_100709418 Ga0097621_1007094182 179
9 3300009011 Ga0105251_10134873 Ga0105251_101348732 179
10 3300009036 Ga0105244_10183058 Ga0105244_101830581 179
11 3300009098 Ga0105245_10507723 Ga0105245_105077231 179
12 3300009174 Ga0105241_10580925 Ga0105241_105809251 179
13 3300009176 Ga0105242_10741329 Ga0105242_107413292 179
14 3300009177 Ga0105248_10311931 Ga0105248_103119312 179
15 3300025900 Ga0207710_10218478 Ga0207710_102184781 179
16 3300025901 Ga0207688_10001807 Ga0207688_100018074 179
17 3300025916 Ga0207663_10116148 Ga0207663_101161482 179
18 3300025918 Ga0207662_10002982 Ga0207662_100029821 179
19 3300025923 Ga0207681_10421935 Ga0207681_104219352 179
20 3300025931 Ga0207644_10158017 Ga0207644_101580172 179
21 3300025941 Ga0207711_10496352 Ga0207711_104963521 179
22 3300025960 Ga0207651_10437783 Ga0207651_104377831 179
23 3300026023 Ga0207677_10505000 Ga0207677_105050002 179
24 3300026118 Ga0207675_100048218 Ga0207675_1000482184 179
25 3300041512 Ga0451853_0475501 Ga0451853_0475501_195_821 179
26 3300048903 Ga0496100_0703921 Ga0496100_0703921_122_748 179
27 3300048904 Ga0496101_0451185 Ga0496101_0451185_38_664 179
28 3300048906 Ga0496103_0227144 Ga0496103_0227144_124_750 179
29 3300048908 Ga0496105_0024665 Ga0496105_0024665_2633_3259 179
30 3300048909 Ga0496106_0003354 Ga0496106_0003354_11084_11710 179
31 3300048910 Ga0496107_0003003 Ga0496107_0003003_6927_7553 179
32 3300048911 Ga0496108_0006129 Ga0496108_0006129_5450_6076 179
33 3300048912 Ga0496109_0797360 Ga0496109_0797360_40_666 179
34 3300048913 Ga0496110_0037247 Ga0496110_0037247_2855_3481 179
35 3300048916 Ga0496113_0202325 Ga0496113_0202325_494_1120 179
36 3300050511 nmdc:mga08y16_331592_c1 nmdc:mga08y16_331592_c1_330_956 179
37 3300046492 Ga0495585_0074855 Ga0495585_0074855_119_745 181
38 3300046810 Ga0495660_0249021 Ga0495660_0249021_81_707 181
39 3300025940 Ga0207691_10023057 Ga0207691_100230576 183
40 3300046459 Ga0495629_0020215 Ga0495629_0020215_1835_2509 183
41 3300046514 Ga0495618_0261418 Ga0495618_0261418_277_951 183
42 3300047322 Ga0495680_0107756 Ga0495680_0107756_732_1406 183
43 3300053085 Ga0495619_0019233 Ga0495619_0019233_2832_3506 183
44 3300005356 Ga0070674_100334239 Ga0070674_1003342392 184
45 3300005366 Ga0070659_100612548 Ga0070659_1006125481 184
46 3300005367 Ga0070667_100483691 Ga0070667_1004836912 184
47 3300005444 Ga0070694_100608381 Ga0070694_1006083811 184
48 3300005577 Ga0068857_100835690 Ga0068857_1008356902 184
49 3300005841 Ga0068863_100022927 Ga0068863_1000229275 184
50 3300006881 Ga0068865_100400168 Ga0068865_1004001681 184
51 3300009148 Ga0105243_10377600 Ga0105243_103776002 184
52 3300010375 Ga0105239_10163399 Ga0105239_101633993 184
53 3300014326 Ga0157380_10857701 Ga0157380_108577012 184
54 3300025904 Ga0207647_10063640 Ga0207647_100636402 184
55 3300025907 Ga0207645_10033010 Ga0207645_100330102 184
56 3300025932 Ga0207690_10297243 Ga0207690_102972432 184
57 3300026088 Ga0207641_10766257 Ga0207641_107662572 184
58 3300026121 Ga0207683_10219334 Ga0207683_102193342 184
59 3300028381 Ga0268264_10458900 Ga0268264_104589002 184
60 3300035692 Ga0373935_0307555 Ga0373935_0307555_279_953 184
61 3300046694 Ga0495649_0203756 Ga0495649_0203756_318_992 184
62 3300048915 Ga0496112_0087727 Ga0496112_0087727_2067_2741 184
63 3300039438 Ga0436360_0355420 Ga0436360_0355420_159_830 185
64 3300046457 Ga0495590_0033150 Ga0495590_0033150_25_651 186
65 3300054114 Ga0501084_0053593 Ga0501084_0053593_1493_2200 187
66 3300031238 Ga0265332_10000089 Ga0265332_1000008960 188
67 3300031239 Ga0265328_10005245 Ga0265328_100052453 188
68 3300031240 Ga0265320_10047465 Ga0265320_100474652 188
69 3300031242 Ga0265329_10006809 Ga0265329_100068094 188
70 3300031250 Ga0265331_10000032 Ga0265331_1000003263 188
71 3300031344 Ga0265316_10000104 Ga0265316_1000010462 188
72 3300031711 Ga0265314_10000215 Ga0265314_1000021538 188
73 3300031712 Ga0265342_10097337 Ga0265342_100973373 188
74 3300035091 Ga0373951_0134406 Ga0373951_0134406_89_664 189
75 3300005328 Ga0070676_10256347 Ga0070676_102563471 190
76 3300005338 Ga0068868_100154574 Ga0068868_1001545742 190
77 3300005343 Ga0070687_100006064 Ga0070687_1000060643 190
78 3300005353 Ga0070669_100097180 Ga0070669_1000971803 190
79 3300005355 Ga0070671_100088307 Ga0070671_1000883074 190
80 3300005364 Ga0070673_100379790 Ga0070673_1003797902 190
81 3300005436 Ga0070713_100695108 Ga0070713_1006951082 190
82 3300005437 Ga0070710_10164414 Ga0070710_101644142 190
83 3300005438 Ga0070701_10042285 Ga0070701_100422853 190
84 3300005466 Ga0070685_10006291 Ga0070685_100062915 190
85 3300005539 Ga0068853_100705329 Ga0068853_1007053291 190
86 3300025935 Ga0207709_10147026 Ga0207709_101470263 190
87 3300025937 Ga0207669_10178298 Ga0207669_101782983 190
88 3300005345 Ga0070692_10118823 Ga0070692_101188232 191
89 3300034819 Ga0373958_0044772 Ga0373958_0044772_30_611 191
90 3300005356 Ga0070674_100666300 Ga0070674_1006663001 192
91 3300025911 Ga0207654_10447658 Ga0207654_104476581 193
92 3300006048 Ga0075363_100285515 Ga0075363_1002855152 194
93 3300006177 Ga0075362_10125569 Ga0075362_101255691 194
94 3300009545 Ga0105237_10132728 Ga0105237_101327281 194
95 3300013307 Ga0157372_10863844 Ga0157372_108638442 194
96 3300025903 Ga0207680_10129628 Ga0207680_101296282 194
97 3300025908 Ga0207643_10000613 Ga0207643_1000061323 194
98 3300025920 Ga0207649_10121443 Ga0207649_101214432 194
99 3300025926 Ga0207659_10086357 Ga0207659_100863573 194
100 3300026089 Ga0207648_10011963 Ga0207648_100119633 194
101 3300026095 Ga0207676_10075241 Ga0207676_100752411 194
102 3300027866 Ga0209813_10117973 Ga0209813_101179732 194
103 3300041501 Ga0451845_0750059 Ga0451845_0750059_243_869 194
104 3300046500 Ga0495596_0123287 Ga0495596_0123287_248_874 194
105 3300050489 nmdc:mga03683_197188_c1 nmdc:mga03683_197188_c1_162_788 194
106 3300050494 nmdc:mga06z11_161812_c1 nmdc:mga06z11_161812_c1_400_1026 194
107 3300053083 Ga0495655_0007229 Ga0495655_0007229_529_1155 194
108 3300005334 Ga0068869_100314111 Ga0068869_1003141112 195
109 3300005456 Ga0070678_100454486 Ga0070678_1004544861 195
110 3300005459 Ga0068867_100083532 Ga0068867_1000835322 195
111 3300006237 Ga0097621_100615138 Ga0097621_1006151381 195
112 3300025937 Ga0207669_10248327 Ga0207669_102483272 195
113 3300005330 Ga0070690_100614953 Ga0070690_1006149531 196
114 3300031247 Ga0265340_10065124 Ga0265340_100651242 196
115 3300006173 Ga0070716_100216590 Ga0070716_1002165902 197
116 3300025939 Ga0207665_10031304 Ga0207665_100313042 197
117 3300035086 Ga0373934_0073677 Ga0373934_0073677_607_1284 198
118 3300035118 Ga0373954_0118112 Ga0373954_0118112_153_830 198
119 3300036401 Ga0373937_0001940 Ga0373937_0001940_9874_10551 198
120 3300037068 Ga0373925_0642231 Ga0373925_0642231_108_785 198
121 3300046689 Ga0495613_0186124 Ga0495613_0186124_549_1226 198
122 3300047319 Ga0495674_0349159 Ga0495674_0349159_150_827 198
123 3300025938 Ga0207704_10342235 Ga0207704_103422352 199
124 3300034820 Ga0373959_0022595 Ga0373959_0022595_53_688 199
125 3300049570 Ga0501033_0055821 Ga0501033_0055821_1306_2013 199
126 3300049571 Ga0501034_0082996 Ga0501034_0082996_1155_1862 199
127 3300049572 Ga0501036_0006160 Ga0501036_0006160_6292_6999 199
128 3300049574 Ga0501038_0001565 Ga0501038_0001565_16639_17346 199
129 3300049578 Ga0501042_0053479 Ga0501042_0053479_774_1481 199
130 3300049579 Ga0501043_0012827 Ga0501043_0012827_2533_3240 199
131 3300049580 Ga0501046_0017926 Ga0501046_0017926_5037_5744 199
132 3300049585 Ga0501069_0001963 Ga0501069_0001963_7870_8577 199
133 3300049587 Ga0501071_0009884 Ga0501071_0009884_3870_4577 199
134 3300049590 Ga0501074_0018888 Ga0501074_0018888_4142_4849 199
135 3300049741 Ga0501079_0036323 Ga0501079_0036323_3014_3721 199
136 3300049742 Ga0501080_0020553 Ga0501080_0020553_5250_5957 199
137 3300049744 Ga0501083_0000817 Ga0501083_0000817_10975_11682 199
138 3300049822 Ga0501035_0050063 Ga0501035_0050063_26_733 199
139 3300049824 Ga0501045_0047633 Ga0501045_0047633_799_1506 199
140 3300005577 Ga0068857_100083172 Ga0068857_1000831724 200
141 3300026089 Ga0207648_10046730 Ga0207648_100467302 200
142 3300026116 Ga0207674_10089000 Ga0207674_100890002 200
143 3300035724 Ga0373933_0274911 Ga0373933_0274911_88_765 200
144 3300036401 Ga0373937_0480096 Ga0373937_0480096_282_959 200
145 3300050492 nmdc:mga0yw44_26339_c1 nmdc:mga0yw44_26339_c1_185_865 200
146 3300005436 Ga0070713_100941016 Ga0070713_1009410161 201
147 3300005445 Ga0070708_100038350 Ga0070708_1000383504 201
148 3300005467 Ga0070706_100034351 Ga0070706_1000343513 201
149 3300005468 Ga0070707_100054696 Ga0070707_1000546964 201
150 3300005471 Ga0070698_100004886 Ga0070698_1000048864 201
151 3300005518 Ga0070699_100005366 Ga0070699_10000536614 201
152 3300005536 Ga0070697_100005980 Ga0070697_10000598013 201
153 3300025910 Ga0207684_10001023 Ga0207684_1000102335 201
154 3300025922 Ga0207646_10001026 Ga0207646_1000102610 201
155 3300042876 Ga0451577_0011400 Ga0451577_0011400_4429_5082 201
156 3300044673 Ga0453683_0045670 Ga0453683_0045670_62_715 201
157 3300044712 Ga0453684_0062644 Ga0453684_0062644_1384_2037 201
158 3300045051 Ga0451576_0081076 Ga0451576_0081076_1205_1858 201
159 3300047319 Ga0495674_0338589 Ga0495674_0338589_27_707 201
160 3300047673 Ga0495593_0078192 Ga0495593_0078192_384_1064 201
161 3300053085 Ga0495619_0363557 Ga0495619_0363557_214_894 201
162 3300005458 Ga0070681_10018284 Ga0070681_100182848 202
163 3300005467 Ga0070706_100522047 Ga0070706_1005220472 202
164 3300005530 Ga0070679_100053825 Ga0070679_1000538252 202
165 3300013297 Ga0157378_10047051 Ga0157378_100470513 202
166 3300013306 Ga0163162_10747135 Ga0163162_107471352 202
167 3300025910 Ga0207684_10464854 Ga0207684_104648541 202
168 3300025919 Ga0207657_10195096 Ga0207657_101950962 202
169 3300037068 Ga0373925_0253097 Ga0373925_0253097_19_627 202
170 3300006038 Ga0075365_10001359 Ga0075365_100013591 203
171 3300050492 nmdc:mga0yw44_10992_c1 nmdc:mga0yw44_10992_c1_3809_4465 203
172 3300005468 Ga0070707_100128742 Ga0070707_1001287421 204
173 3300025922 Ga0207646_10046854 Ga0207646_100468543 204
174 3300032002 Ga0307416_100701813 Ga0307416_1007018131 204
175 3300005339 Ga0070660_100302808 Ga0070660_1003028081 205
176 3300005354 Ga0070675_100112644 Ga0070675_1001126441 205
177 3300005937 Ga0081455_10030484 Ga0081455_100304843 205
178 3300006175 Ga0070712_100606398 Ga0070712_1006063981 205
179 3300053077 Ga0495601_0280443 Ga0495601_0280443_26_706 205
180 3300053085 Ga0495619_0181263 Ga0495619_0181263_293_973 205
181 3300006038 Ga0075365_10150259 Ga0075365_101502591 206
182 3300025936 Ga0207670_10123289 Ga0207670_101232891 206
183 3300046520 Ga0495637_0167948 Ga0495637_0167948_92_793 206
184 3300005341 Ga0070691_10185947 Ga0070691_101859472 207
185 3300006871 Ga0075434_100013807 Ga0075434_1000138073 207
186 3300009553 Ga0105249_10405081 Ga0105249_104050812 207
187 3300031238 Ga0265332_10000616 Ga0265332_100006166 207
188 3300031241 Ga0265325_10105754 Ga0265325_101057541 207
189 3300031247 Ga0265340_10001157 Ga0265340_1000115711 207
190 3300031249 Ga0265339_10001689 Ga0265339_1000168916 207
191 3300031250 Ga0265331_10054970 Ga0265331_100549702 207
192 3300031711 Ga0265314_10109518 Ga0265314_101095182 207
193 3300031712 Ga0265342_10000139 Ga0265342_1000013972 207
194 3300050510 nmdc:mga06r32_431764_c1 nmdc:mga06r32_431764_c1_468_1160 207
195 3300050512 nmdc:mga0n895_6815_c1 nmdc:mga0n895_6815_c1_4357_5049 207
196 3300006178 Ga0075367_10227156 Ga0075367_102271561 208
197 3300013104 Ga0157370_10018965 Ga0157370_100189652 208
198 3300025942 Ga0207689_10022751 Ga0207689_100227511 208
199 3300048910 Ga0496107_0400219 Ga0496107_0400219_278_964 208
200 3300049593 Ga0501077_0340134 Ga0501077_0340134_206_883 208
201 3300005445 Ga0070708_100064690 Ga0070708_1000646902 209
202 3300005518 Ga0070699_100405612 Ga0070699_1004056121 209
203 3300031241 Ga0265325_10005177 Ga0265325_100051772 209
204 3300005355 Ga0070671_100172853 Ga0070671_1001728532 210
205 3300005617 Ga0068859_100132355 Ga0068859_1001323554 210
206 3300006163 Ga0070715_10091184 Ga0070715_100911842 210
207 3300006173 Ga0070716_100253625 Ga0070716_1002536252 210
208 3300006931 Ga0097620_100132350 Ga0097620_1001323504 210
209 3300007788 Ga0099795_10009343 Ga0099795_100093432 210
210 3300009176 Ga0105242_10478829 Ga0105242_104788292 210
211 3300009177 Ga0105248_10002898 Ga0105248_1000289810 210
212 3300009551 Ga0105238_10536808 Ga0105238_105368081 210
213 3300014968 Ga0157379_10262427 Ga0157379_102624272 210
214 3300025905 Ga0207685_10010784 Ga0207685_100107842 210
215 3300025931 Ga0207644_10022156 Ga0207644_100221562 210
216 3300025941 Ga0207711_10064116 Ga0207711_100641165 210
217 3300034817 Ga0373948_0007698 Ga0373948_0007698_554_1222 210
218 3300035085 Ga0373929_0014816 Ga0373929_0014816_174_842 210
219 3300035241 Ga0373961_0006333 Ga0373961_0006333_1132_1800 210
220 3300035242 Ga0373962_0002857 Ga0373962_0002857_1856_2524 210
221 3300035691 Ga0373931_0002195 Ga0373931_0002195_5148_5816 210
222 3300035692 Ga0373935_0013611 Ga0373935_0013611_3227_3895 210
223 3300035695 Ga0373927_0035826 Ga0373927_0035826_82_774 210
224 3300035724 Ga0373933_0160638 Ga0373933_0160638_22_690 210
225 3300037068 Ga0373925_0017723 Ga0373925_0017723_176_868 210
226 3300046529 Ga0495652_0531988 Ga0495652_0531988_54_722 210
227 3300048088 Ga0495602_0298724 Ga0495602_0298724_478_1146 210
228 3300048903 Ga0496100_0007392 Ga0496100_0007392_2470_3138 210
229 3300048904 Ga0496101_0001698 Ga0496101_0001698_6485_7153 210
230 3300048905 Ga0496102_0006852 Ga0496102_0006852_2442_3110 210
231 3300048909 Ga0496106_0016334 Ga0496106_0016334_4067_4735 210
232 3300048910 Ga0496107_0103514 Ga0496107_0103514_858_1526 210
233 3300048911 Ga0496108_0007574 Ga0496108_0007574_6556_7224 210
234 3300048912 Ga0496109_0038830 Ga0496109_0038830_713_1381 210
235 3300048913 Ga0496110_0003430 Ga0496110_0003430_7317_7985 210
236 3300048914 Ga0496111_0041160 Ga0496111_0041160_235_903 210
237 3300048915 Ga0496112_0113340 Ga0496112_0113340_1682_2350 210
238 3300048917 Ga0496114_0029829 Ga0496114_0029829_2719_3387 210
239 3300048918 Ga0496115_0360023 Ga0496115_0360023_211_879 210
240 3300053084 Ga0495595_0111926 Ga0495595_0111926_77_745 210
241 3300005564 Ga0070664_100728059 Ga0070664_1007280592 211
242 3300005615 Ga0070702_100204715 Ga0070702_1002047151 211
243 3300006358 Ga0068871_100447069 Ga0068871_1004470691 211
244 3300014969 Ga0157376_10153214 Ga0157376_101532142 211
245 3300035115 Ga0373941_0131370 Ga0373941_0131370_190_882 211
246 3300035691 Ga0373931_0024442 Ga0373931_0024442_1265_1957 211
247 3300048905 Ga0496102_0794924 Ga0496102_0794924_91_783 211
248 3300048906 Ga0496103_0302388 Ga0496103_0302388_117_809 211
249 3300048907 Ga0496104_0231863 Ga0496104_0231863_244_936 211
250 3300035113 Ga0373936_0047375 Ga0373936_0047375_28_675 212
251 3300035695 Ga0373927_0306473 Ga0373927_0306473_317_1009 212
252 3300046531 Ga0495665_0202396 Ga0495665_0202396_185_877 212
253 3300050516 nmdc:mga0sz30_226992_c1 nmdc:mga0sz30_226992_c1_118_768 212
254 3300005616 Ga0068852_100483956 Ga0068852_1004839561 213
255 3300006186 Ga0075369_10290774 Ga0075369_102907741 213
256 3300035695 Ga0373927_0302897 Ga0373927_0302897_366_1034 213
257 3300037068 Ga0373925_0255732 Ga0373925_0255732_444_1112 213
258 3300037853 Ga0436364_1223108 Ga0436364_1223108_1223_1888 213
259 3300039437 Ga0436365_1676454 Ga0436365_1676454_142_807 213
260 3300046678 Ga0495599_0230856 Ga0495599_0230856_427_1095 213
261 3300047444 Ga0495675_0075860 Ga0495675_0075860_772_1440 213
262 3300049822 Ga0501035_0479717 Ga0501035_0479717_140_781 213
263 3300053077 Ga0495601_0001331 Ga0495601_0001331_211_879 213
264 3300053078 Ga0495612_0041712 Ga0495612_0041712_814_1482 213
265 3300053085 Ga0495619_0020949 Ga0495619_0020949_155_823 213
266 3300006028 Ga0070717_10271658 Ga0070717_102716582 214
267 3300006871 Ga0075434_100153262 Ga0075434_1001532622 214
268 3300050512 nmdc:mga0n895_151047_c1 nmdc:mga0n895_151047_c1_767_1465 214
269 3300005563 Ga0068855_100000490 Ga0068855_10000049037 215
270 3300005614 Ga0068856_100609286 Ga0068856_1006092862 215
271 3300006028 Ga0070717_10142541 Ga0070717_101425412 215
272 3300006871 Ga0075434_100673671 Ga0075434_1006736712 215
273 3300007076 Ga0075435_100399997 Ga0075435_1003999971 215
274 3300009551 Ga0105238_10125713 Ga0105238_101257133 215
275 3300021388 Ga0213875_10000036 Ga0213875_1000003676 215
276 3300025949 Ga0207667_10038536 Ga0207667_100385364 215
277 3300037853 Ga0436364_0245439 Ga0436364_0245439_19593_20261 215
278 3300044842 Ga0466957_0177553 Ga0466957_0177553_593_1261 215
279 3300050512 nmdc:mga0n895_646931_c1 nmdc:mga0n895_646931_c1_242_922 215
280 3300005937 Ga0081455_10143213 Ga0081455_101432132 216
281 3300049574 Ga0501038_0061334 Ga0501038_0061334_427_1134 216
282 3300006871 Ga0075434_100026845 Ga0075434_1000268454 218
283 3300031241 Ga0265325_10020694 Ga0265325_100206945 218
284 3300031249 Ga0265339_10020335 Ga0265339_100203352 218
285 3300031595 Ga0265313_10001715 Ga0265313_1000171511 218
286 3300005328 Ga0070676_10059345 Ga0070676_100593452 219
287 3300005330 Ga0070690_100010821 Ga0070690_1000108212 219
288 3300005340 Ga0070689_100019555 Ga0070689_1000195554 219
289 3300005343 Ga0070687_100027699 Ga0070687_1000276992 219
290 3300005353 Ga0070669_100127630 Ga0070669_1001276302 219
291 3300005353 Ga0070669_100262379 Ga0070669_1002623792 219
292 3300005354 Ga0070675_100040621 Ga0070675_1000406216 219
293 3300005356 Ga0070674_100085149 Ga0070674_1000851492 219
294 3300005356 Ga0070674_100385649 Ga0070674_1003856491 219
295 3300005436 Ga0070713_100190276 Ga0070713_1001902761 219
296 3300005441 Ga0070700_100482541 Ga0070700_1004825411 219
297 3300005457 Ga0070662_100727105 Ga0070662_1007271051 219
298 3300005543 Ga0070672_100388550 Ga0070672_1003885502 219
299 3300005544 Ga0070686_100244563 Ga0070686_1002445632 219
300 3300005544 Ga0070686_100335858 Ga0070686_1003358582 219
301 3300005547 Ga0070693_100322028 Ga0070693_1003220282 219
302 3300005618 Ga0068864_100061132 Ga0068864_1000611322 219
303 3300005718 Ga0068866_10151746 Ga0068866_101517462 219
304 3300005719 Ga0068861_100293100 Ga0068861_1002931001 219
305 3300005844 Ga0068862_100752646 Ga0068862_1007526462 219
306 3300005981 Ga0081538_10034218 Ga0081538_100342183 219
307 3300005985 Ga0081539_10056597 Ga0081539_100565974 219
308 3300006042 Ga0075368_10135713 Ga0075368_101357132 219
309 3300006178 Ga0075367_10053344 Ga0075367_100533443 219
310 3300006195 Ga0075366_10108919 Ga0075366_101089192 219
311 3300006881 Ga0068865_100171746 Ga0068865_1001717462 219
312 3300009101 Ga0105247_10152842 Ga0105247_101528422 219
313 3300009148 Ga0105243_10220115 Ga0105243_102201152 219
314 3300013297 Ga0157378_10293652 Ga0157378_102936521 219
315 3300013306 Ga0163162_10077518 Ga0163162_100775183 219
316 3300014325 Ga0163163_10010340 Ga0163163_100103409 219
317 3300014326 Ga0157380_10308459 Ga0157380_103084592 219
318 3300025315 Ga0207697_10063765 Ga0207697_100637652 219
319 3300025903 Ga0207680_10404997 Ga0207680_104049972 219
320 3300025903 Ga0207680_10611987 Ga0207680_106119871 219
321 3300025912 Ga0207707_10065413 Ga0207707_100654132 219
322 3300025918 Ga0207662_10042914 Ga0207662_100429142 219
323 3300025923 Ga0207681_10075004 Ga0207681_100750042 219
324 3300025923 Ga0207681_10198534 Ga0207681_101985342 219
325 3300025926 Ga0207659_10044866 Ga0207659_100448662 219
326 3300025928 Ga0207700_10183685 Ga0207700_101836851 219
327 3300025935 Ga0207709_10201715 Ga0207709_102017152 219
328 3300025936 Ga0207670_10001838 Ga0207670_100018386 219
329 3300025936 Ga0207670_10122779 Ga0207670_101227792 219
330 3300025937 Ga0207669_10060700 Ga0207669_100607002 219
331 3300025937 Ga0207669_10385532 Ga0207669_103855322 219
332 3300025940 Ga0207691_10060991 Ga0207691_100609914 219
333 3300025961 Ga0207712_10307622 Ga0207712_103076222 219
334 3300026023 Ga0207677_10061026 Ga0207677_100610264 219
335 3300026035 Ga0207703_10130666 Ga0207703_101306663 219
336 3300026075 Ga0207708_10278417 Ga0207708_102784172 219
337 3300026089 Ga0207648_10559752 Ga0207648_105597522 219
338 3300026095 Ga0207676_10034795 Ga0207676_100347952 219
339 3300026118 Ga0207675_100112315 Ga0207675_1001123152 219
340 3300026121 Ga0207683_10202095 Ga0207683_102020952 219
341 3300026121 Ga0207683_10258379 Ga0207683_102583793 219
342 3300034816 Ga0373930_0014678 Ga0373930_0014678_216_884 219
343 3300035114 Ga0373939_0130882 Ga0373939_0130882_100_768 219
344 3300035691 Ga0373931_0002855 Ga0373931_0002855_6542_7210 219
345 3300035695 Ga0373927_0220142 Ga0373927_0220142_281_949 219
346 3300046516 Ga0495628_0090624 Ga0495628_0090624_134_802 219
347 3300048910 Ga0496107_0510647 Ga0496107_0510647_86_754 219
348 3300048911 Ga0496108_0246050 Ga0496108_0246050_490_1158 219
349 3300048912 Ga0496109_0116188 Ga0496109_0116188_1705_2373 219
350 3300048917 Ga0496114_0146378 Ga0496114_0146378_617_1285 219
351 3300050493 nmdc:mga0k408_61425_c1 nmdc:mga0k408_61425_c1_877_1557 219
352 3300050494 nmdc:mga06z11_35075_c1 nmdc:mga06z11_35075_c1_145_813 219
353 3300005331 Ga0070670_100743992 Ga0070670_1007439921 220
354 3300005334 Ga0068869_100007595 Ga0068869_1000075952 220
355 3300005338 Ga0068868_100038216 Ga0068868_1000382163 220
356 3300005347 Ga0070668_100462860 Ga0070668_1004628601 220
357 3300005353 Ga0070669_100335939 Ga0070669_1003359392 220
358 3300005365 Ga0070688_100098053 Ga0070688_1000980533 220
359 3300005367 Ga0070667_100230043 Ga0070667_1002300433 220
360 3300005456 Ga0070678_100035721 Ga0070678_1000357213 220
361 3300005459 Ga0068867_100107087 Ga0068867_1001070872 220
362 3300005471 Ga0070698_100278636 Ga0070698_1002786363 220
363 3300005546 Ga0070696_100253289 Ga0070696_1002532891 220
364 3300005548 Ga0070665_100389176 Ga0070665_1003891761 220
365 3300005549 Ga0070704_100228072 Ga0070704_1002280722 220
366 3300005617 Ga0068859_100039120 Ga0068859_1000391202 220
367 3300005618 Ga0068864_100278721 Ga0068864_1002787212 220
368 3300005719 Ga0068861_100127274 Ga0068861_1001272742 220
369 3300005841 Ga0068863_100955005 Ga0068863_1009550051 220
370 3300005842 Ga0068858_100129354 Ga0068858_1001293543 220
371 3300005844 Ga0068862_100010983 Ga0068862_1000109838 220
372 3300006175 Ga0070712_100188261 Ga0070712_1001882611 220
373 3300006237 Ga0097621_100005768 Ga0097621_1000057685 220
374 3300006844 Ga0075428_100181760 Ga0075428_1001817602 220
375 3300006881 Ga0068865_100625019 Ga0068865_1006250192 220
376 3300006914 Ga0075436_100395339 Ga0075436_1003953391 220
377 3300006931 Ga0097620_100039121 Ga0097620_1000391212 220
378 3300009098 Ga0105245_10085585 Ga0105245_100855853 220
379 3300009177 Ga0105248_10021568 Ga0105248_100215683 220
380 3300009545 Ga0105237_10613764 Ga0105237_106137642 220
381 3300009553 Ga0105249_10313108 Ga0105249_103131081 220
382 3300010375 Ga0105239_10266529 Ga0105239_102665292 220
383 3300010375 Ga0105239_11131220 Ga0105239_111312202 220
384 3300011119 Ga0105246_10023189 Ga0105246_100231893 220
385 3300013296 Ga0157374_10740444 Ga0157374_107404442 220
386 3300013297 Ga0157378_10503601 Ga0157378_105036012 220
387 3300013308 Ga0157375_10184089 Ga0157375_101840893 220
388 3300014326 Ga0157380_10583506 Ga0157380_105835063 220
389 3300014968 Ga0157379_10130282 Ga0157379_101302821 220
390 3300014969 Ga0157376_10026378 Ga0157376_100263783 220
391 3300025903 Ga0207680_10033521 Ga0207680_100335212 220
392 3300025925 Ga0207650_10812018 Ga0207650_108120181 220
393 3300025934 Ga0207686_10421089 Ga0207686_104210892 220
394 3300025938 Ga0207704_10036725 Ga0207704_100367252 220
395 3300025941 Ga0207711_10015412 Ga0207711_100154123 220
396 3300025942 Ga0207689_10009969 Ga0207689_100099694 220
397 3300025972 Ga0207668_10276943 Ga0207668_102769431 220
398 3300025986 Ga0207658_10382940 Ga0207658_103829401 220
399 3300026023 Ga0207677_10101963 Ga0207677_101019631 220
400 3300026089 Ga0207648_10948208 Ga0207648_109482081 220
401 3300026118 Ga0207675_100101229 Ga0207675_1001012293 220
402 3300026121 Ga0207683_10022345 Ga0207683_100223453 220
403 3300028380 Ga0268265_10028490 Ga0268265_100284903 220
404 3300035113 Ga0373936_0238794 Ga0373936_0238794_107_799 220
405 3300035114 Ga0373939_0067248 Ga0373939_0067248_173_853 220
406 3300035116 Ga0373945_0224230 Ga0373945_0224230_99_764 220
407 3300035118 Ga0373954_0248626 Ga0373954_0248626_62_754 220
408 3300035170 Ga0373943_0052990 Ga0373943_0052990_422_1087 220
409 3300035172 Ga0373955_0163314 Ga0373955_0163314_294_986 220
410 3300035692 Ga0373935_0014558 Ga0373935_0014558_3263_3928 220
411 3300035692 Ga0373935_0187414 Ga0373935_0187414_229_921 220
412 3300035725 Ga0373947_0389423 Ga0373947_0389423_262_927 220
413 3300037068 Ga0373925_0036365 Ga0373925_0036365_2462_3127 220
414 3300046475 Ga0495639_0127609 Ga0495639_0127609_462_1154 220
415 3300046533 Ga0495640_0095896 Ga0495640_0095896_140_805 220
416 3300047319 Ga0495674_0448262 Ga0495674_0448262_100_765 220
417 3300048088 Ga0495602_0038047 Ga0495602_0038047_2610_3302 220
418 3300048907 Ga0496104_0004221 Ga0496104_0004221_159_854 220
419 3300048908 Ga0496105_0020192 Ga0496105_0020192_676_1371 220
420 3300048908 Ga0496105_0071009 Ga0496105_0071009_1351_2016 220
421 3300048909 Ga0496106_0187348 Ga0496106_0187348_844_1539 220
422 3300048914 Ga0496111_0128129 Ga0496111_0128129_531_1196 220
423 3300048916 Ga0496113_0186965 Ga0496113_0186965_80_775 220
424 3300005545 Ga0070695_100086845 Ga0070695_1000868452 221
425 3300006844 Ga0075428_100112286 Ga0075428_1001122862 221
426 3300025921 Ga0207652_10165998 Ga0207652_101659982 221
427 3300025928 Ga0207700_10830897 Ga0207700_108308971 221
428 3300046520 Ga0495637_0144753 Ga0495637_0144753_185_862 221
429 3300053733 Ga0500552_002709 Ga0500552_002709_426_1097 221
430 3300005548 Ga0070665_100262869 Ga0070665_1002628692 222
431 3300005981 Ga0081538_10002854 Ga0081538_1000285415 222
432 3300005983 Ga0081540_1054033 Ga0081540_10540331 222
433 3300006195 Ga0075366_10022896 Ga0075366_100228962 222
434 3300006195 Ga0075366_10040610 Ga0075366_100406102 222
435 3300007076 Ga0075435_100159311 Ga0075435_1001593112 222
436 3300007076 Ga0075435_100291275 Ga0075435_1002912752 222
437 3300009094 Ga0111539_11203367 Ga0111539_112033671 222
438 3300009098 Ga0105245_10384308 Ga0105245_103843082 222
439 3300009148 Ga0105243_10518016 Ga0105243_105180162 222
440 3300025297 Ga0209758_1000921 Ga0209758_100092112 222
441 3300031548 Ga0307408_100326374 Ga0307408_1003263742 222
442 3300035695 Ga0373927_0474621 Ga0373927_0474621_11_703 222
443 3300035725 Ga0373947_0032093 Ga0373947_0032093_554_1246 222
444 3300046491 Ga0495584_0105600 Ga0495584_0105600_473_1162 222
445 3300046664 Ga0495659_0099594 Ga0495659_0099594_32_721 222
446 3300046683 Ga0495658_0167998 Ga0495658_0167998_495_1187 222
447 3300047315 Ga0495581_0058775 Ga0495581_0058775_108_800 222
448 3300049571 Ga0501034_0064129 Ga0501034_0064129_384_1091 222
449 3300049581 Ga0501047_0110532 Ga0501047_0110532_986_1693 222
450 3300049823 Ga0501044_0000509 Ga0501044_0000509_16734_17441 222
451 3300050493 nmdc:mga0k408_53649_c1 nmdc:mga0k408_53649_c1_417_1094 222
452 3300050493 nmdc:mga0k408_73074_c1 nmdc:mga0k408_73074_c1_1189_1866 222
453 3300050494 nmdc:mga06z11_3813_c1 nmdc:mga06z11_3813_c1_3473_4150 222
454 3300050496 nmdc:mga07m45_372051_c1 nmdc:mga07m45_372051_c1_140_817 222
455 3300050513 nmdc:mga0rr50_42377_c1 nmdc:mga0rr50_42377_c1_1166_1864 222
456 3300031240 Ga0265320_10112239 Ga0265320_101122392 223
457 3300031247 Ga0265340_10040971 Ga0265340_100409711 223
458 3300044693 Ga0466961_0109817 Ga0466961_0109817_1046_1720 223
459 3300050514 nmdc:mga08x19_1357_c1 nmdc:mga08x19_1357_c1_910_1626 223
460 3300005327 Ga0070658_10115781 Ga0070658_101157811 227
461 3300005327 Ga0070658_10055099 Ga0070658_100550993 229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07077

DUF1345

Protein of unknown function (DUF1345)

57

227

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lp8-assembly1.cif.gz_A a novel open-state crystal structure of the prokaryotic inward rectifier kirbac3.1 0.7859 126 222
3zrs-assembly1.cif.gz_A x-ray crystal structure of a kirbac potassium channel highlights a mechanism of channel opening at the bundle-crossing gate. 0.7756 126 222
2wll-assembly1.cif.gz_A-2 potassium channel from burkholderia pseudomallei 0.77 130 222
2wll-assembly1.cif.gz_B-2 potassium channel from burkholderia pseudomallei 0.7698 130 222
7n9k-assembly1.cif.gz_A kirbac3.1 l124m mutant 0.7673 126 222
ID Description Score Start End Superfamily
af_A0A1D8PL65_249_390_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8373 128 225 1.10.287.70
2wllA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.77 130 222 1.10.287.70
af_Q4E5R5_256_364_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7647 122 227 1.10.287.70
af_Q8LIN5_63_157_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7449 128 226 1.10.287.70
af_K7KPW5_139_236_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7281 124 227 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A2U1WLG6-F1-model_v4 DUF1345 domain-containing protein 0.9689 14 229 GO:0016020
AF-A0A2R5FA31-F1-model_v4 DUF1345 domain-containing protein 0.9675 46 227 GO:0016020
AF-A0A4Z0BBV9-F1-model_v4 DUF1345 domain-containing protein 0.9585 13 229 GO:0016020
AF-A0A5R9JH90-F1-model_v4 DUF1345 domain-containing protein 0.9556 13 229 GO:0016020
AF-A0A0N0XI40-F1-model_v4 DUF1345 domain-containing protein 0.9529 17 229 GO:0016020

Feature Viewer

pLDDT pTM Quality
88.3 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map