F448915

General Info

Members Datasets Scaffolds Average Seq Length
462 271 454 226

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10499077|Ga0157370_104990771
Length 253
Sequence MNGAPTAVLFDVDGTLVDSNYLHAVCWWDALIQAGHDVPMARIHRAIGMGSDQLLDALLPPDRDRDADDGIRAAHGALYATYWSRQRPLAGAPELLRACKDQGLRVVLASSADSREFAALRAALNADDAVDDVTSSGDVDRSKPAPDLVQVALEKARVRPEEAVFVGDTVWDVQACNEVGVPCIGLLSGGISREELRDAGAAEVYLGPGDLLETLADSILGTGRLLSARTAGAHVQRAARAQGDPGRDRGVPA

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
3 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
4 2855683550 Micromonospora sp. RP3T Isolate Unclassified
5 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
6 2902582711 Micromonospora sp. AP08 Isolate Unclassified
7 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
8 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
150 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
151 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
154 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
155 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
171 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
172 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
173 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
174 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
175 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
204 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
205 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
214 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
215 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
231 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
232 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
233 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
236 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
237 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
238 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
239 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
240 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
245 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
246 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
251 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
252 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
253 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
254 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
255 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
261 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
262 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
263 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
264 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
265 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
266 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
267 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
268 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
269 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
270 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
271 649633069 Micromonospora sp. L5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.32
Metatranscriptomes 1.95
Isolates 1.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.49
Nodule 0.22
Rhizoplane 8.44
Rhizosphere 78.14
Stem 0
Stem Tuber 0
Unclassified 6.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000242 3300000549 Bacteria 10018
2 JGI24743J22301_10005285 3300001991 Bacteria 2147
3 JGI24744J21845_10004647 3300002077 Bacteria 2840
4 Ga0070676_10067461 3300005328 Bacteria 2139
5 Ga0070683_100004610 3300005329 Bacteria 11384
6 Ga0070683_100028260 3300005329 Bacteria 5067
7 Ga0070683_100067977 3300005329 Bacteria 3319
8 Ga0070670_100059229 3300005331 Bacteria 3287
9 Ga0068869_100011285 3300005334 Bacteria 5853
10 Ga0068869_100076006 3300005334 Bacteria 2496
11 Ga0068869_100162899 3300005334 Bacteria 1737
12 Ga0070680_100106053 3300005336 Bacteria 2336
13 Ga0070682_100038305 3300005337 Bacteria 2941
14 Ga0068868_100026352 3300005338 Bacteria 4430
15 Ga0068868_100094095 3300005338 Bacteria 2417
16 Ga0070660_100132048 3300005339 Bacteria 1999
17 Ga0070691_10033728 3300005341 Bacteria 2409
18 Ga0070687_100122298 3300005343 Bacteria 1490
19 Ga0070661_100176892 3300005344 Bacteria 1622
20 Ga0070692_10175370 3300005345 Bacteria 1239
21 Ga0070692_10294196 3300005345 Bacteria 989
22 Ga0070668_100097208 3300005347 Bacteria 2328
23 Ga0070668_100101280 3300005347 Bacteria 2283
24 Ga0070675_100001139 3300005354 Bacteria 19182
25 Ga0070675_100042619 3300005354 Bacteria 3709
26 Ga0070674_100309285 3300005356 Bacteria 1263
27 Ga0070688_100009269 3300005365 Bacteria 5374
28 Ga0070659_100030685 3300005366 Bacteria 4160
29 Ga0070667_100001249 3300005367 Bacteria 23096
30 Ga0070667_100103663 3300005367 Bacteria 2459
31 Ga0070709_10006672 3300005434 Bacteria 6302
32 Ga0070709_10067613 3300005434 Bacteria 2295
33 Ga0070714_100002351 3300005435 Bacteria 13913
34 Ga0070714_100016845 3300005435 Bacteria 5911
35 Ga0070714_100033298 3300005435 Bacteria 4307
36 Ga0070714_100090818 3300005435 Bacteria 2675
37 Ga0070713_100012915 3300005436 Bacteria 6147
38 Ga0070713_100021690 3300005436 Bacteria 4947
39 Ga0070713_100108928 3300005436 Bacteria 2412
40 Ga0070710_10004201 3300005437 Bacteria 6828
41 Ga0070710_10043945 3300005437 Bacteria 2477
42 Ga0070701_10324140 3300005438 Bacteria 954
43 Ga0070711_100104882 3300005439 Bacteria 2063
44 Ga0070705_100136890 3300005440 Bacteria 1606
45 Ga0070700_100000003 3300005441 Bacteria 261247
46 Ga0070663_100003680 3300005455 Bacteria 8889
47 Ga0070662_100002640 3300005457 Bacteria 11052
48 Ga0070681_10053901 3300005458 Bacteria 4007
49 Ga0070679_100086985 3300005530 Bacteria 3112
50 Ga0070679_100199730 3300005530 Bacteria 1966
51 Ga0070684_100001585 3300005535 Bacteria 16418
52 Ga0070684_100038396 3300005535 Bacteria 4113
53 Ga0070684_100095350 3300005535 Bacteria 2651
54 Ga0070684_100140119 3300005535 Bacteria 2186
55 Ga0068853_100141655 3300005539 Bacteria 2159
56 Ga0070696_100107781 3300005546 Bacteria 2004
57 Ga0070693_100076302 3300005547 Bacteria 1986
58 Ga0070665_100030201 3300005548 Bacteria 5454
59 Ga0070665_100539071 3300005548 Bacteria 1179
60 Ga0068855_100025055 3300005563 Bacteria 7140
61 Ga0070664_100009119 3300005564 Bacteria 8053
62 Ga0070664_100082546 3300005564 Bacteria 2772
63 Ga0068857_100191217 3300005577 Bacteria 1864
64 Ga0068856_100125412 3300005614 Bacteria 2571
65 Ga0068856_100292399 3300005614 Bacteria 1646
66 Ga0068852_100023315 3300005616 Bacteria 4981
67 Ga0068852_100660153 3300005616 Bacteria 1054
68 Ga0068852_100915941 3300005616 Bacteria 894
69 Ga0068864_100021527 3300005618 Bacteria 5401
70 Ga0068866_10019625 3300005718 Bacteria 3082
71 Ga0068861_100397383 3300005719 Bacteria 1222
72 Ga0068863_100035135 3300005841 Bacteria 4775
73 Ga0068858_100143690 3300005842 Bacteria 2240
74 Ga0068862_100113817 3300005844 Bacteria 2377
75 Ga0068862_100215651 3300005844 Bacteria 1736
76 Ga0070717_10057827 3300006028 Bacteria 3205
77 Ga0070717_10080322 3300006028 Bacteria 2736
78 Ga0075363_100016211 3300006048 Bacteria 3677
79 Ga0075364_10010011 3300006051 Bacteria 5710
80 Ga0075364_10015126 3300006051 Bacteria 4779
81 Ga0070715_10009292 3300006163 Bacteria 3461
82 Ga0070716_100013711 3300006173 Bacteria 4136
83 Ga0070716_100576091 3300006173 Bacteria 843
84 Ga0070712_100038076 3300006175 Bacteria 3283
85 Ga0070712_100068385 3300006175 Bacteria 2531
86 Ga0070712_100214646 3300006175 Bacteria 1519
87 Ga0070712_100365386 3300006175 Bacteria 1184
88 Ga0075362_10092559 3300006177 Bacteria 1405
89 Ga0075367_10039413 3300006178 Bacteria 2755
90 Ga0075369_10000995 3300006186 Bacteria 9450
91 Ga0075369_10233753 3300006186 Bacteria 852
92 Ga0075370_10001825 3300006353 Bacteria 9524
93 Ga0075370_10035229 3300006353 Bacteria 2809
94 Ga0075370_10049200 3300006353 Bacteria 2389
95 Ga0075370_10081187 3300006353 Bacteria 1864
96 Ga0068871_100255678 3300006358 Bacteria 1527
97 Ga0075428_100001450 3300006844 Bacteria 25357
98 Ga0075428_100220897 3300006844 Bacteria 2046
99 Ga0075430_100001524 3300006846 Bacteria 18905
100 Ga0075430_100001791 3300006846 Bacteria 17572
101 Ga0075434_100448258 3300006871 Bacteria 1312
102 Ga0075434_100479962 3300006871 Archaea 1264
103 Ga0075435_100423559 3300007076 Bacteria 1147
104 Ga0099795_10014171 3300007788 Bacteria 2465
105 Ga0105250_10006078 3300009092 Bacteria 5315
106 Ga0105240_10038250 3300009093 Bacteria 6156
107 Ga0111539_10000821 3300009094 Bacteria 40288
108 Ga0105245_10128307 3300009098 Bacteria 2376
109 Ga0114129_10152338 3300009147 Bacteria 3164
110 Ga0105243_10247610 3300009148 Bacteria 1589
111 Ga0105237_10005369 3300009545 Bacteria 14494
112 Ga0105249_10027309 3300009553 Bacteria 5150
113 Ga0105239_10031939 3300010375 Bacteria 5785
114 Ga0105239_10724469 3300010375 Bacteria 1138
115 Ga0105246_10008982 3300011119 Bacteria 6154
116 Ga0105246_10177317 3300011119 Bacteria 1638
117 Ga0157370_10009445 3300013104 Bacteria 10417
118 Ga0157370_10032879 3300013104 Bacteria 5061
119 Ga0157370_10499077 3300013104 Bacteria 1118
120 Ga0157369_10007442 3300013105 Bacteria 12610
121 Ga0157369_10090958 3300013105 Bacteria 3258
122 Ga0157369_10264884 3300013105 Bacteria 1792
123 Ga0157369_10401183 3300013105 Bacteria 1422
124 Ga0157374_10097643 3300013296 Bacteria 2811
125 Ga0163162_10206633 3300013306 Bacteria 2093
126 Ga0163162_10259457 3300013306 Bacteria 1870
127 Ga0157372_10391516 3300013307 Archaea 1619
128 Ga0157375_10064693 3300013308 Bacteria 3642
129 Ga0163163_10475959 3300014325 Bacteria 1310
130 Ga0157380_10192342 3300014326 Bacteria 1803
131 Ga0157377_10025532 3300014745 Bacteria 3152
132 Ga0157379_10168977 3300014968 Bacteria 1974
133 Ga0157376_10258489 3300014969 Bacteria 1630
134 Ga0163161_10280173 3300017792 Bacteria 1307
135 Ga0197907_11334825 3300020069 Bacteria 910
136 Ga0206356_10200614 3300020070 Bacteria 928
137 Ga0206350_11346535 3300020080 Bacteria 1487
138 Ga0206354_11094981 3300020081 Bacteria 2915
139 Ga0206353_10656241 3300020082 Bacteria 3469
140 Ga0206353_11386555 3300020082 Bacteria 1056
141 Ga0213875_10000452 3300021388 Bacteria 35594
142 Ga0213875_10184343 3300021388 Bacteria 981
143 Ga0224712_10024520 3300022467 Bacteria 2108
144 Ga0224712_10190346 3300022467 Bacteria 928
145 Ga0224712_10207589 3300022467 Bacteria 892
146 Ga0207692_10020886 3300025898 Bacteria 2987
147 Ga0207692_10058842 3300025898 Bacteria 1981
148 Ga0207642_10038328 3300025899 Bacteria 2073
149 Ga0207688_10007024 3300025901 Bacteria 6122
150 Ga0207688_10138444 3300025901 Bacteria 1431
151 Ga0207699_10120563 3300025906 Bacteria 1695
152 Ga0207699_10171804 3300025906 Bacteria 1451
153 Ga0207645_10123994 3300025907 Bacteria 1679
154 Ga0207645_10134530 3300025907 Bacteria 1610
155 Ga0207707_10028063 3300025912 Bacteria 4920
156 Ga0207671_10021428 3300025914 Bacteria 4904
157 Ga0207671_10167660 3300025914 Bacteria 1703
158 Ga0207693_10002211 3300025915 Bacteria 16958
159 Ga0207693_10102049 3300025915 Bacteria 2250
160 Ga0207693_10136616 3300025915 Bacteria 1928
161 Ga0207663_10037122 3300025916 Bacteria 2935
162 Ga0207660_10387252 3300025917 Bacteria 1124
163 Ga0207662_10148418 3300025918 Bacteria 1490
164 Ga0207657_10546239 3300025919 Bacteria 906
165 Ga0207652_10045481 3300025921 Bacteria 3743
166 Ga0207652_10159151 3300025921 Bacteria 2024
167 Ga0207659_10040719 3300025926 Bacteria 3251
168 Ga0207687_10039911 3300025927 Bacteria 3216
169 Ga0207687_10168984 3300025927 Bacteria 1685
170 Ga0207700_10013005 3300025928 Bacteria 5394
171 Ga0207700_10022733 3300025928 Bacteria 4307
172 Ga0207700_10145772 3300025928 Bacteria 1951
173 Ga0207700_10463383 3300025928 Bacteria 1118
174 Ga0207664_10003636 3300025929 Bacteria 10324
175 Ga0207664_10054008 3300025929 Bacteria 3182
176 Ga0207664_10059724 3300025929 Bacteria 3038
177 Ga0207664_10095846 3300025929 Bacteria 2441
178 Ga0207664_10215448 3300025929 Bacteria 1663
179 Ga0207664_10362937 3300025929 Bacteria 1283
180 Ga0207664_10580407 3300025929 Bacteria 1007
181 Ga0207690_10049749 3300025932 Bacteria 2795
182 Ga0207706_10011306 3300025933 Bacteria 8133
183 Ga0207706_10040413 3300025933 Bacteria 4134
184 Ga0207686_10036330 3300025934 Bacteria 2965
185 Ga0207709_10096721 3300025935 Bacteria 1943
186 Ga0207665_10003320 3300025939 Bacteria 10773
187 Ga0207689_10009427 3300025942 Bacteria 8430
188 Ga0207689_10692850 3300025942 Bacteria 859
189 Ga0207661_10008979 3300025944 Bacteria 7161
190 Ga0207661_10036912 3300025944 Bacteria 3818
191 Ga0207661_10056880 3300025944 Bacteria 3142
192 Ga0207661_10138431 3300025944 Bacteria 2093
193 Ga0207679_10003060 3300025945 Bacteria 10356
194 Ga0207679_10161676 3300025945 Bacteria 1834
195 Ga0207667_10024287 3300025949 Bacteria 6657
196 Ga0207712_10028478 3300025961 Bacteria 3737
197 Ga0207712_10101823 3300025961 Bacteria 2137
198 Ga0207668_10113876 3300025972 Bacteria 2035
199 Ga0207640_10555387 3300025981 Bacteria 965
200 Ga0207658_10061653 3300025986 Bacteria 2803
201 Ga0207658_10101871 3300025986 Bacteria 2251
202 Ga0207658_10364224 3300025986 Bacteria 1262
203 Ga0207677_10069703 3300026023 Bacteria 2474
204 Ga0207703_10155768 3300026035 Bacteria 1996
205 Ga0207678_10011208 3300026067 Bacteria 7875
206 Ga0207678_10092261 3300026067 Bacteria 2589
207 Ga0207678_10415516 3300026067 Archaea 1166
208 Ga0207708_10000002 3300026075 Bacteria 411071
209 Ga0207708_10010483 3300026075 Bacteria 6881
210 Ga0207702_10211965 3300026078 Bacteria 1801
211 Ga0207702_10875503 3300026078 Bacteria 890
212 Ga0207641_10026300 3300026088 Bacteria 4802
213 Ga0207648_10151875 3300026089 Bacteria 2043
214 Ga0207676_10041465 3300026095 Bacteria 3534
215 Ga0207674_10027445 3300026116 Bacteria 6021
216 Ga0207674_10231751 3300026116 Bacteria 1794
217 Ga0207675_100014450 3300026118 Bacteria 7361
218 Ga0207675_100048794 3300026118 Bacteria 3951
219 Ga0207675_100484048 3300026118 Bacteria 1230
220 Ga0207683_10084528 3300026121 Bacteria 2821
221 Ga0207698_10528681 3300026142 Bacteria 1152
222 Ga0207698_10702661 3300026142 Bacteria 1006
223 Ga0207698_10799003 3300026142 Bacteria 945
224 Ga0209813_10039725 3300027866 Bacteria 1427
225 Ga0207428_10265629 3300027907 Bacteria 1277
226 Ga0268266_10017872 3300028379 Bacteria 6042
227 Ga0268266_10521888 3300028379 Bacteria 1136
228 Ga0268265_10196252 3300028380 Bacteria 1747
229 Ga0268265_10206160 3300028380 Bacteria 1709
230 Ga0268264_10225484 3300028381 Bacteria 1727
231 Ga0268264_10546519 3300028381 Bacteria 1135
232 Ga0268264_10981651 3300028381 Bacteria 851
233 Ga0307517_10005122 3300028786 Bacteria 19915
234 Ga0265327_10000604 3300031251 Bacteria 59613
235 Ga0307508_10034686 3300031616 Bacteria 4548
236 Ga0307416_100074387 3300032002 Bacteria 2838
237 Ga0307416_100417903 3300032002 Bacteria 1384
238 Ga0373926_0008257 3300035083 Bacteria 3466
239 Ga0373934_0049339 3300035086 Bacteria 1667
240 Ga0373944_0001639 3300035089 Bacteria 5662
241 Ga0373923_0004964 3300035111 Bacteria 4472
242 Ga0373936_0012273 3300035113 Bacteria 3256
243 Ga0373945_0000022 3300035116 Bacteria 31935
244 Ga0373946_0000356 3300035171 Bacteria 14838
245 Ga0373955_0103712 3300035172 Bacteria 1636
246 Ga0373931_0175285 3300035691 Bacteria 1266
247 Ga0373935_0010476 3300035692 Bacteria 5562
248 Ga0373935_0230573 3300035692 Bacteria 1289
249 Ga0373927_0026616 3300035695 Bacteria 3780
250 Ga0373933_0010045 3300035724 Bacteria 5182
251 Ga0373937_0027835 3300036401 Bacteria 5113
252 Ga0373937_0046502 3300036401 Bacteria 3969
253 Ga0373937_0162278 3300036401 Bacteria 2095
254 Ga0373925_0014916 3300037068 Bacteria 5615
255 Ga0395898_0318572 3300037466 Bacteria 1483
256 Ga0436364_0045299 3300037853 Bacteria 62726
257 Ga0436364_0536219 3300037853 Bacteria 799
258 Ga0436364_1226794 3300037853 Bacteria 1371
259 Ga0395901_0082439 3300038443 Bacteria 3360
260 Ga0242420_005055 3300038996 Archaea 2025
261 Ga0436363_1070021 3300039450 Bacteria 1498
262 Ga0439466_0006873 3300041411 Bacteria 4312
263 Ga0439465_0005629 3300041413 Bacteria 3990
264 Ga0439431_0024114 3300041997 Bacteria 1478
265 Ga0466972_0026319 3300044658 Bacteria 2883
266 Ga0466972_0047241 3300044658 Bacteria 2082
267 Ga0466972_0057566 3300044658 Bacteria 1867
268 Ga0466972_0221282 3300044658 Bacteria 886
269 Ga0466966_0002534 3300044684 Bacteria 11962
270 Ga0466961_0184782 3300044693 Bacteria 1293
271 Ga0466961_0262271 3300044693 Bacteria 1059
272 Ga0466963_0282615 3300044694 Bacteria 1166
273 Ga0466971_0040031 3300044719 Bacteria 2105
274 Ga0466957_0159339 3300044842 Bacteria 1465
275 Ga0466957_0564285 3300044842 Bacteria 794
276 Ga0466960_0029807 3300044901 Bacteria 2507
277 Ga0466959_0008960 3300045049 Bacteria 7100
278 Ga0466959_0026760 3300045049 Bacteria 4277
279 Ga0466959_0048369 3300045049 Bacteria 3125
280 Ga0466959_0107205 3300045049 Bacteria 1997
281 Ga0466958_0078573 3300045836 Bacteria 2028
282 Ga0466958_0089217 3300045836 Bacteria 1906
283 Ga0466958_0354486 3300045836 Bacteria 945
284 Ga0466958_0401614 3300045836 Bacteria 885
285 Ga0466967_0062610 3300045976 Bacteria 3303
286 Ga0495592_0095934 3300046454 Bacteria 2120
287 Ga0495641_0027889 3300046461 Bacteria 2738
288 Ga0495651_0013786 3300046462 Bacteria 6251
289 Ga0495651_0015357 3300046462 Bacteria 5921
290 Ga0495651_0053162 3300046462 Bacteria 3119
291 Ga0495653_0015865 3300046463 Bacteria 6139
292 Ga0495653_0037801 3300046463 Bacteria 3790
293 Ga0495653_0117376 3300046463 Bacteria 1901
294 Ga0495582_0097771 3300046473 Bacteria 1642
295 Ga0495664_0001507 3300046477 Bacteria 12335
296 Ga0495664_0004566 3300046477 Bacteria 7574
297 Ga0495664_0025444 3300046477 Bacteria 3446
298 Ga0495608_0024746 3300046511 Bacteria 4102
299 Ga0495608_0051607 3300046511 Bacteria 2725
300 Ga0495608_0075279 3300046511 Bacteria 2200
301 Ga0495608_0456004 3300046511 Bacteria 777
302 Ga0495618_0006962 3300046514 Bacteria 6850
303 Ga0495618_0021020 3300046514 Bacteria 4021
304 Ga0495618_0077703 3300046514 Bacteria 2115
305 Ga0495618_0103644 3300046514 Bacteria 1821
306 Ga0495628_0031077 3300046516 Bacteria 4320
307 Ga0495628_0273340 3300046516 Bacteria 1256
308 Ga0495630_0045234 3300046517 Bacteria 3289
309 Ga0495630_0246731 3300046517 Bacteria 1364
310 Ga0495652_0007955 3300046529 Bacteria 9733
311 Ga0495652_0024865 3300046529 Bacteria 5299
312 Ga0495652_0049011 3300046529 Bacteria 3617
313 Ga0495665_0006115 3300046531 Bacteria 6498
314 Ga0495640_0158045 3300046533 Bacteria 1454
315 Ga0495640_0233776 3300046533 Bacteria 1155
316 Ga0495587_0028244 3300046536 Bacteria 3412
317 Ga0495667_0001024 3300046559 Bacteria 18088
318 Ga0495667_0038440 3300046559 Bacteria 3186
319 Ga0495667_0058386 3300046559 Bacteria 2535
320 Ga0495667_0112022 3300046559 Bacteria 1763
321 Ga0495634_0005893 3300046642 Bacteria 9360
322 Ga0495634_0148292 3300046642 Bacteria 1485
323 Ga0495634_0191779 3300046642 Bacteria 1274
324 Ga0495635_0000199 3300046663 Bacteria 37937
325 Ga0495635_0149655 3300046663 Bacteria 1589
326 Ga0495657_0039921 3300046675 Bacteria 3223
327 Ga0495657_0044132 3300046675 Bacteria 3035
328 Ga0495599_0009374 3300046678 Bacteria 5981
329 Ga0495599_0263259 3300046678 Bacteria 1047
330 Ga0495646_0079175 3300046680 Bacteria 1919
331 Ga0495624_0001602 3300046690 Bacteria 17361
332 Ga0495600_0032400 3300046809 Bacteria 3391
333 Ga0495600_0137619 3300046809 Bacteria 1585
334 Ga0495600_0170930 3300046809 Bacteria 1403
335 Ga0495600_0189927 3300046809 Bacteria 1321
336 Ga0495604_0229447 3300047317 Bacteria 1274
337 Ga0495674_0000328 3300047319 Bacteria 41808
338 Ga0495674_0162146 3300047319 Bacteria 1870
339 Ga0495674_0174676 3300047319 Bacteria 1791
340 Ga0495676_0009612 3300047321 Bacteria 8802
341 Ga0495680_0006297 3300047322 Bacteria 11052
342 Ga0495680_0013475 3300047322 Bacteria 7132
343 Ga0495680_0018780 3300047322 Bacteria 5859
344 Ga0495680_0047252 3300047322 Bacteria 3387
345 Ga0495675_0402293 3300047444 Bacteria 798
346 Ga0495684_0001085 3300047471 Bacteria 21968
347 Ga0495684_0028401 3300047471 Bacteria 4295
348 Ga0495684_0052564 3300047471 Bacteria 3109
349 Ga0495684_0164238 3300047471 Bacteria 1655
350 Ga0495686_0001464 3300047472 Bacteria 25716
351 Ga0495593_0022505 3300047673 Bacteria 3511
352 Ga0495602_0032442 3300048088 Bacteria 4917
353 Ga0495602_0201632 3300048088 Bacteria 1517
354 Ga0495602_0365232 3300048088 Bacteria 1038
355 Ga0496100_0000145 3300048903 Bacteria 39148
356 Ga0496101_0000118 3300048904 Bacteria 77684
357 Ga0496102_0011754 3300048905 Bacteria 7555
358 Ga0496102_0019653 3300048905 Bacteria 5952
359 Ga0496102_0072905 3300048905 Bacteria 3156
360 Ga0496102_0088023 3300048905 Bacteria 2870
361 Ga0496102_0378859 3300048905 Bacteria 1331
362 Ga0496102_0397227 3300048905 Bacteria 1296
363 Ga0496103_0001331 3300048906 Bacteria 16740
364 Ga0496103_0018162 3300048906 Bacteria 4217
365 Ga0496103_0062062 3300048906 Bacteria 2326
366 Ga0496103_0269663 3300048906 Bacteria 1095
367 Ga0496106_0003374 3300048909 Bacteria 11909
368 Ga0496106_0003401 3300048909 Bacteria 11852
369 Ga0496106_0022110 3300048909 Bacteria 4724
370 Ga0496107_0004035 3300048910 Bacteria 9887
371 Ga0496107_0040257 3300048910 Bacteria 3354
372 Ga0496107_0221536 3300048910 Bacteria 1407
373 Ga0496108_0000628 3300048911 Bacteria 27558
374 Ga0496108_0001232 3300048911 Bacteria 20073
375 Ga0496109_0000401 3300048912 Bacteria 39175
376 Ga0496109_0007586 3300048912 Bacteria 9198
377 Ga0496109_0055532 3300048912 Bacteria 3613
378 Ga0496109_0094217 3300048912 Bacteria 2771
379 Ga0496110_0020280 3300048913 Bacteria 5612
380 Ga0496110_0135117 3300048913 Bacteria 2228
381 Ga0496110_0164847 3300048913 Bacteria 2009
382 Ga0496110_0554573 3300048913 Bacteria 1044
383 Ga0496111_0008965 3300048914 Bacteria 6654
384 Ga0496111_0149798 3300048914 Archaea 1730
385 Ga0496111_0406441 3300048914 Bacteria 1006
386 Ga0496112_0079919 3300048915 Bacteria 3234
387 Ga0496112_0320946 3300048915 Bacteria 1493
388 Ga0496113_0063626 3300048916 Bacteria 2788
389 Ga0496113_0075969 3300048916 Bacteria 2565
390 Ga0496113_0127350 3300048916 Archaea 1995
391 Ga0496113_0188305 3300048916 Bacteria 1638
392 Ga0496114_0007889 3300048917 Bacteria 8423
393 Ga0496115_0022280 3300048918 Bacteria 4906
394 Ga0496116_0022778 3300048919 Bacteria 4683
395 Ga0496117_0016614 3300048920 Bacteria 6198
396 Ga0496117_0033007 3300048920 Bacteria 3920
397 Ga0496118_0000295 3300048921 Bacteria 86668
398 Ga0496118_0039607 3300048921 Bacteria 3757
399 Ga0496119_0010262 3300048922 Bacteria 7894
400 Ga0496121_0000002 3300048924 Bacteria 1494588
401 Ga0496121_0010290 3300048924 Bacteria 10583
402 Ga0496122_0000141 3300048925 Bacteria 168707
403 Ga0496123_0052293 3300048926 Bacteria 2712
404 Ga0496124_0000002 3300048927 Bacteria 1494588
405 Ga0496125_0000002 3300048928 Bacteria 1480920
406 Ga0496126_0000011 3300048929 Bacteria 744275
407 Ga0496126_0000235 3300048929 Bacteria 119657
408 Ga0496126_0000586 3300048929 Bacteria 68837
409 Ga0496126_0001416 3300048929 Bacteria 37926
410 Ga0496126_0078077 3300048929 Bacteria 2934
411 Ga0501033_0119504 3300049570 Bacteria 1913
412 Ga0501034_0061558 3300049571 Bacteria 3769
413 Ga0501043_0560883 3300049579 Bacteria 847
414 Ga0501047_0005341 3300049581 Bacteria 12076
415 Ga0501067_0009612 3300049583 Bacteria 5355
416 Ga0501067_0110744 3300049583 Bacteria 1526
417 Ga0501067_0325282 3300049583 Bacteria 856
418 Ga0501068_0005947 3300049584 Bacteria 6696
419 Ga0501069_0020897 3300049585 Bacteria 3550
420 Ga0501069_0135500 3300049585 Bacteria 1411
421 Ga0501072_0119038 3300049588 Bacteria 2104
422 Ga0501035_0000729 3300049822 Bacteria 35689
423 Ga0501035_0684962 3300049822 Bacteria 828
424 Ga0501044_0000150 3300049823 Bacteria 85886
425 nmdc:mga03n38_35048_c1 3300050490 Bacteria 2147
426 nmdc:mga03n38_50155_c1 3300050490 Bacteria 1859
427 nmdc:mga00v17_19011_c1 3300050491 Bacteria 3914
428 nmdc:mga00v17_308703_c1 3300050491 Bacteria 1028
429 nmdc:mga00v17_575462_c1 3300050491 Bacteria 727
430 nmdc:mga0yw44_127519_c1 3300050492 Bacteria 1644
431 nmdc:mga0yw44_259779_c1 3300050492 Bacteria 1157
432 nmdc:mga06z11_35081_c1 3300050494 Bacteria 2466
433 nmdc:mga04h51_21358_c1 3300050495 Bacteria 1946
434 nmdc:mga07m45_11706_c1 3300050496 Bacteria 2263
435 nmdc:mga07m45_14582_c1 3300050496 Bacteria 4190
436 nmdc:mga07m45_5496_c1 3300050496 Bacteria 6312
437 nmdc:mga05p37_30180_c1 3300050507 Bacteria 6614
438 nmdc:mga0qj67_223_c1 3300050509 Bacteria 38690
439 nmdc:mga0qj67_4017_c1 3300050509 Bacteria 10653
440 nmdc:mga06r32_187041_c1 3300050510 Bacteria 2058
441 nmdc:mga0n895_417287_c1 3300050512 Bacteria 1357
442 nmdc:mga0a205_762465_c1 3300050515 Bacteria 816
443 nmdc:mga0sz30_23211_c2 3300050516 Bacteria 2082
444 Ga0495601_0087171 3300053077 Bacteria 2007
445 Ga0495601_0432384 3300053077 Bacteria 852
446 Ga0495655_0005344 3300053083 Bacteria 2265
447 Ga0495595_0150699 3300053084 Bacteria 1144
448 Ga0495595_0310983 3300053084 Bacteria 793
449 Ga0500578_0139059 3300053086 Bacteria 1519
450 Ga0500560_063255 3300053107 Bacteria 1210
451 Ga0500614_022260 3300053123 Bacteria 1478
452 Ga0500600_0040487 3300053149 Bacteria 2691
453 Ga0500616_0150536 3300053153 Bacteria 1077
454 Ga0466962_0023973 3300061719 Bacteria 2933

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044842 Ga0466957_0564285 Ga0466957_0564285_47_757 189
2 3300046511 Ga0495608_0456004 Ga0495608_0456004_31_753 189
3 3300049822 Ga0501035_0684962 Ga0501035_0684962_29_718 200
4 3300045836 Ga0466958_0401614 Ga0466958_0401614_17_622 201
5 3300005329 Ga0070683_100004610 Ga0070683_1000046108 205
6 3300005535 Ga0070684_100001585 Ga0070684_10000158518 205
7 3300005564 Ga0070664_100082546 Ga0070664_1000825462 205
8 3300021388 Ga0213875_10000452 Ga0213875_1000045211 205
9 3300025944 Ga0207661_10008979 Ga0207661_100089792 205
10 3300025945 Ga0207679_10161676 Ga0207679_101616761 205
11 3300026142 Ga0207698_10799003 Ga0207698_107990031 205
12 3300031616 Ga0307508_10034686 Ga0307508_100346866 205
13 3300037853 Ga0436364_0045299 Ga0436364_0045299_27276_27941 205
14 3300053083 Ga0495655_0005344 Ga0495655_0005344_1454_2116 205
15 3300053086 Ga0500578_0139059 Ga0500578_0139059_31_693 205
16 3300053149 Ga0500600_0040487 Ga0500600_0040487_1595_2257 205
17 3300053153 Ga0500616_0150536 Ga0500616_0150536_385_1047 205
18 3300038996 Ga0242420_005055 Ga0242420_005055_1242_1874 208
19 3300032002 Ga0307416_100417903 Ga0307416_1004179032 210
20 3300007788 Ga0099795_10014171 Ga0099795_100141712 213
21 3300035086 Ga0373934_0049339 Ga0373934_0049339_585_1265 213
22 3300036401 Ga0373937_0046502 Ga0373937_0046502_831_1511 213
23 3300046462 Ga0495651_0013786 Ga0495651_0013786_4668_5348 213
24 3300046463 Ga0495653_0117376 Ga0495653_0117376_982_1662 213
25 3300046477 Ga0495664_0025444 Ga0495664_0025444_1539_2219 213
26 3300046511 Ga0495608_0075279 Ga0495608_0075279_1505_2185 213
27 3300046514 Ga0495618_0021020 Ga0495618_0021020_1865_2545 213
28 3300046516 Ga0495628_0031077 Ga0495628_0031077_1917_2597 213
29 3300046529 Ga0495652_0024865 Ga0495652_0024865_1913_2593 213
30 3300046559 Ga0495667_0112022 Ga0495667_0112022_663_1343 213
31 3300046675 Ga0495657_0039921 Ga0495657_0039921_1291_1971 213
32 3300046809 Ga0495600_0189927 Ga0495600_0189927_141_821 213
33 3300047322 Ga0495680_0013475 Ga0495680_0013475_1365_2045 213
34 3300047444 Ga0495675_0402293 Ga0495675_0402293_49_729 213
35 3300047471 Ga0495684_0164238 Ga0495684_0164238_453_1133 213
36 3300048088 Ga0495602_0032442 Ga0495602_0032442_3193_3873 213
37 3300048913 Ga0496110_0554573 Ga0496110_0554573_157_801 213
38 3300046678 Ga0495599_0263259 Ga0495599_0263259_45_746 214
39 3300048924 Ga0496121_0010290 Ga0496121_0010290_991_1638 215
40 iso_pu_bacteria 3002998708 3003008304 215
41 3300035691 Ga0373931_0175285 Ga0373931_0175285_318_983 216
42 3300005347 Ga0070668_100101280 Ga0070668_1001012803 217
43 3300005367 Ga0070667_100103663 Ga0070667_1001036633 217
44 3300005844 Ga0068862_100215651 Ga0068862_1002156513 217
45 3300006048 Ga0075363_100016211 Ga0075363_1000162111 217
46 3300006051 Ga0075364_10015126 Ga0075364_100151262 217
47 3300006177 Ga0075362_10092559 Ga0075362_100925592 217
48 3300006178 Ga0075367_10039413 Ga0075367_100394132 217
49 3300006186 Ga0075369_10000995 Ga0075369_1000099511 217
50 3300006353 Ga0075370_10035229 Ga0075370_100352292 217
51 3300009092 Ga0105250_10006078 Ga0105250_100060786 217
52 3300009553 Ga0105249_10027309 Ga0105249_100273095 217
53 3300025961 Ga0207712_10028478 Ga0207712_100284784 217
54 3300025986 Ga0207658_10061653 Ga0207658_100616533 217
55 3300027866 Ga0209813_10039725 Ga0209813_100397252 217
56 3300028380 Ga0268265_10196252 Ga0268265_101962523 217
57 3300041411 Ga0439466_0006873 Ga0439466_0006873_2954_3607 217
58 3300041413 Ga0439465_0005629 Ga0439465_0005629_757_1410 217
59 3300041997 Ga0439431_0024114 Ga0439431_0024114_53_706 217
60 3300044658 Ga0466972_0057566 Ga0466972_0057566_234_887 217
61 3300048905 Ga0496102_0088023 Ga0496102_0088023_1723_2376 217
62 3300048906 Ga0496103_0269663 Ga0496103_0269663_400_1053 217
63 3300048912 Ga0496109_0055532 Ga0496109_0055532_824_1477 217
64 3300048913 Ga0496110_0135117 Ga0496110_0135117_592_1245 217
65 3300048916 Ga0496113_0063626 Ga0496113_0063626_1408_2061 217
66 3300050490 nmdc:mga03n38_35048_c1 nmdc:mga03n38_35048_c1_404_1084 217
67 3300050492 nmdc:mga0yw44_127519_c1 nmdc:mga0yw44_127519_c1_128_808 217
68 3300050492 nmdc:mga0yw44_259779_c1 nmdc:mga0yw44_259779_c1_96_749 217
69 3300050494 nmdc:mga06z11_35081_c1 nmdc:mga06z11_35081_c1_460_1113 217
70 3300050495 nmdc:mga04h51_21358_c1 nmdc:mga04h51_21358_c1_1114_1767 217
71 3300050496 nmdc:mga07m45_14582_c1 nmdc:mga07m45_14582_c1_3238_3918 217
72 3300045836 Ga0466958_0354486 Ga0466958_0354486_221_928 219
73 3300005334 Ga0068869_100162899 Ga0068869_1001628992 220
74 3300005441 Ga0070700_100000003 Ga0070700_100000003221 220
75 3300014969 Ga0157376_10258489 Ga0157376_102584893 220
76 3300025942 Ga0207689_10692850 Ga0207689_106928502 220
77 3300026075 Ga0207708_10000002 Ga0207708_10000002362 220
78 3300028786 Ga0307517_10005122 Ga0307517_100051228 220
79 3300035083 Ga0373926_0008257 Ga0373926_0008257_297_1013 220
80 3300035089 Ga0373944_0001639 Ga0373944_0001639_4221_4937 220
81 3300035111 Ga0373923_0004964 Ga0373923_0004964_2285_3001 220
82 3300035113 Ga0373936_0012273 Ga0373936_0012273_2403_3119 220
83 3300035116 Ga0373945_0000022 Ga0373945_0000022_30751_31467 220
84 3300035171 Ga0373946_0000356 Ga0373946_0000356_9324_10040 220
85 3300035172 Ga0373955_0103712 Ga0373955_0103712_489_1205 220
86 3300035692 Ga0373935_0010476 Ga0373935_0010476_2763_3479 220
87 3300035695 Ga0373927_0026616 Ga0373927_0026616_2262_2978 220
88 3300036401 Ga0373937_0162278 Ga0373937_0162278_983_1699 220
89 3300037068 Ga0373925_0014916 Ga0373925_0014916_1232_1948 220
90 3300046461 Ga0495641_0027889 Ga0495641_0027889_1185_1901 220
91 3300046462 Ga0495651_0053162 Ga0495651_0053162_1111_1827 220
92 3300046463 Ga0495653_0015865 Ga0495653_0015865_3722_4438 220
93 3300046473 Ga0495582_0097771 Ga0495582_0097771_806_1522 220
94 3300046477 Ga0495664_0001507 Ga0495664_0001507_3609_4325 220
95 3300046514 Ga0495618_0006962 Ga0495618_0006962_5736_6452 220
96 3300046517 Ga0495630_0045234 Ga0495630_0045234_2084_2800 220
97 3300046529 Ga0495652_0007955 Ga0495652_0007955_8880_9596 220
98 3300046531 Ga0495665_0006115 Ga0495665_0006115_5667_6383 220
99 3300046533 Ga0495640_0158045 Ga0495640_0158045_339_1055 220
100 3300046559 Ga0495667_0001024 Ga0495667_0001024_8170_8886 220
101 3300046642 Ga0495634_0005893 Ga0495634_0005893_4970_5686 220
102 3300046663 Ga0495635_0000199 Ga0495635_0000199_28442_29158 220
103 3300046678 Ga0495599_0009374 Ga0495599_0009374_1527_2243 220
104 3300046690 Ga0495624_0001602 Ga0495624_0001602_15272_15988 220
105 3300046809 Ga0495600_0032400 Ga0495600_0032400_1668_2384 220
106 3300047319 Ga0495674_0000328 Ga0495674_0000328_11947_12663 220
107 3300047321 Ga0495676_0009612 Ga0495676_0009612_1388_2104 220
108 3300047322 Ga0495680_0006297 Ga0495680_0006297_9852_10568 220
109 3300047471 Ga0495684_0001085 Ga0495684_0001085_18605_19321 220
110 3300047673 Ga0495593_0022505 Ga0495593_0022505_1791_2507 220
111 3300049583 Ga0501067_0110744 Ga0501067_0110744_383_1045 220
112 3300049584 Ga0501068_0005947 Ga0501068_0005947_2177_2839 220
113 3300049585 Ga0501069_0135500 Ga0501069_0135500_650_1312 220
114 3300053077 Ga0495601_0432384 Ga0495601_0432384_55_771 220
115 3300053107 Ga0500560_063255 Ga0500560_063255_168_830 220
116 3300053123 Ga0500614_022260 Ga0500614_022260_411_1073 220
117 3300005329 Ga0070683_100067977 Ga0070683_1000679774 221
118 3300005336 Ga0070680_100106053 Ga0070680_1001060531 221
119 3300005345 Ga0070692_10175370 Ga0070692_101753701 221
120 3300005435 Ga0070714_100033298 Ga0070714_1000332981 221
121 3300005436 Ga0070713_100021690 Ga0070713_1000216902 221
122 3300005458 Ga0070681_10053901 Ga0070681_100539015 221
123 3300005530 Ga0070679_100086985 Ga0070679_1000869853 221
124 3300005535 Ga0070684_100140119 Ga0070684_1001401192 221
125 3300005548 Ga0070665_100539071 Ga0070665_1005390712 221
126 3300005614 Ga0068856_100125412 Ga0068856_1001254122 221
127 3300005616 Ga0068852_100915941 Ga0068852_1009159411 221
128 3300013104 Ga0157370_10032879 Ga0157370_100328792 221
129 3300013105 Ga0157369_10090958 Ga0157369_100909583 221
130 3300020070 Ga0206356_10200614 Ga0206356_102006141 221
131 3300020080 Ga0206350_11346535 Ga0206350_113465352 221
132 3300020081 Ga0206354_11094981 Ga0206354_110949812 221
133 3300020082 Ga0206353_10656241 Ga0206353_106562414 221
134 3300022467 Ga0224712_10190346 Ga0224712_101903461 221
135 3300025912 Ga0207707_10028063 Ga0207707_100280632 221
136 3300025917 Ga0207660_10387252 Ga0207660_103872521 221
137 3300025921 Ga0207652_10045481 Ga0207652_100454813 221
138 3300025928 Ga0207700_10013005 Ga0207700_100130052 221
139 3300025929 Ga0207664_10054008 Ga0207664_100540082 221
140 3300025944 Ga0207661_10056880 Ga0207661_100568802 221
141 3300026116 Ga0207674_10027445 Ga0207674_100274453 221
142 3300028379 Ga0268266_10521888 Ga0268266_105218881 221
143 3300037853 Ga0436364_0536219 Ga0436364_0536219_30_713 221
144 3300039450 Ga0436363_1070021 Ga0436363_1070021_467_1141 221
145 3300044694 Ga0466963_0282615 Ga0466963_0282615_127_804 221
146 3300047317 Ga0495604_0229447 Ga0495604_0229447_103_807 221
147 3300048905 Ga0496102_0072905 Ga0496102_0072905_824_1489 221
148 3300048906 Ga0496103_0018162 Ga0496103_0018162_492_1157 221
149 3300048915 Ga0496112_0320946 Ga0496112_0320946_316_993 221
150 3300048929 Ga0496126_0000235 Ga0496126_0000235_4356_5021 221
151 3300048929 Ga0496126_0000586 Ga0496126_0000586_39722_40387 221
152 3300048929 Ga0496126_0078077 Ga0496126_0078077_424_1098 221
153 iso_pu_bacteria 2501939600 2501940975 221
154 iso_pu_bacteria 2622736626 2623587844 221
155 iso_pu_bacteria 2855683550 2855687131 221
156 iso_pu_bacteria 2856858025 2856861876 221
157 iso_pu_bacteria 649633069 649812476 221
158 3300005328 Ga0070676_10067461 Ga0070676_100674612 222
159 3300005329 Ga0070683_100028260 Ga0070683_1000282604 222
160 3300005331 Ga0070670_100059229 Ga0070670_1000592295 222
161 3300005334 Ga0068869_100011285 Ga0068869_1000112856 222
162 3300005338 Ga0068868_100026352 Ga0068868_1000263525 222
163 3300005339 Ga0070660_100132048 Ga0070660_1001320482 222
164 3300005343 Ga0070687_100122298 Ga0070687_1001222982 222
165 3300005354 Ga0070675_100001139 Ga0070675_10000113918 222
166 3300005366 Ga0070659_100030685 Ga0070659_1000306855 222
167 3300005435 Ga0070714_100090818 Ga0070714_1000908182 222
168 3300005455 Ga0070663_100003680 Ga0070663_1000036809 222
169 3300005457 Ga0070662_100002640 Ga0070662_10000264012 222
170 3300005530 Ga0070679_100199730 Ga0070679_1001997302 222
171 3300005535 Ga0070684_100038396 Ga0070684_1000383965 222
172 3300005535 Ga0070684_100095350 Ga0070684_1000953503 222
173 3300005564 Ga0070664_100009119 Ga0070664_10000911910 222
174 3300005577 Ga0068857_100191217 Ga0068857_1001912172 222
175 3300005614 Ga0068856_100292399 Ga0068856_1002923993 222
176 3300005616 Ga0068852_100023315 Ga0068852_1000233155 222
177 3300005719 Ga0068861_100397383 Ga0068861_1003973833 222
178 3300005844 Ga0068862_100113817 Ga0068862_1001138171 222
179 3300009094 Ga0111539_10000821 Ga0111539_1000082112 222
180 3300009148 Ga0105243_10247610 Ga0105243_102476102 222
181 3300011119 Ga0105246_10177317 Ga0105246_101773172 222
182 3300014745 Ga0157377_10025532 Ga0157377_100255325 222
183 3300021388 Ga0213875_10184343 Ga0213875_101843431 222
184 3300025901 Ga0207688_10138444 Ga0207688_101384442 222
185 3300025907 Ga0207645_10134530 Ga0207645_101345302 222
186 3300025918 Ga0207662_10148418 Ga0207662_101484181 222
187 3300025919 Ga0207657_10546239 Ga0207657_105462392 222
188 3300025921 Ga0207652_10159151 Ga0207652_101591512 222
189 3300025926 Ga0207659_10040719 Ga0207659_100407195 222
190 3300025927 Ga0207687_10168984 Ga0207687_101689842 222
191 3300025933 Ga0207706_10011306 Ga0207706_100113064 222
192 3300025942 Ga0207689_10009427 Ga0207689_100094279 222
193 3300025944 Ga0207661_10036912 Ga0207661_100369125 222
194 3300025945 Ga0207679_10003060 Ga0207679_1000306010 222
195 3300025981 Ga0207640_10555387 Ga0207640_105553872 222
196 3300026023 Ga0207677_10069703 Ga0207677_100697032 222
197 3300026067 Ga0207678_10011208 Ga0207678_100112084 222
198 3300026078 Ga0207702_10211965 Ga0207702_102119652 222
199 3300026116 Ga0207674_10231751 Ga0207674_102317512 222
200 3300026118 Ga0207675_100484048 Ga0207675_1004840482 222
201 3300026142 Ga0207698_10528681 Ga0207698_105286813 222
202 3300027907 Ga0207428_10265629 Ga0207428_102656291 222
203 3300028380 Ga0268265_10206160 Ga0268265_102061603 222
204 3300028381 Ga0268264_10546519 Ga0268264_105465192 222
205 3300032002 Ga0307416_100074387 Ga0307416_1000743875 222
206 3300035692 Ga0373935_0230573 Ga0373935_0230573_547_1215 222
207 3300037853 Ga0436364_1226794 Ga0436364_1226794_407_1093 222
208 3300050490 nmdc:mga03n38_50155_c1 nmdc:mga03n38_50155_c1_11_685 222
209 3300005367 Ga0070667_100001249 Ga0070667_10000124918 223
210 3300005435 Ga0070714_100002351 Ga0070714_1000023512 223
211 3300005436 Ga0070713_100012915 Ga0070713_1000129156 223
212 3300005436 Ga0070713_100108928 Ga0070713_1001089282 223
213 3300006051 Ga0075364_10010011 Ga0075364_100100118 223
214 3300006353 Ga0075370_10049200 Ga0075370_100492003 223
215 3300009545 Ga0105237_10005369 Ga0105237_1000536911 223
216 3300010375 Ga0105239_10031939 Ga0105239_100319397 223
217 3300013105 Ga0157369_10401183 Ga0157369_104011832 223
218 3300025914 Ga0207671_10021428 Ga0207671_100214283 223
219 3300025928 Ga0207700_10022733 Ga0207700_100227335 223
220 3300025929 Ga0207664_10095846 Ga0207664_100958462 223
221 3300028381 Ga0268264_10981651 Ga0268264_109816511 223
222 3300031251 Ga0265327_10000604 Ga0265327_1000060416 223
223 3300048903 Ga0496100_0000145 Ga0496100_0000145_29775_30446 223
224 3300048904 Ga0496101_0000118 Ga0496101_0000118_67005_67676 223
225 3300048905 Ga0496102_0011754 Ga0496102_0011754_1124_1795 223
226 3300048906 Ga0496103_0001331 Ga0496103_0001331_5154_5825 223
227 3300048909 Ga0496106_0003401 Ga0496106_0003401_1611_2282 223
228 3300048910 Ga0496107_0004035 Ga0496107_0004035_8520_9191 223
229 3300048911 Ga0496108_0001232 Ga0496108_0001232_8899_9570 223
230 3300048912 Ga0496109_0000401 Ga0496109_0000401_8754_9425 223
231 3300048914 Ga0496111_0008965 Ga0496111_0008965_2520_3191 223
232 3300048917 Ga0496114_0007889 Ga0496114_0007889_3538_4209 223
233 3300048918 Ga0496115_0022280 Ga0496115_0022280_2482_3153 223
234 3300048919 Ga0496116_0022778 Ga0496116_0022778_3218_3889 223
235 3300048920 Ga0496117_0033007 Ga0496117_0033007_872_1543 223
236 3300048921 Ga0496118_0039607 Ga0496118_0039607_2700_3371 223
237 3300048922 Ga0496119_0010262 Ga0496119_0010262_4020_4691 223
238 3300048924 Ga0496121_0000002 Ga0496121_0000002_1079621_1080292 223
239 3300048925 Ga0496122_0000141 Ga0496122_0000141_13783_14454 223
240 3300048926 Ga0496123_0052293 Ga0496123_0052293_402_1073 223
241 3300048927 Ga0496124_0000002 Ga0496124_0000002_414297_414968 223
242 3300048928 Ga0496125_0000002 Ga0496125_0000002_1079621_1080292 223
243 3300048929 Ga0496126_0000011 Ga0496126_0000011_414297_414968 223
244 3300048929 Ga0496126_0001416 Ga0496126_0001416_20658_21329 223
245 3300050491 nmdc:mga00v17_308703_c1 nmdc:mga00v17_308703_c1_121_792 223
246 3300050496 nmdc:mga07m45_11706_c1 nmdc:mga07m45_11706_c1_1326_1997 223
247 3300007076 Ga0075435_100423559 Ga0075435_1004235592 224
248 3300022467 Ga0224712_10207589 Ga0224712_102075891 224
249 3300049581 Ga0501047_0005341 Ga0501047_0005341_3793_4482 224
250 3300005539 Ga0068853_100141655 Ga0068853_1001416553 225
251 3300006186 Ga0075369_10233753 Ga0075369_102337531 225
252 3300006353 Ga0075370_10081187 Ga0075370_100811872 225
253 3300006844 Ga0075428_100220897 Ga0075428_1002208972 225
254 3300006846 Ga0075430_100001524 Ga0075430_1000015246 225
255 3300026078 Ga0207702_10875503 Ga0207702_108755031 225
256 3300044658 Ga0466972_0047241 Ga0466972_0047241_175_852 225
257 3300044901 Ga0466960_0029807 Ga0466960_0029807_630_1307 225
258 3300047472 Ga0495686_0001464 Ga0495686_0001464_18338_19024 225
259 3300050491 nmdc:mga00v17_575462_c1 nmdc:mga00v17_575462_c1_36_713 225
260 3300050509 nmdc:mga0qj67_223_c1 nmdc:mga0qj67_223_c1_31367_32044 225
261 3300050516 nmdc:mga0sz30_23211_c2 nmdc:mga0sz30_23211_c2_980_1657 225
262 iso_pu_bacteria 2902582711 2902586841 225
263 3300005841 Ga0068863_100035135 Ga0068863_1000351352 226
264 3300006028 Ga0070717_10057827 Ga0070717_100578273 226
265 3300006173 Ga0070716_100576091 Ga0070716_1005760911 226
266 3300006175 Ga0070712_100038076 Ga0070712_1000380764 226
267 3300006871 Ga0075434_100448258 Ga0075434_1004482581 226
268 3300025915 Ga0207693_10136616 Ga0207693_101366162 226
269 3300025928 Ga0207700_10145772 Ga0207700_101457722 226
270 3300025929 Ga0207664_10362937 Ga0207664_103629372 226
271 3300025986 Ga0207658_10101871 Ga0207658_101018713 226
272 3300026088 Ga0207641_10026300 Ga0207641_100263007 226
273 3300028381 Ga0268264_10225484 Ga0268264_102254843 226
274 3300035724 Ga0373933_0010045 Ga0373933_0010045_554_1249 226
275 3300036401 Ga0373937_0027835 Ga0373937_0027835_3090_3785 226
276 3300044658 Ga0466972_0026319 Ga0466972_0026319_1148_1828 226
277 3300044693 Ga0466961_0262271 Ga0466961_0262271_300_983 226
278 3300045049 Ga0466959_0026760 Ga0466959_0026760_1043_1726 226
279 3300045049 Ga0466959_0048369 Ga0466959_0048369_872_1552 226
280 3300045836 Ga0466958_0089217 Ga0466958_0089217_528_1211 226
281 3300046454 Ga0495592_0095934 Ga0495592_0095934_919_1614 226
282 3300046462 Ga0495651_0015357 Ga0495651_0015357_1476_2171 226
283 3300046463 Ga0495653_0037801 Ga0495653_0037801_889_1584 226
284 3300046477 Ga0495664_0004566 Ga0495664_0004566_4938_5633 226
285 3300046511 Ga0495608_0051607 Ga0495608_0051607_1835_2530 226
286 3300046514 Ga0495618_0077703 Ga0495618_0077703_297_995 226
287 3300046514 Ga0495618_0103644 Ga0495618_0103644_334_1029 226
288 3300046516 Ga0495628_0273340 Ga0495628_0273340_381_1076 226
289 3300046517 Ga0495630_0246731 Ga0495630_0246731_624_1322 226
290 3300046529 Ga0495652_0049011 Ga0495652_0049011_336_1031 226
291 3300046533 Ga0495640_0233776 Ga0495640_0233776_127_822 226
292 3300046536 Ga0495587_0028244 Ga0495587_0028244_2487_3182 226
293 3300046559 Ga0495667_0038440 Ga0495667_0038440_233_928 226
294 3300046559 Ga0495667_0058386 Ga0495667_0058386_656_1354 226
295 3300046642 Ga0495634_0148292 Ga0495634_0148292_334_1029 226
296 3300046642 Ga0495634_0191779 Ga0495634_0191779_205_903 226
297 3300046663 Ga0495635_0149655 Ga0495635_0149655_427_1122 226
298 3300046675 Ga0495657_0044132 Ga0495657_0044132_1130_1828 226
299 3300046680 Ga0495646_0079175 Ga0495646_0079175_244_939 226
300 3300046809 Ga0495600_0137619 Ga0495600_0137619_569_1264 226
301 3300046809 Ga0495600_0170930 Ga0495600_0170930_563_1261 226
302 3300047319 Ga0495674_0162146 Ga0495674_0162146_184_879 226
303 3300047319 Ga0495674_0174676 Ga0495674_0174676_1075_1773 226
304 3300047322 Ga0495680_0018780 Ga0495680_0018780_1427_2122 226
305 3300047322 Ga0495680_0047252 Ga0495680_0047252_1760_2458 226
306 3300047471 Ga0495684_0028401 Ga0495684_0028401_2210_2908 226
307 3300047471 Ga0495684_0052564 Ga0495684_0052564_330_1025 226
308 3300048088 Ga0495602_0201632 Ga0495602_0201632_492_1187 226
309 3300048905 Ga0496102_0397227 Ga0496102_0397227_262_954 226
310 3300048920 Ga0496117_0016614 Ga0496117_0016614_388_1080 226
311 3300048921 Ga0496118_0000295 Ga0496118_0000295_47791_48483 226
312 3300049570 Ga0501033_0119504 Ga0501033_0119504_1125_1808 226
313 3300049571 Ga0501034_0061558 Ga0501034_0061558_1187_1870 226
314 3300049579 Ga0501043_0560883 Ga0501043_0560883_55_738 226
315 3300049822 Ga0501035_0000729 Ga0501035_0000729_22440_23123 226
316 3300049823 Ga0501044_0000150 Ga0501044_0000150_60594_61277 226
317 3300050512 nmdc:mga0n895_417287_c1 nmdc:mga0n895_417287_c1_633_1331 226
318 3300050515 nmdc:mga0a205_762465_c1 nmdc:mga0a205_762465_c1_62_760 226
319 3300053077 Ga0495601_0087171 Ga0495601_0087171_1053_1748 226
320 3300053084 Ga0495595_0150699 Ga0495595_0150699_392_1087 226
321 3300006844 Ga0075428_100001450 Ga0075428_1000014509 227
322 3300006846 Ga0075430_100001791 Ga0075430_1000017918 227
323 3300009147 Ga0114129_10152338 Ga0114129_101523383 227
324 3300046511 Ga0495608_0024746 Ga0495608_0024746_1502_2206 227
325 3300048088 Ga0495602_0365232 Ga0495602_0365232_168_872 227
326 3300050507 nmdc:mga05p37_30180_c1 nmdc:mga05p37_30180_c1_2082_2771 227
327 3300050509 nmdc:mga0qj67_4017_c1 nmdc:mga0qj67_4017_c1_3491_4180 227
328 3300050510 nmdc:mga06r32_187041_c1 nmdc:mga06r32_187041_c1_82_771 227
329 iso_pu_bacteria 2842134933 2842139861 227
330 3300005344 Ga0070661_100176892 Ga0070661_1001768922 228
331 3300005563 Ga0068855_100025055 Ga0068855_1000250555 228
332 3300009093 Ga0105240_10038250 Ga0105240_100382504 228
333 3300013104 Ga0157370_10009445 Ga0157370_1000944511 228
334 3300013104 Ga0157370_10499077 Ga0157370_104990771 228
335 3300013105 Ga0157369_10007442 Ga0157369_1000744214 228
336 3300020082 Ga0206353_11386555 Ga0206353_113865551 228
337 3300022467 Ga0224712_10024520 Ga0224712_100245202 228
338 3300025929 Ga0207664_10059724 Ga0207664_100597242 228
339 3300025949 Ga0207667_10024287 Ga0207667_100242879 228
340 3300037466 Ga0395898_0318572 Ga0395898_0318572_312_1004 228
341 3300038443 Ga0395901_0082439 Ga0395901_0082439_1669_2361 228
342 3300044658 Ga0466972_0221282 Ga0466972_0221282_105_791 228
343 3300045976 Ga0466967_0062610 Ga0466967_0062610_648_1349 228
344 3300050491 nmdc:mga00v17_19011_c1 nmdc:mga00v17_19011_c1_1530_2222 228
345 3300001991 JGI24743J22301_10005285 JGI24743J22301_100052852 229
346 3300002077 JGI24744J21845_10004647 JGI24744J21845_100046473 229
347 3300005334 Ga0068869_100076006 Ga0068869_1000760062 229
348 3300005337 Ga0070682_100038305 Ga0070682_1000383053 229
349 3300005338 Ga0068868_100094095 Ga0068868_1000940953 229
350 3300005341 Ga0070691_10033728 Ga0070691_100337282 229
351 3300005345 Ga0070692_10294196 Ga0070692_102941961 229
352 3300005347 Ga0070668_100097208 Ga0070668_1000972083 229
353 3300005354 Ga0070675_100042619 Ga0070675_1000426194 229
354 3300005356 Ga0070674_100309285 Ga0070674_1003092851 229
355 3300005365 Ga0070688_100009269 Ga0070688_1000092697 229
356 3300005434 Ga0070709_10006672 Ga0070709_100066725 229
357 3300005437 Ga0070710_10004201 Ga0070710_100042015 229
358 3300005438 Ga0070701_10324140 Ga0070701_103241402 229
359 3300005439 Ga0070711_100104882 Ga0070711_1001048822 229
360 3300005440 Ga0070705_100136890 Ga0070705_1001368902 229
361 3300005546 Ga0070696_100107781 Ga0070696_1001077813 229
362 3300005547 Ga0070693_100076302 Ga0070693_1000763022 229
363 3300005548 Ga0070665_100030201 Ga0070665_1000302014 229
364 3300005616 Ga0068852_100660153 Ga0068852_1006601532 229
365 3300005618 Ga0068864_100021527 Ga0068864_1000215272 229
366 3300005718 Ga0068866_10019625 Ga0068866_100196251 229
367 3300005842 Ga0068858_100143690 Ga0068858_1001436902 229
368 3300006163 Ga0070715_10009292 Ga0070715_100092922 229
369 3300006173 Ga0070716_100013711 Ga0070716_1000137113 229
370 3300006175 Ga0070712_100214646 Ga0070712_1002146462 229
371 3300006175 Ga0070712_100365386 Ga0070712_1003653862 229
372 3300006353 Ga0075370_10001825 Ga0075370_100018257 229
373 3300006358 Ga0068871_100255678 Ga0068871_1002556782 229
374 3300006871 Ga0075434_100479962 Ga0075434_1004799621 229
375 3300009098 Ga0105245_10128307 Ga0105245_101283073 229
376 3300010375 Ga0105239_10724469 Ga0105239_107244692 229
377 3300011119 Ga0105246_10008982 Ga0105246_100089826 229
378 3300013105 Ga0157369_10264884 Ga0157369_102648842 229
379 3300013296 Ga0157374_10097643 Ga0157374_100976432 229
380 3300013306 Ga0163162_10206633 Ga0163162_102066332 229
381 3300013306 Ga0163162_10259457 Ga0163162_102594572 229
382 3300013307 Ga0157372_10391516 Ga0157372_103915162 229
383 3300013308 Ga0157375_10064693 Ga0157375_100646933 229
384 3300014325 Ga0163163_10475959 Ga0163163_104759592 229
385 3300014326 Ga0157380_10192342 Ga0157380_101923422 229
386 3300014968 Ga0157379_10168977 Ga0157379_101689772 229
387 3300017792 Ga0163161_10280173 Ga0163161_102801731 229
388 3300025898 Ga0207692_10058842 Ga0207692_100588422 229
389 3300025899 Ga0207642_10038328 Ga0207642_100383284 229
390 3300025901 Ga0207688_10007024 Ga0207688_100070246 229
391 3300025906 Ga0207699_10120563 Ga0207699_101205632 229
392 3300025907 Ga0207645_10123994 Ga0207645_101239942 229
393 3300025914 Ga0207671_10167660 Ga0207671_101676602 229
394 3300025915 Ga0207693_10002211 Ga0207693_1000221120 229
395 3300025916 Ga0207663_10037122 Ga0207663_100371222 229
396 3300025927 Ga0207687_10039911 Ga0207687_100399114 229
397 3300025928 Ga0207700_10463383 Ga0207700_104633832 229
398 3300025929 Ga0207664_10215448 Ga0207664_102154482 229
399 3300025929 Ga0207664_10580407 Ga0207664_105804072 229
400 3300025932 Ga0207690_10049749 Ga0207690_100497492 229
401 3300025933 Ga0207706_10040413 Ga0207706_100404134 229
402 3300025934 Ga0207686_10036330 Ga0207686_100363303 229
403 3300025935 Ga0207709_10096721 Ga0207709_100967212 229
404 3300025939 Ga0207665_10003320 Ga0207665_100033205 229
405 3300025944 Ga0207661_10138431 Ga0207661_101384312 229
406 3300025961 Ga0207712_10101823 Ga0207712_101018232 229
407 3300025972 Ga0207668_10113876 Ga0207668_101138762 229
408 3300025986 Ga0207658_10364224 Ga0207658_103642242 229
409 3300026035 Ga0207703_10155768 Ga0207703_101557682 229
410 3300026067 Ga0207678_10092261 Ga0207678_100922613 229
411 3300026067 Ga0207678_10415516 Ga0207678_104155162 229
412 3300026075 Ga0207708_10010483 Ga0207708_100104837 229
413 3300026089 Ga0207648_10151875 Ga0207648_101518753 229
414 3300026095 Ga0207676_10041465 Ga0207676_100414654 229
415 3300026118 Ga0207675_100014450 Ga0207675_1000144504 229
416 3300026118 Ga0207675_100048794 Ga0207675_1000487943 229
417 3300026121 Ga0207683_10084528 Ga0207683_100845284 229
418 3300026142 Ga0207698_10702661 Ga0207698_107026611 229
419 3300028379 Ga0268266_10017872 Ga0268266_100178725 229
420 3300048905 Ga0496102_0019653 Ga0496102_0019653_1786_2481 229
421 3300048905 Ga0496102_0378859 Ga0496102_0378859_448_1143 229
422 3300048906 Ga0496103_0062062 Ga0496103_0062062_919_1614 229
423 3300048909 Ga0496106_0003374 Ga0496106_0003374_7105_7800 229
424 3300048909 Ga0496106_0022110 Ga0496106_0022110_284_979 229
425 3300048910 Ga0496107_0040257 Ga0496107_0040257_2293_2988 229
426 3300048910 Ga0496107_0221536 Ga0496107_0221536_153_848 229
427 3300048911 Ga0496108_0000628 Ga0496108_0000628_14436_15131 229
428 3300048912 Ga0496109_0007586 Ga0496109_0007586_3095_3790 229
429 3300048912 Ga0496109_0094217 Ga0496109_0094217_965_1660 229
430 3300048913 Ga0496110_0020280 Ga0496110_0020280_646_1341 229
431 3300048913 Ga0496110_0164847 Ga0496110_0164847_850_1545 229
432 3300048914 Ga0496111_0149798 Ga0496111_0149798_998_1693 229
433 3300048914 Ga0496111_0406441 Ga0496111_0406441_99_794 229
434 3300048915 Ga0496112_0079919 Ga0496112_0079919_343_1038 229
435 3300048916 Ga0496113_0075969 Ga0496113_0075969_76_771 229
436 3300048916 Ga0496113_0127350 Ga0496113_0127350_194_889 229
437 3300048916 Ga0496113_0188305 Ga0496113_0188305_330_1049 229
438 3300049583 Ga0501067_0009612 Ga0501067_0009612_3483_4178 229
439 3300049585 Ga0501069_0020897 Ga0501069_0020897_2792_3487 229
440 3300050496 nmdc:mga07m45_5496_c1 nmdc:mga07m45_5496_c1_5055_5756 229
441 3300053084 Ga0495595_0310983 Ga0495595_0310983_48_764 229
442 3300044684 Ga0466966_0002534 Ga0466966_0002534_11221_11925 230
443 3300044693 Ga0466961_0184782 Ga0466961_0184782_252_956 230
444 3300045049 Ga0466959_0008960 Ga0466959_0008960_2487_3191 230
445 3300006028 Ga0070717_10080322 Ga0070717_100803222 231
446 3300049583 Ga0501067_0325282 Ga0501067_0325282_112_819 231
447 3300049588 Ga0501072_0119038 Ga0501072_0119038_374_1081 231
448 3300020069 Ga0197907_11334825 Ga0197907_113348251 232
449 3300005434 Ga0070709_10067613 Ga0070709_100676133 233
450 3300005435 Ga0070714_100016845 Ga0070714_1000168456 233
451 3300005437 Ga0070710_10043945 Ga0070710_100439454 233
452 3300006175 Ga0070712_100068385 Ga0070712_1000683854 233
453 3300025898 Ga0207692_10020886 Ga0207692_100208863 233
454 3300025906 Ga0207699_10171804 Ga0207699_101718042 233
455 3300025915 Ga0207693_10102049 Ga0207693_101020493 233
456 3300025929 Ga0207664_10003636 Ga0207664_100036365 233
457 3300044719 Ga0466971_0040031 Ga0466971_0040031_765_1469 233
458 3300044842 Ga0466957_0159339 Ga0466957_0159339_458_1162 233
459 3300045049 Ga0466959_0107205 Ga0466959_0107205_644_1348 233
460 3300045836 Ga0466958_0078573 Ga0466958_0078573_873_1577 233
461 3300061719 Ga0466962_0023973 Ga0466962_0023973_600_1304 233
462 3300000549 LJQas_1000242 LJQas_10002424 236

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

5

180

0.95

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

8

186

0.93

PF13242

Hydrolase_like

HAD-hyrolase-like

140

217

0.9

PF12710

HAD

haloacid dehalogenase-like hydrolase

8

176

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s6j-assembly3.cif.gz_D the crystal structure of a hydrolase from pseudomonas syringae 0.9544 13 227
3s6j-assembly1.cif.gz_A the crystal structure of a hydrolase from pseudomonas syringae 0.9522 12 225
3s6j-assembly3.cif.gz_C the crystal structure of a hydrolase from pseudomonas syringae 0.9463 15 227
3s6j-assembly3.cif.gz_D the crystal structure of a hydrolase from pseudomonas syringae 0.9458 13 227
3s6j-assembly2.cif.gz_B the crystal structure of a hydrolase from pseudomonas syringae 0.9434 13 227
ID Description Score Start End Superfamily
3s6jB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9257 13 227 3.40.50.1000
af_Q652P6_229_339_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9178 112 215 3.40.50.1000
3s6jB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9138 13 227 3.40.50.1000
3kbbA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9071 98 225 3.40.50.1000
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9049 102 209 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A0J1BXU9-F1-model_v4 HAD family hydrolase 0.9968 18 233 GO:0005829
GO:0006281
GO:0008967
AF-A0A1H5PSN1-F1-model_v4 Haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED/haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E 0.9866 12 228 GO:0005829
GO:0006281
GO:0008967
AF-A0A124I0W5-F1-model_v4 HAD family hydrolase 0.9865 12 229 GO:0005829
GO:0006281
GO:0008967
AF-A0A3R9UDY3-F1-model_v4 HAD family hydrolase 0.9863 12 228 GO:0005829
GO:0006281
GO:0008967
AF-A0A1Q5KSS7-F1-model_v4 HAD family hydrolase 0.9856 12 228 GO:0005829
GO:0006281
GO:0008967

Feature Viewer

pLDDT pTM Quality
93.89 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map