F448845

General Info

Members Datasets Scaffolds Average Seq Length
462 177 462 136

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10005282|JGI24740J21852_100052827
Length 139
Sequence MLRSPSTKVSFALLFAVILLVAIVGVIIEYAHDRSQLRMHAAAATGGDPERGEALFIQYGCGSCHALKNVRTATGMVGPPLDGIALRVIIGGHLSNTPDNMQRWIRDPQHVSPGTAMPDLHVGAGDARDITAFLYTRAK

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
142 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
143 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
144 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
155 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
156 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
159 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
174 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
175 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
176 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
177 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 3.25
Rhizosphere 95.89
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005282 3300001979 Bacteria 5482
2 rootH2_10181735 3300003320 Bacteria 1409
3 Ga0070658_10014633 3300005327 Bacteria 6295
4 Ga0070658_10054865 3300005327 Bacteria 3236
5 Ga0070658_10188825 3300005327 Unclassified 1736
6 Ga0070658_10707591 3300005327 Bacteria 874
7 Ga0070658_11123480 3300005327 Unclassified 683
8 Ga0070658_11140136 3300005327 Bacteria 678
9 Ga0070676_10089188 3300005328 Bacteria 1886
10 Ga0070676_10539383 3300005328 Bacteria 833
11 Ga0070683_100043196 3300005329 Bacteria 4154
12 Ga0070683_100566111 3300005329 Bacteria 1087
13 Ga0070683_102083854 3300005329 Bacteria 545
14 Ga0070690_100435945 3300005330 Bacteria 969
15 Ga0070670_100093791 3300005331 Bacteria 2582
16 Ga0070670_102099354 3300005331 Bacteria 521
17 Ga0070677_10027972 3300005333 Bacteria 2127
18 Ga0068869_100025190 3300005334 Bacteria 4128
19 Ga0070680_100161426 3300005336 Unclassified 1883
20 Ga0070680_100267509 3300005336 Bacteria 1447
21 Ga0070682_100048175 3300005337 Plasmid 2653
22 Ga0070682_100115715 3300005337 Unclassified 1793
23 Ga0068868_100044286 3300005338 Bacteria 3479
24 Ga0068868_100192637 3300005338 Unclassified 1696
25 Ga0068868_100355555 3300005338 Bacteria 1255
26 Ga0068868_100733395 3300005338 Bacteria 886
27 Ga0070660_100011744 3300005339 Bacteria 6236
28 Ga0070660_100101901 3300005339 Bacteria 2275
29 Ga0070660_100251046 3300005339 Bacteria 1443
30 Ga0070660_100290643 3300005339 Bacteria 1338
31 Ga0070660_100678356 3300005339 Unclassified 863
32 Ga0070660_100829138 3300005339 Unclassified 778
33 Ga0070687_100141136 3300005343 Bacteria 1403
34 Ga0070661_100028778 3300005344 Bacteria 4009
35 Ga0070661_100037027 3300005344 Bacteria 3549
36 Ga0070661_100080661 3300005344 Bacteria 2401
37 Ga0070661_100100876 3300005344 Bacteria 2147
38 Ga0070661_100155277 3300005344 Unclassified 1731
39 Ga0070661_100218100 3300005344 Bacteria 1462
40 Ga0070661_100523718 3300005344 Bacteria 951
41 Ga0070692_10156863 3300005345 Unclassified 1301
42 Ga0070669_101542337 3300005353 Bacteria 578
43 Ga0070675_100063980 3300005354 Bacteria 3041
44 Ga0070675_100083451 3300005354 Bacteria 2667
45 Ga0070671_100059181 3300005355 Bacteria 3188
46 Ga0070671_100214913 3300005355 Bacteria 1631
47 Ga0070671_100467059 3300005355 Bacteria 1083
48 Ga0070674_100010556 3300005356 Bacteria 5589
49 Ga0070674_100456885 3300005356 Bacteria 1055
50 Ga0070673_100027012 3300005364 Bacteria 4249
51 Ga0070673_100072672 3300005364 Bacteria 2767
52 Ga0070673_100225521 3300005364 Bacteria 1624
53 Ga0070673_100273111 3300005364 Unclassified 1480
54 Ga0070659_100010221 3300005366 Bacteria 6903
55 Ga0070659_100030930 3300005366 Bacteria 4144
56 Ga0070659_100066222 3300005366 Plasmid 2862
57 Ga0070659_100401272 3300005366 Bacteria 1157
58 Ga0070659_100608613 3300005366 Bacteria 939
59 Ga0070659_100636021 3300005366 Bacteria 919
60 Ga0070659_100763029 3300005366 Bacteria 839
61 Ga0070659_100887135 3300005366 Unclassified 779
62 Ga0070659_101077213 3300005366 Bacteria 708
63 Ga0070667_100413546 3300005367 Bacteria 1229
64 Ga0070667_100764979 3300005367 Bacteria 896
65 Ga0070714_100144037 3300005435 Bacteria 2142
66 Ga0070663_100015299 3300005455 Bacteria 4949
67 Ga0070663_100154964 3300005455 Bacteria 1760
68 Ga0070663_100402075 3300005455 Bacteria 1120
69 Ga0070663_100600588 3300005455 Bacteria 925
70 Ga0070678_100002540 3300005456 Bacteria 10011
71 Ga0070678_100418584 3300005456 Bacteria 1167
72 Ga0070662_100072090 3300005457 Bacteria 2549
73 Ga0070662_100250933 3300005457 Bacteria 1422
74 Ga0070662_100319315 3300005457 Bacteria 1266
75 Ga0070662_100361214 3300005457 Bacteria 1192
76 Ga0070681_10064636 3300005458 Bacteria 3629
77 Ga0070681_10082750 3300005458 Bacteria 3164
78 Ga0070681_10206671 3300005458 Bacteria 1880
79 Ga0070681_10256497 3300005458 Bacteria 1661
80 Ga0070681_10456174 3300005458 Bacteria 1191
81 Ga0070681_11222226 3300005458 Bacteria 673
82 Ga0068867_100110964 3300005459 Bacteria 2107
83 Ga0068867_100139173 3300005459 Bacteria 1895
84 Ga0070679_100101746 3300005530 Bacteria 2860
85 Ga0070679_100313400 3300005530 Bacteria 1518
86 Ga0070679_100482063 3300005530 Bacteria 1184
87 Ga0070679_101027210 3300005530 Unclassified 768
88 Ga0070679_101830333 3300005530 Unclassified 555
89 Ga0070684_100000841 3300005535 Bacteria 21613
90 Ga0070684_100523506 3300005535 Unclassified 1099
91 Ga0068853_100224045 3300005539 Bacteria 1718
92 Ga0068853_100489074 3300005539 Bacteria 1161
93 Ga0068853_100535344 3300005539 Viruses 1108
94 Ga0068853_100551436 3300005539 Bacteria 1092
95 Ga0068853_101088361 3300005539 Unclassified 770
96 Ga0070672_100363484 3300005543 Bacteria 1235
97 Ga0070693_100324994 3300005547 Bacteria 1045
98 Ga0068855_100092838 3300005563 Bacteria 3480
99 Ga0068855_100163790 3300005563 Bacteria 2522
100 Ga0068855_100385711 3300005563 Bacteria 1538
101 Ga0070664_100042053 3300005564 Bacteria 3858
102 Ga0070664_100075851 3300005564 Bacteria 2888
103 Ga0070664_100182069 3300005564 Bacteria 1868
104 Ga0070664_100293223 3300005564 Bacteria 1469
105 Ga0070664_100376179 3300005564 Bacteria 1296
106 Ga0070664_100486392 3300005564 Bacteria 1136
107 Ga0068857_100062940 3300005577 Bacteria 3298
108 Ga0068857_100146000 3300005577 Unclassified 2140
109 Ga0068857_100238972 3300005577 Bacteria 1663
110 Ga0068854_100112512 3300005578 Bacteria 2055
111 Ga0068854_100132638 3300005578 Unclassified 1903
112 Ga0068854_100214838 3300005578 Bacteria 1519
113 Ga0068854_100345966 3300005578 Bacteria 1215
114 Ga0068854_101539335 3300005578 Unclassified 604
115 Ga0068856_100083925 3300005614 Bacteria 3164
116 Ga0068856_100099410 3300005614 Bacteria 2900
117 Ga0068856_100313017 3300005614 Bacteria 1588
118 Ga0070702_100192280 3300005615 Bacteria 1344
119 Ga0068852_100016952 3300005616 Bacteria 5700
120 Ga0068852_100160652 3300005616 Bacteria 2098
121 Ga0068852_100178615 3300005616 Bacteria 1994
122 Ga0068852_100194998 3300005616 Bacteria 1913
123 Ga0068852_100378954 3300005616 Bacteria 1387
124 Ga0068852_100871820 3300005616 Bacteria 916
125 Ga0068852_100940708 3300005616 Bacteria 882
126 Ga0068852_101406580 3300005616 Unclassified 720
127 Ga0068852_102159042 3300005616 Unclassified 578
128 Ga0068859_100165137 3300005617 Bacteria 2294
129 Ga0068864_100030447 3300005618 Bacteria 4574
130 Ga0068866_10043413 3300005718 Bacteria 2244
131 Ga0068851_10087947 3300005834 Bacteria 1632
132 Ga0068851_10178933 3300005834 Bacteria 1174
133 Ga0068851_10278657 3300005834 Bacteria 955
134 Ga0068870_10381422 3300005840 Unclassified 912
135 Ga0068870_10528917 3300005840 Unclassified 790
136 Ga0068870_10812704 3300005840 Bacteria 654
137 Ga0068863_100063028 3300005841 Bacteria 3506
138 Ga0068863_100379998 3300005841 Bacteria 1379
139 Ga0068863_102013903 3300005841 Bacteria 587
140 Ga0068858_100068659 3300005842 Bacteria 3285
141 Ga0068858_100442538 3300005842 Bacteria 1252
142 Ga0068862_101579934 3300005844 Bacteria 662
143 Ga0070717_10144670 3300006028 Bacteria 2053
144 Ga0075366_10727285 3300006195 Unclassified 617
145 Ga0097621_100174174 3300006237 Bacteria 1856
146 Ga0097621_100177110 3300006237 Bacteria 1841
147 Ga0097621_100294368 3300006237 Bacteria 1432
148 Ga0068871_100352509 3300006358 Bacteria 1302
149 Ga0068865_100132097 3300006881 Bacteria 1872
150 Ga0097620_100015588 3300006931 Bacteria 7637
151 Ga0097620_100165136 3300006931 Bacteria 2294
152 Ga0105245_10689502 3300009098 Bacteria 1054
153 Ga0105243_10050717 3300009148 Bacteria 3280
154 Ga0105241_10256123 3300009174 Bacteria 1486
155 Ga0105248_10047519 3300009177 Bacteria 4813
156 Ga0105248_10305139 3300009177 Bacteria 1793
157 Ga0105248_10474002 3300009177 Bacteria 1411
158 Ga0105238_10213208 3300009551 Bacteria 1907
159 Ga0105239_11452397 3300010375 Bacteria 792
160 Ga0105239_12760447 3300010375 Unclassified 573
161 Ga0157373_10034737 3300013100 Bacteria 3621
162 Ga0157373_10167970 3300013100 Bacteria 1544
163 Ga0157373_10504751 3300013100 Unclassified 874
164 Ga0157371_10026784 3300013102 Bacteria 4187
165 Ga0157371_10223904 3300013102 Bacteria 1351
166 Ga0157371_10307471 3300013102 Unclassified 1148
167 Ga0157371_10406713 3300013102 Bacteria 996
168 Ga0157371_11488262 3300013102 Unclassified 528
169 Ga0157370_10122048 3300013104 Unclassified 2433
170 Ga0157370_10151341 3300013104 Unclassified 2159
171 Ga0157370_10170301 3300013104 Bacteria 2024
172 Ga0157370_11981505 3300013104 Unclassified 522
173 Ga0157369_10082269 3300013105 Bacteria 3445
174 Ga0157369_10183223 3300013105 Unclassified 2203
175 Ga0157369_10249853 3300013105 Unclassified 1851
176 Ga0157369_10448074 3300013105 Bacteria 1337
177 Ga0157369_11470337 3300013105 Bacteria 693
178 Ga0157378_10024042 3300013297 Bacteria 5360
179 Ga0157378_11090335 3300013297 Bacteria 835
180 Ga0163162_10006085 3300013306 Bacteria 11680
181 Ga0163162_10132017 3300013306 Bacteria 2606
182 Ga0163162_10534071 3300013306 Bacteria 1302
183 Ga0157372_10353591 3300013307 Bacteria 1712
184 Ga0157372_10857410 3300013307 Bacteria 1054
185 Ga0157372_12939006 3300013307 Unclassified 545
186 Ga0157375_10296145 3300013308 Bacteria 1781
187 Ga0157375_10497710 3300013308 Bacteria 1383
188 Ga0157380_10374047 3300014326 Bacteria 1342
189 Ga0157379_10132636 3300014968 Bacteria 2243
190 Ga0206353_10071993 3300020082 Bacteria 916
191 Ga0207697_10005443 3300025315 Bacteria 5919
192 Ga0207656_10054476 3300025321 Bacteria 1739
193 Ga0207682_10015536 3300025893 Bacteria 2964
194 Ga0207642_10028201 3300025899 Bacteria 2308
195 Ga0207688_10011843 3300025901 Bacteria 4747
196 Ga0207680_10096787 3300025903 Bacteria 1889
197 Ga0207647_10047271 3300025904 Bacteria 2677
198 Ga0207647_10048145 3300025904 Plasmid 2648
199 Ga0207699_10141408 3300025906 Bacteria 1582
200 Ga0207645_10053883 3300025907 Bacteria 2569
201 Ga0207645_10082412 3300025907 Bacteria 2062
202 Ga0207645_10154137 3300025907 Bacteria 1501
203 Ga0207643_10412713 3300025908 Unclassified 855
204 Ga0207705_10018993 3300025909 Bacteria 4915
205 Ga0207705_10020519 3300025909 Bacteria 4719
206 Ga0207705_10039541 3300025909 Bacteria 3381
207 Ga0207705_10083923 3300025909 Unclassified 2325
208 Ga0207705_10103473 3300025909 Unclassified 2097
209 Ga0207705_10119167 3300025909 Bacteria 1957
210 Ga0207705_10142079 3300025909 Bacteria 1793
211 Ga0207705_10631100 3300025909 Unclassified 833
212 Ga0207654_10356362 3300025911 Bacteria 1008
213 Ga0207654_10531681 3300025911 Unclassified 833
214 Ga0207707_10140415 3300025912 Unclassified 2112
215 Ga0207707_10355286 3300025912 Unclassified 1262
216 Ga0207707_10443355 3300025912 Unclassified 1111
217 Ga0207660_10326466 3300025917 Bacteria 1226
218 Ga0207657_10003595 3300025919 Bacteria 16527
219 Ga0207657_10009639 3300025919 Bacteria 9690
220 Ga0207657_10028999 3300025919 Bacteria 5043
221 Ga0207657_10053398 3300025919 Bacteria 3501
222 Ga0207657_10053608 3300025919 Bacteria 3493
223 Ga0207657_10056347 3300025919 Bacteria 3392
224 Ga0207657_10145127 3300025919 Bacteria 1936
225 Ga0207657_10762360 3300025919 Unclassified 749
226 Ga0207649_10080363 3300025920 Bacteria 2108
227 Ga0207649_10139617 3300025920 Unclassified 1656
228 Ga0207649_10305061 3300025920 Bacteria 1165
229 Ga0207649_10469997 3300025920 Unclassified 952
230 Ga0207649_10635373 3300025920 Bacteria 824
231 Ga0207652_10113668 3300025921 Bacteria 2403
232 Ga0207652_10122500 3300025921 Unclassified 2314
233 Ga0207652_10431762 3300025921 Bacteria 1188
234 Ga0207652_11051429 3300025921 Unclassified 714
235 Ga0207652_11574692 3300025921 Bacteria 561
236 Ga0207681_10626083 3300025923 Bacteria 891
237 Ga0207650_10040791 3300025925 Bacteria 3399
238 Ga0207650_10132434 3300025925 Bacteria 1952
239 Ga0207650_11401533 3300025925 Bacteria 595
240 Ga0207650_11594996 3300025925 Bacteria 554
241 Ga0207659_10038650 3300025926 Bacteria 3321
242 Ga0207659_10048069 3300025926 Bacteria 3021
243 Ga0207687_10518757 3300025927 Bacteria 996
244 Ga0207700_10628404 3300025928 Bacteria 957
245 Ga0207664_10137347 3300025929 Bacteria 2064
246 Ga0207644_10025658 3300025931 Unclassified 4053
247 Ga0207690_10051066 3300025932 Bacteria 2763
248 Ga0207690_10201865 3300025932 Bacteria 1510
249 Ga0207690_10567545 3300025932 Bacteria 924
250 Ga0207690_10852431 3300025932 Bacteria 754
251 Ga0207706_10063193 3300025933 Bacteria 3260
252 Ga0207706_10191872 3300025933 Bacteria 1793
253 Ga0207706_10225824 3300025933 Bacteria 1639
254 Ga0207709_10065574 3300025935 Bacteria 2284
255 Ga0207669_10084823 3300025937 Bacteria 2042
256 Ga0207704_11927778 3300025938 Unclassified 508
257 Ga0207691_10151134 3300025940 Bacteria 2041
258 Ga0207711_10067674 3300025941 Bacteria 3092
259 Ga0207711_10141130 3300025941 Bacteria 2168
260 Ga0207689_10043918 3300025942 Bacteria 3695
261 Ga0207661_10050476 3300025944 Bacteria 3314
262 Ga0207661_10102183 3300025944 Bacteria 2409
263 Ga0207661_11037675 3300025944 Unclassified 755
264 Ga0207679_10026683 3300025945 Bacteria 3986
265 Ga0207679_10052628 3300025945 Bacteria 2986
266 Ga0207679_10219169 3300025945 Bacteria 1600
267 Ga0207679_10327609 3300025945 Bacteria 1328
268 Ga0207679_10546424 3300025945 Bacteria 1039
269 Ga0207679_10576892 3300025945 Bacteria 1011
270 Ga0207667_10101062 3300025949 Bacteria 2975
271 Ga0207667_10391420 3300025949 Bacteria 1415
272 Ga0207667_10457244 3300025949 Bacteria 1297
273 Ga0207651_10016827 3300025960 Bacteria 4299
274 Ga0207651_10135474 3300025960 Bacteria 1893
275 Ga0207651_10396020 3300025960 Bacteria 1173
276 Ga0207651_10480636 3300025960 Bacteria 1071
277 Ga0207640_10056594 3300025981 Bacteria 2575
278 Ga0207640_10958238 3300025981 Unclassified 750
279 Ga0207658_10240701 3300025986 Bacteria 1533
280 Ga0207658_10296800 3300025986 Bacteria 1391
281 Ga0207677_10089994 3300026023 Bacteria 2229
282 Ga0207677_10185697 3300026023 Bacteria 1639
283 Ga0207677_10967901 3300026023 Unclassified 770
284 Ga0207703_10493528 3300026035 Bacteria 1148
285 Ga0207639_10232478 3300026041 Bacteria 1599
286 Ga0207639_10435155 3300026041 Bacteria 1188
287 Ga0207678_10010228 3300026067 Bacteria 8236
288 Ga0207678_10026606 3300026067 Bacteria 5046
289 Ga0207678_10058449 3300026067 Bacteria 3318
290 Ga0207678_10439497 3300026067 Bacteria 1133
291 Ga0207678_10472682 3300026067 Bacteria 1091
292 Ga0207702_10239945 3300026078 Bacteria 1698
293 Ga0207702_10762921 3300026078 Unclassified 955
294 Ga0207702_10937251 3300026078 Unclassified 858
295 Ga0207702_11127227 3300026078 Bacteria 778
296 Ga0207702_12087593 3300026078 Unclassified 556
297 Ga0207641_10114626 3300026088 Unclassified 2395
298 Ga0207641_10344490 3300026088 Bacteria 1419
299 Ga0207641_11347690 3300026088 Bacteria 714
300 Ga0207648_10001590 3300026089 Bacteria 24892
301 Ga0207648_10392663 3300026089 Bacteria 1256
302 Ga0207674_10030442 3300026116 Bacteria 5673
303 Ga0207674_10061056 3300026116 Bacteria 3809
304 Ga0207674_10144366 3300026116 Bacteria 2339
305 Ga0207674_10258076 3300026116 Bacteria 1690
306 Ga0207675_101802664 3300026118 Bacteria 631
307 Ga0207683_10013086 3300026121 Bacteria 7077
308 Ga0207698_10042006 3300026142 Unclassified 3412
309 Ga0207698_10075843 3300026142 Bacteria 2689
310 Ga0207698_10079590 3300026142 Bacteria 2636
311 Ga0207698_10273017 3300026142 Unclassified 1560
312 Ga0207698_10326637 3300026142 Bacteria 1439
313 Ga0207698_10597063 3300026142 Bacteria 1088
314 Ga0207698_10711048 3300026142 Bacteria 1000
315 Ga0207698_10830148 3300026142 Bacteria 928
316 Ga0268266_10023288 3300028379 Bacteria 5273
317 Ga0307408_100328527 3300031548 Bacteria 1291
318 Ga0307405_10019324 3300031731 Bacteria 3781
319 Ga0307413_10079744 3300031824 Unclassified 2094
320 Ga0307410_10321837 3300031852 Bacteria 1227
321 Ga0307412_10196252 3300031911 Bacteria 1529
322 Ga0307412_11119706 3300031911 Unclassified 701
323 Ga0307409_100024402 3300031995 Bacteria 4217
324 Ga0307416_100023285 3300032002 Bacteria 4491
325 Ga0307416_100167297 3300032002 Unclassified 2041
326 Ga0307414_10483337 3300032004 Bacteria 1093
327 Ga0307411_10095268 3300032005 Unclassified 2089
328 Ga0307415_100001570 3300032126 Bacteria 11012
329 Ga0307415_100185542 3300032126 Bacteria 1636
330 Ga0373935_0082366 3300035692 Bacteria 2094
331 Ga0373947_0045254 3300035725 Plasmid 2633
332 Ga0395899_0002851 3300037312 Bacteria 13919
333 Ga0395899_0007176 3300037312 Bacteria 8628
334 Ga0395899_0028968 3300037312 Bacteria 4166
335 Ga0395899_0108236 3300037312 Unclassified 2000
336 Ga0395899_0135686 3300037312 Unclassified 1754
337 Ga0395899_0176383 3300037312 Bacteria 1502
338 Ga0395899_0269617 3300037312 Bacteria 1161
339 Ga0395900_0001394 3300037418 Bacteria 28915
340 Ga0395900_0005401 3300037418 Bacteria 13385
341 Ga0395900_0030033 3300037418 Bacteria 5578
342 Ga0395900_0032876 3300037418 Bacteria 5336
343 Ga0395900_0050492 3300037418 Bacteria 4284
344 Ga0395900_0062387 3300037418 Bacteria 3831
345 Ga0395900_0077109 3300037418 Bacteria 3424
346 Ga0395900_0098823 3300037418 Bacteria 2999
347 Ga0395900_0195736 3300037418 Bacteria 2048
348 Ga0395900_0214370 3300037418 Unclassified 1943
349 Ga0395900_0305834 3300037418 Bacteria 1575
350 Ga0395900_0545776 3300037418 Unclassified 1104
351 Ga0395900_0802790 3300037418 Bacteria 869
352 Ga0395900_0923926 3300037418 Bacteria 795
353 Ga0395900_1111451 3300037418 Bacteria 707
354 Ga0395900_1159627 3300037418 Unclassified 689
355 Ga0395898_0028633 3300037466 Bacteria 5582
356 Ga0395898_0130916 3300037466 Bacteria 2403
357 Ga0395898_0166332 3300037466 Unclassified 2109
358 Ga0395898_0396316 3300037466 Bacteria 1316
359 Ga0395898_0537575 3300037466 Unclassified 1110
360 Ga0395898_0769259 3300037466 Bacteria 904
361 Ga0395898_1195581 3300037466 Bacteria 692
362 Ga0395905_0001106 3300037471 Bacteria 33891
363 Ga0395905_0003658 3300037471 Bacteria 16310
364 Ga0395905_0010576 3300037471 Bacteria 8962
365 Ga0395905_0014304 3300037471 Bacteria 7584
366 Ga0395905_0014752 3300037471 Bacteria 7450
367 Ga0395905_0052633 3300037471 Bacteria 3811
368 Ga0395905_0054825 3300037471 Bacteria 3730
369 Ga0395905_0056771 3300037471 Bacteria 3662
370 Ga0395905_0095517 3300037471 Bacteria 2790
371 Ga0395905_0098783 3300037471 Unclassified 2742
372 Ga0395905_0130257 3300037471 Bacteria 2366
373 Ga0395905_0168298 3300037471 Bacteria 2059
374 Ga0395905_0182500 3300037471 Bacteria 1970
375 Ga0395905_0218208 3300037471 Bacteria 1785
376 Ga0395905_0282686 3300037471 Bacteria 1545
377 Ga0395905_0451579 3300037471 Bacteria 1183
378 Ga0395905_0502574 3300037471 Bacteria 1112
379 Ga0395905_0548481 3300037471 Bacteria 1057
380 Ga0395905_0552814 3300037471 Bacteria 1052
381 Ga0395905_0742236 3300037471 Bacteria 884
382 Ga0395905_1084534 3300037471 Bacteria 704
383 Ga0395901_0029326 3300038443 Bacteria 5664
384 Ga0395901_0036445 3300038443 Bacteria 5084
385 Ga0395901_0048224 3300038443 Bacteria 4423
386 Ga0395901_0083450 3300038443 Bacteria 3340
387 Ga0395901_0109032 3300038443 Bacteria 2906
388 Ga0395901_0287119 3300038443 Bacteria 1708
389 Ga0395901_0448675 3300038443 Bacteria 1319
390 Ga0395901_0483528 3300038443 Bacteria 1263
391 Ga0395901_0558740 3300038443 Unclassified 1159
392 Ga0395901_1883920 3300038443 Unclassified 546
393 Ga0436363_1124508 3300039450 Bacteria 679
394 Ga0439448_0004818 3300042005 Bacteria 3822
395 Ga0439455_0007660 3300042012 Viruses 2291
396 Ga0439458_0000010 3300042157 Bacteria 29089
397 Ga0466972_0146692 3300044658 Bacteria 1110
398 Ga0466966_0314841 3300044684 Unclassified 940
399 Ga0466966_0365931 3300044684 Bacteria 866
400 Ga0466961_0185884 3300044693 Bacteria 1289
401 Ga0466961_0238386 3300044693 Unclassified 1118
402 Ga0466963_0049573 3300044694 Bacteria 2777
403 Ga0466963_0136053 3300044694 Unclassified 1700
404 Ga0466963_0196033 3300044694 Bacteria 1412
405 Ga0466963_0769190 3300044694 Bacteria 679
406 Ga0466971_0042625 3300044719 Unclassified 2039
407 Ga0466970_0215978 3300044765 Bacteria 1069
408 Ga0466970_0235528 3300044765 Bacteria 1024
409 Ga0466957_0753014 3300044842 Bacteria 690
410 Ga0466959_0019159 3300045049 Bacteria 5031
411 Ga0466959_0229344 3300045049 Bacteria 1286
412 Ga0466959_0513791 3300045049 Bacteria 809
413 Ga0466959_0717173 3300045049 Unclassified 670
414 Ga0466958_0051336 3300045836 Unclassified 2497
415 Ga0466958_0059777 3300045836 Bacteria 2319
416 Ga0466958_0319062 3300045836 Unclassified 998
417 Ga0466958_0572770 3300045836 Unclassified 734
418 Ga0466967_0004351 3300045976 Bacteria 9534
419 Ga0466967_0228704 3300045976 Bacteria 1770
420 Ga0466967_0390542 3300045976 Bacteria 1353
421 Ga0466967_0402820 3300045976 Bacteria 1331
422 Ga0466967_0403426 3300045976 Unclassified 1330
423 Ga0466967_1015971 3300045976 Bacteria 826
424 Ga0466967_1305682 3300045976 Unclassified 723
425 Ga0466967_1521393 3300045976 Unclassified 666
426 Ga0466967_1755532 3300045976 Bacteria 618
427 Ga0495616_0074256 3300046513 Bacteria 1639
428 Ga0495643_0175695 3300046522 Bacteria 1044
429 Ga0495663_0006214 3300046525 Unclassified 3298
430 Ga0495663_0174536 3300046525 Bacteria 742
431 Ga0495668_0010412 3300046616 Bacteria 5626
432 Ga0495668_0462314 3300046616 Bacteria 698
433 Ga0495669_0000119 3300046684 Bacteria 50758
434 Ga0495669_0009982 3300046684 Bacteria 4014
435 Ga0495669_0018524 3300046684 Unclassified 2994
436 Ga0495669_0072649 3300046684 Bacteria 1570
437 Ga0495669_0135872 3300046684 Unclassified 1159
438 Ga0495677_0059408 3300047445 Bacteria 1416
439 Ga0495677_0128186 3300047445 Bacteria 970
440 Ga0496101_0536144 3300048904 Bacteria 925
441 Ga0496102_0173186 3300048905 Unclassified 2032
442 Ga0496103_0339924 3300048906 Bacteria 965
443 Ga0496105_0164931 3300048908 Bacteria 1818
444 Ga0496106_0394518 3300048909 Bacteria 1112
445 Ga0496107_0084052 3300048910 Bacteria 2322
446 Ga0496108_0039210 3300048911 Unclassified 3949
447 Ga0496109_0161187 3300048912 Bacteria 2101
448 Ga0496109_1220279 3300048912 Bacteria 689
449 Ga0496111_0048239 3300048914 Bacteria 3068
450 Ga0496111_0780158 3300048914 Bacteria 692
451 Ga0496112_0005611 3300048915 Bacteria 10883
452 Ga0496112_0025560 3300048915 Bacteria 5670
453 Ga0496113_0066199 3300048916 Bacteria 2736
454 Ga0496113_0156252 3300048916 Bacteria 1801
455 Ga0501070_0179442 3300049586 Bacteria 1743
456 Ga0501080_1665341 3300049742 Bacteria 539
457 Ga0501270_015531 3300049767 Unclassified 1089
458 nmdc:mga0sz30_184095_c1 3300050516 Bacteria 927
459 Ga0495655_0210742 3300053083 Bacteria 639
460 Ga0590071_021960 3300059421 Bacteria 1506
461 Ga0466962_0014948 3300061719 Bacteria 3742
462 Ga0466962_0073872 3300061719 Unclassified 1629

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005616 Ga0068852_100940708 Ga0068852_1009407082 112
2 3300026142 Ga0207698_10711048 Ga0207698_107110482 112
3 3300037312 Ga0395899_0028968 Ga0395899_0028968_3713_4102 112
4 3300037418 Ga0395900_0030033 Ga0395900_0030033_4706_5122 112
5 3300037466 Ga0395898_0537575 Ga0395898_0537575_345_734 112
6 3300037471 Ga0395905_0182500 Ga0395905_0182500_329_718 112
7 3300038443 Ga0395901_0109032 Ga0395901_0109032_504_920 112
8 3300037418 Ga0395900_0062387 Ga0395900_0062387_2941_3357 114
9 3300037471 Ga0395905_0014752 Ga0395905_0014752_6599_7015 114
10 3300013100 Ga0157373_10167970 Ga0157373_101679702 117
11 3300005455 Ga0070663_100015299 Ga0070663_1000152995 119
12 3300006028 Ga0070717_10144670 Ga0070717_101446703 119
13 3300025906 Ga0207699_10141408 Ga0207699_101414081 119
14 3300037312 Ga0395899_0176383 Ga0395899_0176383_1132_1491 119
15 3300005327 Ga0070658_10054865 Ga0070658_100548652 121
16 3300005337 Ga0070682_100115715 Ga0070682_1001157152 121
17 3300005339 Ga0070660_100011744 Ga0070660_1000117443 121
18 3300005530 Ga0070679_100101746 Ga0070679_1001017462 121
19 3300005616 Ga0068852_100178615 Ga0068852_1001786152 121
20 3300025909 Ga0207705_10103473 Ga0207705_101034732 121
21 3300025919 Ga0207657_10009639 Ga0207657_100096395 121
22 3300025921 Ga0207652_10113668 Ga0207652_101136682 121
23 3300026142 Ga0207698_10042006 Ga0207698_100420062 121
24 3300005336 Ga0070680_100267509 Ga0070680_1002675091 122
25 3300005458 Ga0070681_10064636 Ga0070681_100646365 122
26 3300025912 Ga0207707_10443355 Ga0207707_104433553 122
27 3300037312 Ga0395899_0007176 Ga0395899_0007176_2376_2768 122
28 3300037418 Ga0395900_0214370 Ga0395900_0214370_1280_1672 122
29 3300046522 Ga0495643_0175695 Ga0495643_0175695_284_652 122
30 3300037418 Ga0395900_1111451 Ga0395900_1111451_78_449 123
31 3300005331 Ga0070670_100093791 Ga0070670_1000937911 125
32 3300005339 Ga0070660_100290643 Ga0070660_1002906432 125
33 3300005455 Ga0070663_100402075 Ga0070663_1004020752 125
34 3300025925 Ga0207650_10040791 Ga0207650_100407912 125
35 3300025945 Ga0207679_10026683 Ga0207679_100266832 125
36 3300026067 Ga0207678_10439497 Ga0207678_104394972 125
37 3300044694 Ga0466963_0049573 Ga0466963_0049573_2104_2520 125
38 3300045976 Ga0466967_0402820 Ga0466967_0402820_132_548 125
39 3300005344 Ga0070661_100037027 Ga0070661_1000370273 126
40 3300005366 Ga0070659_100030930 Ga0070659_1000309305 126
41 3300025909 Ga0207705_10631100 Ga0207705_106311002 126
42 3300025919 Ga0207657_10003595 Ga0207657_100035959 126
43 3300045836 Ga0466958_0051336 Ga0466958_0051336_503_919 126
44 3300045976 Ga0466967_0403426 Ga0466967_0403426_95_511 126
45 3300005329 Ga0070683_100566111 Ga0070683_1005661112 127
46 3300013102 Ga0157371_11488262 Ga0157371_114882622 127
47 3300044842 Ga0466957_0753014 Ga0466957_0753014_241_657 127
48 3300048914 Ga0496111_0780158 Ga0496111_0780158_218_601 127
49 3300005539 Ga0068853_100224045 Ga0068853_1002240453 130
50 3300009177 Ga0105248_10047519 Ga0105248_100475192 130
51 3300013104 Ga0157370_11981505 Ga0157370_119815052 130
52 3300014968 Ga0157379_10132636 Ga0157379_101326362 130
53 3300025911 Ga0207654_10531681 Ga0207654_105316812 130
54 3300037418 Ga0395900_0032876 Ga0395900_0032876_2672_3064 130
55 3300037418 Ga0395900_0802790 Ga0395900_0802790_95_487 130
56 3300037471 Ga0395905_0014304 Ga0395905_0014304_2094_2486 130
57 3300037471 Ga0395905_0282686 Ga0395905_0282686_637_1029 130
58 3300037471 Ga0395905_0548481 Ga0395905_0548481_132_524 130
59 3300005339 Ga0070660_100251046 Ga0070660_1002510462 131
60 3300005366 Ga0070659_100010221 Ga0070659_1000102215 131
61 3300005564 Ga0070664_100075851 Ga0070664_1000758513 131
62 3300025932 Ga0207690_10201865 Ga0207690_102018652 131
63 3300025945 Ga0207679_10052628 Ga0207679_100526282 131
64 3300045976 Ga0466967_1015971 Ga0466967_1015971_225_620 131
65 3300038443 Ga0395901_0558740 Ga0395901_0558740_303_713 136
66 3300038443 Ga0395901_0483528 Ga0395901_0483528_201_614 137
67 3300003320 rootH2_10181735 rootH2_101817353 138
68 3300005328 Ga0070676_10089188 Ga0070676_100891882 138
69 3300005328 Ga0070676_10539383 Ga0070676_105393832 138
70 3300005330 Ga0070690_100435945 Ga0070690_1004359452 138
71 3300005331 Ga0070670_102099354 Ga0070670_1020993541 138
72 3300005333 Ga0070677_10027972 Ga0070677_100279722 138
73 3300005334 Ga0068869_100025190 Ga0068869_1000251904 138
74 3300005338 Ga0068868_100044286 Ga0068868_1000442865 138
75 3300005338 Ga0068868_100192637 Ga0068868_1001926373 138
76 3300005338 Ga0068868_100355555 Ga0068868_1003555553 138
77 3300005338 Ga0068868_100733395 Ga0068868_1007333952 138
78 3300005343 Ga0070687_100141136 Ga0070687_1001411362 138
79 3300005344 Ga0070661_100028778 Ga0070661_1000287785 138
80 3300005353 Ga0070669_101542337 Ga0070669_1015423371 138
81 3300005354 Ga0070675_100063980 Ga0070675_1000639803 138
82 3300005354 Ga0070675_100083451 Ga0070675_1000834511 138
83 3300005355 Ga0070671_100059181 Ga0070671_1000591813 138
84 3300005355 Ga0070671_100467059 Ga0070671_1004670591 138
85 3300005356 Ga0070674_100010556 Ga0070674_1000105565 138
86 3300005356 Ga0070674_100456885 Ga0070674_1004568852 138
87 3300005364 Ga0070673_100027012 Ga0070673_1000270124 138
88 3300005364 Ga0070673_100072672 Ga0070673_1000726722 138
89 3300005364 Ga0070673_100273111 Ga0070673_1002731112 138
90 3300005366 Ga0070659_100066222 Ga0070659_1000662222 138
91 3300005366 Ga0070659_100401272 Ga0070659_1004012723 138
92 3300005366 Ga0070659_100636021 Ga0070659_1006360212 138
93 3300005366 Ga0070659_100763029 Ga0070659_1007630292 138
94 3300005366 Ga0070659_101077213 Ga0070659_1010772132 138
95 3300005367 Ga0070667_100413546 Ga0070667_1004135462 138
96 3300005367 Ga0070667_100764979 Ga0070667_1007649791 138
97 3300005455 Ga0070663_100600588 Ga0070663_1006005881 138
98 3300005456 Ga0070678_100002540 Ga0070678_1000025405 138
99 3300005456 Ga0070678_100418584 Ga0070678_1004185842 138
100 3300005457 Ga0070662_100072090 Ga0070662_1000720905 138
101 3300005457 Ga0070662_100250933 Ga0070662_1002509332 138
102 3300005457 Ga0070662_100319315 Ga0070662_1003193152 138
103 3300005458 Ga0070681_10456174 Ga0070681_104561742 138
104 3300005459 Ga0068867_100110964 Ga0068867_1001109644 138
105 3300005459 Ga0068867_100139173 Ga0068867_1001391733 138
106 3300005530 Ga0070679_100313400 Ga0070679_1003134001 138
107 3300005530 Ga0070679_101027210 Ga0070679_1010272101 138
108 3300005539 Ga0068853_100551436 Ga0068853_1005514362 138
109 3300005543 Ga0070672_100363484 Ga0070672_1003634842 138
110 3300005547 Ga0070693_100324994 Ga0070693_1003249941 138
111 3300005563 Ga0068855_100385711 Ga0068855_1003857113 138
112 3300005564 Ga0070664_100182069 Ga0070664_1001820692 138
113 3300005564 Ga0070664_100293223 Ga0070664_1002932232 138
114 3300005564 Ga0070664_100376179 Ga0070664_1003761792 138
115 3300005577 Ga0068857_100238972 Ga0068857_1002389722 138
116 3300005578 Ga0068854_100112512 Ga0068854_1001125122 138
117 3300005578 Ga0068854_101539335 Ga0068854_1015393352 138
118 3300005615 Ga0070702_100192280 Ga0070702_1001922803 138
119 3300005616 Ga0068852_100194998 Ga0068852_1001949983 138
120 3300005616 Ga0068852_100871820 Ga0068852_1008718202 138
121 3300005617 Ga0068859_100165137 Ga0068859_1001651372 138
122 3300005718 Ga0068866_10043413 Ga0068866_100434132 138
123 3300005834 Ga0068851_10178933 Ga0068851_101789332 138
124 3300005834 Ga0068851_10278657 Ga0068851_102786572 138
125 3300005840 Ga0068870_10381422 Ga0068870_103814222 138
126 3300005840 Ga0068870_10528917 Ga0068870_105289172 138
127 3300005840 Ga0068870_10812704 Ga0068870_108127042 138
128 3300005841 Ga0068863_100063028 Ga0068863_1000630282 138
129 3300005841 Ga0068863_100379998 Ga0068863_1003799983 138
130 3300005842 Ga0068858_100068659 Ga0068858_1000686594 138
131 3300005842 Ga0068858_100442538 Ga0068858_1004425381 138
132 3300005844 Ga0068862_101579934 Ga0068862_1015799342 138
133 3300006195 Ga0075366_10727285 Ga0075366_107272852 138
134 3300006237 Ga0097621_100174174 Ga0097621_1001741742 138
135 3300006237 Ga0097621_100294368 Ga0097621_1002943682 138
136 3300006358 Ga0068871_100352509 Ga0068871_1003525092 138
137 3300006881 Ga0068865_100132097 Ga0068865_1001320974 138
138 3300006931 Ga0097620_100015588 Ga0097620_1000155882 138
139 3300006931 Ga0097620_100165136 Ga0097620_1001651362 138
140 3300009098 Ga0105245_10689502 Ga0105245_106895022 138
141 3300009148 Ga0105243_10050717 Ga0105243_100507174 138
142 3300009174 Ga0105241_10256123 Ga0105241_102561233 138
143 3300009177 Ga0105248_10474002 Ga0105248_104740023 138
144 3300010375 Ga0105239_11452397 Ga0105239_114523972 138
145 3300013100 Ga0157373_10034737 Ga0157373_100347374 138
146 3300013105 Ga0157369_11470337 Ga0157369_114703371 138
147 3300013297 Ga0157378_10024042 Ga0157378_100240424 138
148 3300013297 Ga0157378_11090335 Ga0157378_110903352 138
149 3300013306 Ga0163162_10006085 Ga0163162_1000608511 138
150 3300013306 Ga0163162_10132017 Ga0163162_101320172 138
151 3300013306 Ga0163162_10534071 Ga0163162_105340712 138
152 3300013308 Ga0157375_10296145 Ga0157375_102961452 138
153 3300013308 Ga0157375_10497710 Ga0157375_104977103 138
154 3300014326 Ga0157380_10374047 Ga0157380_103740472 138
155 3300025315 Ga0207697_10005443 Ga0207697_100054435 138
156 3300025893 Ga0207682_10015536 Ga0207682_100155362 138
157 3300025899 Ga0207642_10028201 Ga0207642_100282014 138
158 3300025901 Ga0207688_10011843 Ga0207688_100118436 138
159 3300025903 Ga0207680_10096787 Ga0207680_100967872 138
160 3300025907 Ga0207645_10053883 Ga0207645_100538833 138
161 3300025907 Ga0207645_10082412 Ga0207645_100824124 138
162 3300025907 Ga0207645_10154137 Ga0207645_101541372 138
163 3300025908 Ga0207643_10412713 Ga0207643_104127131 138
164 3300025911 Ga0207654_10356362 Ga0207654_103563623 138
165 3300025919 Ga0207657_10053398 Ga0207657_100533983 138
166 3300025919 Ga0207657_10053608 Ga0207657_100536084 138
167 3300025919 Ga0207657_10145127 Ga0207657_101451272 138
168 3300025920 Ga0207649_10080363 Ga0207649_100803633 138
169 3300025921 Ga0207652_11051429 Ga0207652_110514292 138
170 3300025923 Ga0207681_10626083 Ga0207681_106260832 138
171 3300025925 Ga0207650_10132434 Ga0207650_101324344 138
172 3300025925 Ga0207650_11401533 Ga0207650_114015332 138
173 3300025925 Ga0207650_11594996 Ga0207650_115949962 138
174 3300025926 Ga0207659_10038650 Ga0207659_100386505 138
175 3300025926 Ga0207659_10048069 Ga0207659_100480693 138
176 3300025927 Ga0207687_10518757 Ga0207687_105187572 138
177 3300025928 Ga0207700_10628404 Ga0207700_106284042 138
178 3300025932 Ga0207690_10051066 Ga0207690_100510664 138
179 3300025932 Ga0207690_10567545 Ga0207690_105675452 138
180 3300025932 Ga0207690_10852431 Ga0207690_108524312 138
181 3300025933 Ga0207706_10063193 Ga0207706_100631931 138
182 3300025933 Ga0207706_10191872 Ga0207706_101918723 138
183 3300025935 Ga0207709_10065574 Ga0207709_100655742 138
184 3300025937 Ga0207669_10084823 Ga0207669_100848234 138
185 3300025938 Ga0207704_11927778 Ga0207704_119277781 138
186 3300025940 Ga0207691_10151134 Ga0207691_101511344 138
187 3300025941 Ga0207711_10067674 Ga0207711_100676743 138
188 3300025942 Ga0207689_10043918 Ga0207689_100439183 138
189 3300025945 Ga0207679_10219169 Ga0207679_102191692 138
190 3300025945 Ga0207679_10327609 Ga0207679_103276092 138
191 3300025945 Ga0207679_10546424 Ga0207679_105464242 138
192 3300025945 Ga0207679_10576892 Ga0207679_105768922 138
193 3300025949 Ga0207667_10391420 Ga0207667_103914203 138
194 3300025960 Ga0207651_10016827 Ga0207651_100168272 138
195 3300025960 Ga0207651_10396020 Ga0207651_103960202 138
196 3300025960 Ga0207651_10480636 Ga0207651_104806362 138
197 3300025981 Ga0207640_10958238 Ga0207640_109582382 138
198 3300025986 Ga0207658_10240701 Ga0207658_102407012 138
199 3300025986 Ga0207658_10296800 Ga0207658_102968002 138
200 3300026023 Ga0207677_10089994 Ga0207677_100899942 138
201 3300026023 Ga0207677_10185697 Ga0207677_101856972 138
202 3300026023 Ga0207677_10967901 Ga0207677_109679012 138
203 3300026035 Ga0207703_10493528 Ga0207703_104935282 138
204 3300026041 Ga0207639_10232478 Ga0207639_102324782 138
205 3300026041 Ga0207639_10435155 Ga0207639_104351552 138
206 3300026067 Ga0207678_10026606 Ga0207678_100266062 138
207 3300026067 Ga0207678_10058449 Ga0207678_100584494 138
208 3300026088 Ga0207641_10114626 Ga0207641_101146264 138
209 3300026088 Ga0207641_10344490 Ga0207641_103444903 138
210 3300026089 Ga0207648_10001590 Ga0207648_1000159019 138
211 3300026089 Ga0207648_10392663 Ga0207648_103926632 138
212 3300026116 Ga0207674_10144366 Ga0207674_101443662 138
213 3300026116 Ga0207674_10258076 Ga0207674_102580763 138
214 3300026118 Ga0207675_101802664 Ga0207675_1018026642 138
215 3300026121 Ga0207683_10013086 Ga0207683_100130866 138
216 3300026142 Ga0207698_10273017 Ga0207698_102730172 138
217 3300026142 Ga0207698_10597063 Ga0207698_105970632 138
218 3300026142 Ga0207698_10830148 Ga0207698_108301482 138
219 3300028379 Ga0268266_10023288 Ga0268266_100232883 138
220 3300031548 Ga0307408_100328527 Ga0307408_1003285272 138
221 3300031731 Ga0307405_10019324 Ga0307405_100193244 138
222 3300031824 Ga0307413_10079744 Ga0307413_100797444 138
223 3300031852 Ga0307410_10321837 Ga0307410_103218372 138
224 3300031911 Ga0307412_10196252 Ga0307412_101962521 138
225 3300031911 Ga0307412_11119706 Ga0307412_111197062 138
226 3300031995 Ga0307409_100024402 Ga0307409_1000244025 138
227 3300032002 Ga0307416_100023285 Ga0307416_1000232854 138
228 3300032002 Ga0307416_100167297 Ga0307416_1001672972 138
229 3300032005 Ga0307411_10095268 Ga0307411_100952683 138
230 3300032126 Ga0307415_100001570 Ga0307415_1000015709 138
231 3300032126 Ga0307415_100185542 Ga0307415_1001855422 138
232 3300037312 Ga0395899_0108236 Ga0395899_0108236_589_1005 138
233 3300037312 Ga0395899_0269617 Ga0395899_0269617_182_598 138
234 3300037418 Ga0395900_0077109 Ga0395900_0077109_2177_2593 138
235 3300037418 Ga0395900_0195736 Ga0395900_0195736_1452_1868 138
236 3300037418 Ga0395900_0305834 Ga0395900_0305834_471_887 138
237 3300037418 Ga0395900_0545776 Ga0395900_0545776_122_538 138
238 3300037466 Ga0395898_0028633 Ga0395898_0028633_787_1203 138
239 3300037466 Ga0395898_0130916 Ga0395898_0130916_1275_1691 138
240 3300037466 Ga0395898_0769259 Ga0395898_0769259_464_880 138
241 3300037466 Ga0395898_1195581 Ga0395898_1195581_188_604 138
242 3300037471 Ga0395905_0010576 Ga0395905_0010576_8005_8421 138
243 3300037471 Ga0395905_0095517 Ga0395905_0095517_2217_2633 138
244 3300037471 Ga0395905_0130257 Ga0395905_0130257_328_744 138
245 3300037471 Ga0395905_0168298 Ga0395905_0168298_473_889 138
246 3300037471 Ga0395905_0451579 Ga0395905_0451579_260_676 138
247 3300037471 Ga0395905_0502574 Ga0395905_0502574_443_859 138
248 3300037471 Ga0395905_1084534 Ga0395905_1084534_222_638 138
249 3300038443 Ga0395901_0036445 Ga0395901_0036445_80_496 138
250 3300038443 Ga0395901_0083450 Ga0395901_0083450_941_1357 138
251 3300038443 Ga0395901_0448675 Ga0395901_0448675_464_880 138
252 3300038443 Ga0395901_1883920 Ga0395901_1883920_59_475 138
253 3300044684 Ga0466966_0314841 Ga0466966_0314841_315_731 138
254 3300044693 Ga0466961_0238386 Ga0466961_0238386_613_1029 138
255 3300044694 Ga0466963_0769190 Ga0466963_0769190_17_433 138
256 3300045049 Ga0466959_0019159 Ga0466959_0019159_755_1171 138
257 3300045836 Ga0466958_0319062 Ga0466958_0319062_323_739 138
258 3300045836 Ga0466958_0572770 Ga0466958_0572770_285_701 138
259 3300045976 Ga0466967_0004351 Ga0466967_0004351_2969_3385 138
260 3300045976 Ga0466967_1755532 Ga0466967_1755532_98_514 138
261 3300046513 Ga0495616_0074256 Ga0495616_0074256_724_1140 138
262 3300046525 Ga0495663_0006214 Ga0495663_0006214_1480_1896 138
263 3300046525 Ga0495663_0174536 Ga0495663_0174536_294_710 138
264 3300046616 Ga0495668_0010412 Ga0495668_0010412_2784_3200 138
265 3300046616 Ga0495668_0462314 Ga0495668_0462314_140_556 138
266 3300046684 Ga0495669_0000119 Ga0495669_0000119_29369_29785 138
267 3300046684 Ga0495669_0009982 Ga0495669_0009982_1111_1527 138
268 3300046684 Ga0495669_0018524 Ga0495669_0018524_1122_1538 138
269 3300046684 Ga0495669_0072649 Ga0495669_0072649_628_1044 138
270 3300047445 Ga0495677_0059408 Ga0495677_0059408_615_1031 138
271 3300047445 Ga0495677_0128186 Ga0495677_0128186_126_542 138
272 3300048905 Ga0496102_0173186 Ga0496102_0173186_1234_1650 138
273 3300048906 Ga0496103_0339924 Ga0496103_0339924_491_907 138
274 3300048909 Ga0496106_0394518 Ga0496106_0394518_491_907 138
275 3300048912 Ga0496109_1220279 Ga0496109_1220279_193_609 138
276 3300048915 Ga0496112_0005611 Ga0496112_0005611_4851_5267 138
277 3300048916 Ga0496113_0066199 Ga0496113_0066199_105_521 138
278 3300049586 Ga0501070_0179442 Ga0501070_0179442_1104_1520 138
279 3300049742 Ga0501080_1665341 Ga0501080_1665341_85_501 138
280 3300049767 Ga0501270_015531 Ga0501270_015531_212_628 138
281 3300050516 nmdc:mga0sz30_184095_c1 nmdc:mga0sz30_184095_c1_182_598 138
282 3300053083 Ga0495655_0210742 Ga0495655_0210742_42_458 138
283 3300059421 Ga0590071_021960 Ga0590071_021960_563_979 138
284 3300001979 JGI24740J21852_10005282 JGI24740J21852_100052827 139
285 3300005327 Ga0070658_10014633 Ga0070658_100146335 139
286 3300005327 Ga0070658_10188825 Ga0070658_101888253 139
287 3300005327 Ga0070658_10707591 Ga0070658_107075911 139
288 3300005327 Ga0070658_11123480 Ga0070658_111234801 139
289 3300005327 Ga0070658_11140136 Ga0070658_111401361 139
290 3300005329 Ga0070683_100043196 Ga0070683_1000431964 139
291 3300005329 Ga0070683_102083854 Ga0070683_1020838541 139
292 3300005336 Ga0070680_100161426 Ga0070680_1001614262 139
293 3300005337 Ga0070682_100048175 Ga0070682_1000481752 139
294 3300005339 Ga0070660_100101901 Ga0070660_1001019011 139
295 3300005339 Ga0070660_100678356 Ga0070660_1006783562 139
296 3300005339 Ga0070660_100829138 Ga0070660_1008291382 139
297 3300005344 Ga0070661_100080661 Ga0070661_1000806613 139
298 3300005344 Ga0070661_100100876 Ga0070661_1001008762 139
299 3300005344 Ga0070661_100155277 Ga0070661_1001552772 139
300 3300005344 Ga0070661_100218100 Ga0070661_1002181002 139
301 3300005344 Ga0070661_100523718 Ga0070661_1005237182 139
302 3300005345 Ga0070692_10156863 Ga0070692_101568632 139
303 3300005355 Ga0070671_100214913 Ga0070671_1002149132 139
304 3300005364 Ga0070673_100225521 Ga0070673_1002255212 139
305 3300005366 Ga0070659_100608613 Ga0070659_1006086132 139
306 3300005366 Ga0070659_100887135 Ga0070659_1008871352 139
307 3300005435 Ga0070714_100144037 Ga0070714_1001440374 139
308 3300005455 Ga0070663_100154964 Ga0070663_1001549642 139
309 3300005457 Ga0070662_100361214 Ga0070662_1003612142 139
310 3300005458 Ga0070681_10082750 Ga0070681_100827503 139
311 3300005458 Ga0070681_10206671 Ga0070681_102066713 139
312 3300005458 Ga0070681_10256497 Ga0070681_102564973 139
313 3300005458 Ga0070681_11222226 Ga0070681_112222261 139
314 3300005530 Ga0070679_100482063 Ga0070679_1004820632 139
315 3300005530 Ga0070679_101830333 Ga0070679_1018303331 139
316 3300005535 Ga0070684_100000841 Ga0070684_1000008415 139
317 3300005535 Ga0070684_100523506 Ga0070684_1005235062 139
318 3300005539 Ga0068853_100489074 Ga0068853_1004890742 139
319 3300005539 Ga0068853_100535344 Ga0068853_1005353442 139
320 3300005539 Ga0068853_101088361 Ga0068853_1010883612 139
321 3300005563 Ga0068855_100092838 Ga0068855_1000928384 139
322 3300005563 Ga0068855_100163790 Ga0068855_1001637902 139
323 3300005564 Ga0070664_100042053 Ga0070664_1000420535 139
324 3300005564 Ga0070664_100486392 Ga0070664_1004863922 139
325 3300005577 Ga0068857_100062940 Ga0068857_1000629405 139
326 3300005577 Ga0068857_100146000 Ga0068857_1001460001 139
327 3300005578 Ga0068854_100132638 Ga0068854_1001326381 139
328 3300005578 Ga0068854_100214838 Ga0068854_1002148382 139
329 3300005578 Ga0068854_100345966 Ga0068854_1003459662 139
330 3300005614 Ga0068856_100083925 Ga0068856_1000839255 139
331 3300005614 Ga0068856_100099410 Ga0068856_1000994103 139
332 3300005614 Ga0068856_100313017 Ga0068856_1003130172 139
333 3300005616 Ga0068852_100016952 Ga0068852_1000169522 139
334 3300005616 Ga0068852_100160652 Ga0068852_1001606522 139
335 3300005616 Ga0068852_100378954 Ga0068852_1003789542 139
336 3300005616 Ga0068852_101406580 Ga0068852_1014065802 139
337 3300005616 Ga0068852_102159042 Ga0068852_1021590422 139
338 3300005618 Ga0068864_100030447 Ga0068864_1000304473 139
339 3300005834 Ga0068851_10087947 Ga0068851_100879473 139
340 3300005841 Ga0068863_102013903 Ga0068863_1020139032 139
341 3300006237 Ga0097621_100177110 Ga0097621_1001771102 139
342 3300009177 Ga0105248_10305139 Ga0105248_103051392 139
343 3300009551 Ga0105238_10213208 Ga0105238_102132082 139
344 3300010375 Ga0105239_12760447 Ga0105239_127604471 139
345 3300013100 Ga0157373_10504751 Ga0157373_105047512 139
346 3300013102 Ga0157371_10026784 Ga0157371_100267842 139
347 3300013102 Ga0157371_10223904 Ga0157371_102239042 139
348 3300013102 Ga0157371_10307471 Ga0157371_103074712 139
349 3300013102 Ga0157371_10406713 Ga0157371_104067131 139
350 3300013104 Ga0157370_10122048 Ga0157370_101220481 139
351 3300013104 Ga0157370_10151341 Ga0157370_101513414 139
352 3300013104 Ga0157370_10170301 Ga0157370_101703013 139
353 3300013105 Ga0157369_10082269 Ga0157369_100822692 139
354 3300013105 Ga0157369_10183223 Ga0157369_101832232 139
355 3300013105 Ga0157369_10249853 Ga0157369_102498532 139
356 3300013105 Ga0157369_10448074 Ga0157369_104480742 139
357 3300013307 Ga0157372_10353591 Ga0157372_103535912 139
358 3300013307 Ga0157372_10857410 Ga0157372_108574101 139
359 3300013307 Ga0157372_12939006 Ga0157372_129390062 139
360 3300020082 Ga0206353_10071993 Ga0206353_100719932 139
361 3300025321 Ga0207656_10054476 Ga0207656_100544762 139
362 3300025904 Ga0207647_10047271 Ga0207647_100472712 139
363 3300025904 Ga0207647_10048145 Ga0207647_100481454 139
364 3300025909 Ga0207705_10018993 Ga0207705_100189934 139
365 3300025909 Ga0207705_10020519 Ga0207705_100205192 139
366 3300025909 Ga0207705_10039541 Ga0207705_100395415 139
367 3300025909 Ga0207705_10083923 Ga0207705_100839232 139
368 3300025909 Ga0207705_10119167 Ga0207705_101191672 139
369 3300025909 Ga0207705_10142079 Ga0207705_101420792 139
370 3300025912 Ga0207707_10140415 Ga0207707_101404152 139
371 3300025912 Ga0207707_10355286 Ga0207707_103552862 139
372 3300025917 Ga0207660_10326466 Ga0207660_103264661 139
373 3300025919 Ga0207657_10028999 Ga0207657_100289996 139
374 3300025919 Ga0207657_10056347 Ga0207657_100563475 139
375 3300025919 Ga0207657_10762360 Ga0207657_107623602 139
376 3300025920 Ga0207649_10139617 Ga0207649_101396172 139
377 3300025920 Ga0207649_10305061 Ga0207649_103050612 139
378 3300025920 Ga0207649_10469997 Ga0207649_104699971 139
379 3300025920 Ga0207649_10635373 Ga0207649_106353732 139
380 3300025921 Ga0207652_10122500 Ga0207652_101225002 139
381 3300025921 Ga0207652_10431762 Ga0207652_104317621 139
382 3300025921 Ga0207652_11574692 Ga0207652_115746921 139
383 3300025929 Ga0207664_10137347 Ga0207664_101373472 139
384 3300025931 Ga0207644_10025658 Ga0207644_100256585 139
385 3300025933 Ga0207706_10225824 Ga0207706_102258242 139
386 3300025941 Ga0207711_10141130 Ga0207711_101411302 139
387 3300025944 Ga0207661_10050476 Ga0207661_100504765 139
388 3300025944 Ga0207661_10102183 Ga0207661_101021832 139
389 3300025944 Ga0207661_11037675 Ga0207661_110376752 139
390 3300025949 Ga0207667_10101062 Ga0207667_101010622 139
391 3300025949 Ga0207667_10457244 Ga0207667_104572441 139
392 3300025960 Ga0207651_10135474 Ga0207651_101354742 139
393 3300025981 Ga0207640_10056594 Ga0207640_100565943 139
394 3300026067 Ga0207678_10010228 Ga0207678_100102284 139
395 3300026067 Ga0207678_10472682 Ga0207678_104726822 139
396 3300026078 Ga0207702_10239945 Ga0207702_102399452 139
397 3300026078 Ga0207702_10762921 Ga0207702_107629212 139
398 3300026078 Ga0207702_10937251 Ga0207702_109372512 139
399 3300026078 Ga0207702_11127227 Ga0207702_111272272 139
400 3300026078 Ga0207702_12087593 Ga0207702_120875931 139
401 3300026088 Ga0207641_11347690 Ga0207641_113476902 139
402 3300026116 Ga0207674_10030442 Ga0207674_100304425 139
403 3300026116 Ga0207674_10061056 Ga0207674_100610564 139
404 3300026142 Ga0207698_10075843 Ga0207698_100758433 139
405 3300026142 Ga0207698_10079590 Ga0207698_100795902 139
406 3300026142 Ga0207698_10326637 Ga0207698_103266372 139
407 3300032004 Ga0307414_10483337 Ga0307414_104833372 139
408 3300035692 Ga0373935_0082366 Ga0373935_0082366_1179_1598 139
409 3300035725 Ga0373947_0045254 Ga0373947_0045254_1715_2134 139
410 3300037312 Ga0395899_0002851 Ga0395899_0002851_7256_7675 139
411 3300037312 Ga0395899_0135686 Ga0395899_0135686_894_1313 139
412 3300037418 Ga0395900_0001394 Ga0395900_0001394_25078_25497 139
413 3300037418 Ga0395900_0005401 Ga0395900_0005401_9063_9482 139
414 3300037418 Ga0395900_0050492 Ga0395900_0050492_1745_2164 139
415 3300037418 Ga0395900_0098823 Ga0395900_0098823_2165_2584 139
416 3300037418 Ga0395900_0923926 Ga0395900_0923926_55_474 139
417 3300037418 Ga0395900_1159627 Ga0395900_1159627_162_581 139
418 3300037466 Ga0395898_0166332 Ga0395898_0166332_1257_1676 139
419 3300037466 Ga0395898_0396316 Ga0395898_0396316_614_1033 139
420 3300037471 Ga0395905_0001106 Ga0395905_0001106_3337_3756 139
421 3300037471 Ga0395905_0003658 Ga0395905_0003658_5331_5750 139
422 3300037471 Ga0395905_0052633 Ga0395905_0052633_2317_2736 139
423 3300037471 Ga0395905_0054825 Ga0395905_0054825_1306_1725 139
424 3300037471 Ga0395905_0056771 Ga0395905_0056771_1348_1767 139
425 3300037471 Ga0395905_0098783 Ga0395905_0098783_183_602 139
426 3300037471 Ga0395905_0218208 Ga0395905_0218208_341_760 139
427 3300037471 Ga0395905_0552814 Ga0395905_0552814_434_853 139
428 3300037471 Ga0395905_0742236 Ga0395905_0742236_219_638 139
429 3300038443 Ga0395901_0029326 Ga0395901_0029326_1469_1888 139
430 3300038443 Ga0395901_0048224 Ga0395901_0048224_1702_2121 139
431 3300038443 Ga0395901_0287119 Ga0395901_0287119_912_1331 139
432 3300039450 Ga0436363_1124508 Ga0436363_1124508_59_478 139
433 3300042005 Ga0439448_0004818 Ga0439448_0004818_2272_2691 139
434 3300042012 Ga0439455_0007660 Ga0439455_0007660_173_592 139
435 3300042157 Ga0439458_0000010 Ga0439458_0000010_484_903 139
436 3300044658 Ga0466972_0146692 Ga0466972_0146692_207_626 139
437 3300044684 Ga0466966_0365931 Ga0466966_0365931_411_830 139
438 3300044693 Ga0466961_0185884 Ga0466961_0185884_41_460 139
439 3300044694 Ga0466963_0136053 Ga0466963_0136053_980_1399 139
440 3300044694 Ga0466963_0196033 Ga0466963_0196033_883_1302 139
441 3300044719 Ga0466971_0042625 Ga0466971_0042625_781_1200 139
442 3300044765 Ga0466970_0215978 Ga0466970_0215978_552_971 139
443 3300044765 Ga0466970_0235528 Ga0466970_0235528_452_871 139
444 3300045049 Ga0466959_0229344 Ga0466959_0229344_97_516 139
445 3300045049 Ga0466959_0513791 Ga0466959_0513791_59_478 139
446 3300045049 Ga0466959_0717173 Ga0466959_0717173_45_464 139
447 3300045836 Ga0466958_0059777 Ga0466958_0059777_149_568 139
448 3300045976 Ga0466967_0228704 Ga0466967_0228704_545_964 139
449 3300045976 Ga0466967_0390542 Ga0466967_0390542_175_594 139
450 3300045976 Ga0466967_1305682 Ga0466967_1305682_199_618 139
451 3300045976 Ga0466967_1521393 Ga0466967_1521393_47_466 139
452 3300046684 Ga0495669_0135872 Ga0495669_0135872_431_850 139
453 3300048904 Ga0496101_0536144 Ga0496101_0536144_162_581 139
454 3300048908 Ga0496105_0164931 Ga0496105_0164931_1162_1581 139
455 3300048910 Ga0496107_0084052 Ga0496107_0084052_635_1054 139
456 3300048911 Ga0496108_0039210 Ga0496108_0039210_1662_2081 139
457 3300048912 Ga0496109_0161187 Ga0496109_0161187_1234_1653 139
458 3300048914 Ga0496111_0048239 Ga0496111_0048239_2347_2766 139
459 3300048915 Ga0496112_0025560 Ga0496112_0025560_4639_5058 139
460 3300048916 Ga0496113_0156252 Ga0496113_0156252_771_1190 139
461 3300061719 Ga0466962_0014948 Ga0466962_0014948_1076_1495 139
462 3300061719 Ga0466962_0073872 Ga0466962_0073872_672_1091 139

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

49

138

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c4w-assembly1.cif.gz_A structure of the yeast pichia membranifaciens cytochrome c 0.8133 97 139
6p41-assembly1.cif.gz_B yeast cytochrome c peroxidase (w191y:l232e) in complex with iso-1 cytochrome c 0.7212 94 134
1crg-assembly1.cif.gz_A the role of a conserved internal water molecule and its associated hydrogen bond network in cytochrome c 0.7132 94 134
4ye1-assembly2.cif.gz_B a cytochrome c plus calixarene structure - alternative ligand binding mode 0.7101 94 138
6p42-assembly1.cif.gz_B yeast cytochrome c peroxidase (w191y:l232h) in complex with iso-1 cytochrome c 0.7094 94 138
ID Description Score Start End Superfamily
5cieD00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7216 99 139 1.10.760.10
2yevE02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.67 50 136 2.60.40.420
5cibD00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6549 94 134 1.10.760.10
2giwA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6188 47 134 1.10.760.10
2jtiB00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6024 47 138 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A660VMD9-F1-model_v4 Cytochrome c domain-containing protein 0.9168 101 135 GO:0009055
GO:0020037
GO:0046872
AF-A0A316TTN0-F1-model_v4 Cytochrome c domain-containing protein 0.8986 97 134 GO:0009055
GO:0020037
GO:0046872
AF-A0A1J0V6U5-F1-model_v4 deleted 0.8905 99 136
AF-A0A7W1HUZ2-F1-model_v4 C-type cytochrome 0.8705 7 136 GO:0009055
GO:0020037
GO:0046872
AF-A0A2G5QPT1-F1-model_v4 Cytochrome C 0.8426 14 136 GO:0009055
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
74.77 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map