F448936

General Info

Members Datasets Scaffolds Average Seq Length
462 239 924 371

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10226946|Ga0265316_102269461
Length 362
Sequence MSLADQALPYVRAISAYQPGKPITELARETGIPVDKIVKLASNENPLGMSPKAKKAVEAAISGVERYPDQFDLIKAVAAKAGVEQSQVVLGNGSNDVLDLIARVFLAPGRSAVFAQHAFAVYPLATLSIGGELIVTPAKNYGHDLDAMRAAIRPDTRIVWIANPNNPTGNFVPYPEVRAFLEAVPKDVVVVLDEAYNEYLPPAERVDVAGWIKDFPNLVVCRTMSKIYGLAGLRIGYALASAEVADLMNRVRQPFNVNNLALAGALAALDDDEFLQASYELNRRGMLQIVTGLEKLGLEYIKPHGNFVTFKVGDGAGINQKLLNLGVIVRPIGGYGLPEWLRVTIGTEAENARLLEALELVI

Samples

Sample ID Description Type Environment
1 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
120 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
121 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
122 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
132 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
135 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
136 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
146 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
147 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
148 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
149 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
150 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
151 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
152 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
153 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
237 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
238 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
239 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.3
Rhizosphere 98.05
Stem 0
Stem Tuber 0
Unclassified 0.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265316_10226946 3300031344 Bacteria 1376
2 Ga0070690_100023318 3300005330 Bacteria 3795
3 Ga0070690_100042097 3300005330 Bacteria 2892
4 Ga0070670_100034318 3300005331 Bacteria 4366
5 Ga0070677_10002463 3300005333 Bacteria 5924
6 Ga0070666_10004998 3300005335 Bacteria 8112
7 Ga0068868_100079706 3300005338 Bacteria 2623
8 Ga0068868_100112852 3300005338 Bacteria 2210
9 Ga0070689_100048619 3300005340 Bacteria 3271
10 Ga0070691_10064085 3300005341 Bacteria 1773
11 Ga0070687_100016203 3300005343 Bacteria 3392
12 Ga0070687_100046055 3300005343 Bacteria 2231
13 Ga0070692_10015816 3300005345 Bacteria 3577
14 Ga0070692_10023653 3300005345 Bacteria 3012
15 Ga0070669_100318838 3300005353 Bacteria 1254
16 Ga0070675_100091675 3300005354 Bacteria 2546
17 Ga0070675_100290232 3300005354 Bacteria 1439
18 Ga0070671_100041992 3300005355 Bacteria 3801
19 Ga0070674_100022812 3300005356 Bacteria 4039
20 Ga0070673_100127573 3300005364 Bacteria 2130
21 Ga0070659_100188873 3300005366 Bacteria 1693
22 Ga0070667_100071764 3300005367 Bacteria 2949
23 Ga0070714_100001917 3300005435 Bacteria 15177
24 Ga0070705_100038490 3300005440 Bacteria 2706
25 Ga0070700_100002980 3300005441 Bacteria 8688
26 Ga0070700_100007202 3300005441 Bacteria 5992
27 Ga0070700_100020323 3300005441 Bacteria 3844
28 Ga0070700_100069946 3300005441 Bacteria 2236
29 Ga0070694_100078555 3300005444 Bacteria 2289
30 Ga0070662_100078967 3300005457 Bacteria 2446
31 Ga0070681_10000685 3300005458 Bacteria 28045
32 Ga0070681_10008164 3300005458 Bacteria 10249
33 Ga0068867_100002134 3300005459 Bacteria 13894
34 Ga0068867_100002723 3300005459 Bacteria 12466
35 Ga0068867_100034081 3300005459 Bacteria 3689
36 Ga0068867_100041867 3300005459 Bacteria 3348
37 Ga0068867_100072530 3300005459 Bacteria 2578
38 Ga0070684_100007846 3300005535 Bacteria 8324
39 Ga0070697_100114902 3300005536 Bacteria 2247
40 Ga0070697_100160548 3300005536 Bacteria 1899
41 Ga0070697_100222734 3300005536 Bacteria 1608
42 Ga0070686_100000425 3300005544 Bacteria 26563
43 Ga0070695_100034487 3300005545 Bacteria 3173
44 Ga0070695_100035637 3300005545 Bacteria 3126
45 Ga0070695_100041189 3300005545 Bacteria 2927
46 Ga0070695_100222703 3300005545 Bacteria 1360
47 Ga0070696_100004260 3300005546 Bacteria 9540
48 Ga0070696_100022721 3300005546 Bacteria 4263
49 Ga0070704_100007675 3300005549 Bacteria 6430
50 Ga0070704_100008861 3300005549 Bacteria 6056
51 Ga0070704_100052864 3300005549 Bacteria 2868
52 Ga0070704_100063605 3300005549 Bacteria 2649
53 Ga0068856_100114452 3300005614 Bacteria 2697
54 Ga0070702_100000216 3300005615 Bacteria 19242
55 Ga0070702_100027021 3300005615 Bacteria 3092
56 Ga0068859_100022141 3300005617 Bacteria 6373
57 Ga0068859_100070211 3300005617 Bacteria 3538
58 Ga0068859_100262819 3300005617 Bacteria 1817
59 Ga0068859_100279434 3300005617 Bacteria 1762
60 Ga0068864_100024494 3300005618 Bacteria 5078
61 Ga0068866_10000880 3300005718 Bacteria 13251
62 Ga0068866_10101064 3300005718 Bacteria 1591
63 Ga0068861_100000406 3300005719 Bacteria 24917
64 Ga0068861_100391074 3300005719 Bacteria 1231
65 Ga0068858_100053346 3300005842 Bacteria 3740
66 Ga0068862_100255738 3300005844 Bacteria 1597
67 Ga0070715_10009063 3300006163 Bacteria 3493
68 Ga0097621_100035601 3300006237 Bacteria 3979
69 Ga0068871_100000638 3300006358 Bacteria 24082
70 Ga0068871_100002996 3300006358 Bacteria 11587
71 Ga0068871_100143006 3300006358 Bacteria 2035
72 Ga0075428_100039788 3300006844 Bacteria 5175
73 Ga0075428_100131389 3300006844 Bacteria 2723
74 Ga0075428_100204237 3300006844 Bacteria 2135
75 Ga0075428_100270073 3300006844 Bacteria 1830
76 Ga0075428_100287315 3300006844 Bacteria 1769
77 Ga0075430_100005230 3300006846 Bacteria 10943
78 Ga0075430_100008533 3300006846 Bacteria 8654
79 Ga0075430_100104450 3300006846 Bacteria 2365
80 Ga0075430_100251478 3300006846 Bacteria 1464
81 Ga0075431_100005453 3300006847 Bacteria 12568
82 Ga0075434_100000017 3300006871 Bacteria 74154
83 Ga0075434_100063439 3300006871 Bacteria 3677
84 Ga0075429_100000003 3300006880 Bacteria 130377
85 Ga0075429_100011652 3300006880 Bacteria 7624
86 Ga0075429_100025516 3300006880 Bacteria 5129
87 Ga0075429_100042611 3300006880 Bacteria 3950
88 Ga0068865_100001425 3300006881 Bacteria 13951
89 Ga0068865_100005462 3300006881 Bacteria 7709
90 Ga0068865_100115988 3300006881 Bacteria 1983
91 Ga0075436_100012475 3300006914 Bacteria 5824
92 Ga0075436_100041119 3300006914 Bacteria 3190
93 Ga0075436_100045861 3300006914 Bacteria 3015
94 Ga0097620_100022140 3300006931 Bacteria 6373
95 Ga0097620_100070216 3300006931 Bacteria 3538
96 Ga0097620_100262828 3300006931 Bacteria 1817
97 Ga0097620_100279444 3300006931 Bacteria 1762
98 Ga0075435_100025665 3300007076 Bacteria 4589
99 Ga0075435_100074129 3300007076 Bacteria 2783
100 Ga0075435_100085143 3300007076 Bacteria 2602
101 Ga0099795_10035999 3300007788 Bacteria 1734
102 Ga0105240_10333289 3300009093 Bacteria 1726
103 Ga0111539_10002346 3300009094 Bacteria 25210
104 Ga0111539_10006612 3300009094 Bacteria 14934
105 Ga0111539_10024928 3300009094 Bacteria 7332
106 Ga0111539_10103982 3300009094 Bacteria 3332
107 Ga0111539_10177880 3300009094 Unclassified 2485
108 Ga0111539_10253607 3300009094 Bacteria 2049
109 Ga0111539_10423426 3300009094 Bacteria 1551
110 Ga0105245_10000182 3300009098 Bacteria 59361
111 Ga0105245_10081271 3300009098 Bacteria 2962
112 Ga0105245_10140385 3300009098 Bacteria 2275
113 Ga0105247_10190728 3300009101 Bacteria 1372
114 Ga0114129_10009603 3300009147 Bacteria 13798
115 Ga0114129_10317022 3300009147 Bacteria 2074
116 Ga0105243_10009415 3300009148 Bacteria 7444
117 Ga0105243_10016134 3300009148 Bacteria 5650
118 Ga0105243_10024968 3300009148 Bacteria 4563
119 Ga0105243_10082140 3300009148 Bacteria 2633
120 Ga0105242_10001174 3300009176 Bacteria 20608
121 Ga0105242_10011877 3300009176 Bacteria 6702
122 Ga0105242_10098157 3300009176 Bacteria 2478
123 Ga0105248_10125845 3300009177 Bacteria 2891
124 Ga0105249_10010145 3300009553 Bacteria 8270
125 Ga0105249_10072623 3300009553 Bacteria 3181
126 Ga0105239_10230970 3300010375 Bacteria 2075
127 Ga0105246_10125542 3300011119 Bacteria 1908
128 Ga0157370_10021267 3300013104 Bacteria 6468
129 Ga0157374_10186185 3300013296 Bacteria 2030
130 Ga0157374_10419827 3300013296 Bacteria 1336
131 Ga0157378_10001114 3300013297 Bacteria 24462
132 Ga0157378_10066853 3300013297 Bacteria 3220
133 Ga0163162_10055505 3300013306 Bacteria 3988
134 Ga0157372_10098937 3300013307 Bacteria 3327
135 Ga0157375_10021483 3300013308 Bacteria 5920
136 Ga0157375_10049269 3300013308 Bacteria 4126
137 Ga0157375_10179947 3300013308 Bacteria 2265
138 Ga0157375_10202428 3300013308 Bacteria 2141
139 Ga0163163_10181247 3300014325 Bacteria 2153
140 Ga0157380_10073176 3300014326 Bacteria 2778
141 Ga0157380_10132790 3300014326 Bacteria 2127
142 Ga0157379_10020793 3300014968 Bacteria 5808
143 Ga0157379_10111670 3300014968 Bacteria 2455
144 Ga0157379_10142277 3300014968 Unclassified 2162
145 Ga0157376_10035597 3300014969 Bacteria 4028
146 Ga0207697_10001747 3300025315 Bacteria 11677
147 Ga0207682_10033701 3300025893 Bacteria 2062
148 Ga0207642_10016651 3300025899 Bacteria 2775
149 Ga0207645_10005279 3300025907 Bacteria 9406
150 Ga0207643_10012125 3300025908 Bacteria 4658
151 Ga0207643_10059823 3300025908 Bacteria 2174
152 Ga0207707_10096785 3300025912 Bacteria 2579
153 Ga0207695_10114354 3300025913 Bacteria 2674
154 Ga0207660_10039252 3300025917 Bacteria 3309
155 Ga0207660_10209247 3300025917 Bacteria 1527
156 Ga0207662_10039783 3300025918 Bacteria 2760
157 Ga0207662_10074111 3300025918 Bacteria 2066
158 Ga0207649_10042514 3300025920 Bacteria 2773
159 Ga0207652_10028471 3300025921 Bacteria 4662
160 Ga0207681_10004318 3300025923 Bacteria 8772
161 Ga0207650_10066192 3300025925 Bacteria 2709
162 Ga0207659_10019165 3300025926 Bacteria 4497
163 Ga0207659_10168004 3300025926 Bacteria 1728
164 Ga0207687_10077940 3300025927 Bacteria 2385
165 Ga0207664_10045874 3300025929 Bacteria 3429
166 Ga0207690_10163614 3300025932 Bacteria 1661
167 Ga0207706_10007327 3300025933 Bacteria 10202
168 Ga0207686_10003193 3300025934 Bacteria 8817
169 Ga0207686_10018944 3300025934 Bacteria 3905
170 Ga0207686_10029917 3300025934 Bacteria 3219
171 Ga0207686_10030074 3300025934 Bacteria 3212
172 Ga0207709_10136348 3300025935 Bacteria 1681
173 Ga0207670_10008966 3300025936 Bacteria 5676
174 Ga0207704_10004505 3300025938 Bacteria 6368
175 Ga0207704_10005103 3300025938 Bacteria 6044
176 Ga0207711_10169356 3300025941 Bacteria 1981
177 Ga0207689_10000074 3300025942 Bacteria 80723
178 Ga0207689_10013398 3300025942 Bacteria 6999
179 Ga0207661_10101870 3300025944 Bacteria 2413
180 Ga0207661_10171123 3300025944 Bacteria 1891
181 Ga0207679_10092639 3300025945 Bacteria 2341
182 Ga0207712_10012958 3300025961 Bacteria 5338
183 Ga0207712_10013238 3300025961 Bacteria 5286
184 Ga0207668_10082189 3300025972 Bacteria 2339
185 Ga0207677_10037738 3300026023 Unclassified 3160
186 Ga0207677_10147625 3300026023 Bacteria 1809
187 Ga0207678_10101866 3300026067 Bacteria 2451
188 Ga0207708_10001899 3300026075 Bacteria 15444
189 Ga0207708_10011421 3300026075 Bacteria 6613
190 Ga0207708_10019279 3300026075 Bacteria 5139
191 Ga0207708_10093899 3300026075 Bacteria 2315
192 Ga0207708_10189724 3300026075 Bacteria 1635
193 Ga0207702_10067349 3300026078 Bacteria 3073
194 Ga0207702_10140825 3300026078 Bacteria 2182
195 Ga0207641_10163820 3300026088 Bacteria 2024
196 Ga0207648_10000059 3300026089 Bacteria 103580
197 Ga0207648_10004249 3300026089 Bacteria 14794
198 Ga0207648_10009053 3300026089 Bacteria 9578
199 Ga0207648_10035402 3300026089 Bacteria 4398
200 Ga0207648_10089096 3300026089 Bacteria 2695
201 Ga0207676_10119120 3300026095 Bacteria 2223
202 Ga0207674_10089786 3300026116 Bacteria 3065
203 Ga0207675_100000261 3300026118 Bacteria 50218
204 Ga0207675_100008426 3300026118 Bacteria 9718
205 Ga0207675_100013344 3300026118 Bacteria 7667
206 Ga0207683_10008821 3300026121 Bacteria 8600
207 Ga0207683_10017212 3300026121 Bacteria 6157
208 Ga0209969_1001748 3300027360 Bacteria 2996
209 Ga0209969_1008401 3300027360 Unclassified 1464
210 Ga0210000_1000583 3300027462 Bacteria 4992
211 Ga0209995_1004293 3300027471 Bacteria 2279
212 Ga0209999_1000354 3300027543 Bacteria 6959
213 Ga0209999_1006448 3300027543 Bacteria 2107
214 Ga0209983_1003592 3300027665 Bacteria 3291
215 Ga0207428_10022384 3300027907 Bacteria 5335
216 Ga0207428_10072469 3300027907 Bacteria 2704
217 Ga0268266_10052173 3300028379 Bacteria 3512
218 Ga0268265_10000957 3300028380 Bacteria 26523
219 Ga0268265_10185065 3300028380 Bacteria 1793
220 Ga0268265_10321810 3300028380 Bacteria 1401
221 Ga0265318_10002659 3300028577 Bacteria 9408
222 Ga0265330_10003509 3300031235 Bacteria 8174
223 Ga0265332_10001156 3300031238 Bacteria 15284
224 Ga0265328_10002609 3300031239 Bacteria 8056
225 Ga0265331_10000012 3300031250 Bacteria 297201
226 Ga0265331_10006686 3300031250 Bacteria 6771
227 Ga0265331_10007252 3300031250 Bacteria 6430
228 Ga0265331_10020603 3300031250 Bacteria 3383
229 Ga0265327_10000173 3300031251 Bacteria 138925
230 Ga0265327_10000458 3300031251 Bacteria 73095
231 Ga0265327_10004140 3300031251 Bacteria 13084
232 Ga0265327_10058894 3300031251 Bacteria 1969
233 Ga0265316_10004417 3300031344 Bacteria 14012
234 Ga0265316_10020215 3300031344 Bacteria 5674
235 Ga0265314_10000450 3300031711 Bacteria 54942
236 Ga0265342_10026131 3300031712 Bacteria 3663
237 Ga0307406_10166407 3300031901 Bacteria 1591
238 Ga0307412_10052963 3300031911 Bacteria 2689
239 Ga0307412_10228696 3300031911 Bacteria 1431
240 Ga0307416_100055008 3300032002 Bacteria 3202
241 Ga0307416_100261449 3300032002 Bacteria 1692
242 Ga0307415_100076163 3300032126 Bacteria 2378
243 Ga0373934_0039407 3300035086 Bacteria 1863
244 Ga0373952_0000876 3300035092 Bacteria 5482
245 Ga0373936_0061266 3300035113 Bacteria 1536
246 Ga0373954_0000072 3300035118 Bacteria 35827
247 Ga0373954_0000934 3300035118 Bacteria 11358
248 Ga0373954_0007933 3300035118 Bacteria 4651
249 Ga0373956_0000005 3300035119 Bacteria 69067
250 Ga0373957_0006999 3300035120 Bacteria 3586
251 Ga0373955_0002156 3300035172 Bacteria 8508
252 Ga0373955_0101107 3300035172 Bacteria 1655
253 Ga0373924_0015595 3300035410 Bacteria 2890
254 Ga0373924_0023103 3300035410 Bacteria 2435
255 Ga0373931_0017533 3300035691 Bacteria 3545
256 Ga0373935_0011122 3300035692 Bacteria 5403
257 Ga0373935_0194780 3300035692 Bacteria 1398
258 Ga0373933_0003113 3300035724 Bacteria 9250
259 Ga0373933_0003169 3300035724 Bacteria 9187
260 Ga0373933_0004028 3300035724 Bacteria 8103
261 Ga0373937_0001775 3300036401 Bacteria 18120
262 Ga0373937_0058619 3300036401 Bacteria 3537
263 Ga0373925_0040181 3300037068 Bacteria 3463
264 Ga0395900_0061165 3300037418 Bacteria 3873
265 Ga0436361_0480295 3300039447 Bacteria 1448
266 Ga0451843_1618263 3300041509 Bacteria 1868
267 Ga0439441_006814 3300042001 Bacteria 1822
268 Ga0439443_003563 3300042003 Bacteria 1972
269 Ga0439443_004496 3300042003 Bacteria 1819
270 Ga0439456_016244 3300042013 Bacteria 1557
271 Ga0439435_0000164 3300042436 Bacteria 9201
272 Ga0439435_0000651 3300042436 Bacteria 5720
273 Ga0439444_0008763 3300042437 Bacteria 1581
274 Ga0439460_0000630 3300042461 Bacteria 7729
275 Ga0466965_0063300 3300044683 Bacteria 1851
276 Ga0453684_0004586 3300044712 Bacteria 28810
277 Ga0451576_0026308 3300045051 Bacteria 6259
278 Ga0466967_0003407 3300045976 Bacteria 10366
279 Ga0495592_0006887 3300046454 Bacteria 8487
280 Ga0495592_0013182 3300046454 Bacteria 6290
281 Ga0495651_0002160 3300046462 Bacteria 15218
282 Ga0495651_0020407 3300046462 Bacteria 5144
283 Ga0495580_0041365 3300046472 Bacteria 3286
284 Ga0495582_0067939 3300046473 Bacteria 1970
285 Ga0495639_0023166 3300046475 Bacteria 2727
286 Ga0495662_0007694 3300046476 Bacteria 5310
287 Ga0495608_0052775 3300046511 Bacteria 2690
288 Ga0495628_0013602 3300046516 Bacteria 6843
289 Ga0495628_0015463 3300046516 Bacteria 6372
290 Ga0495630_0001395 3300046517 Bacteria 16694
291 Ga0495630_0007934 3300046517 Bacteria 7616
292 Ga0495666_0007640 3300046526 Bacteria 5410
293 Ga0495652_0010394 3300046529 Bacteria 8436
294 Ga0495665_0023516 3300046531 Bacteria 3310
295 Ga0495640_0004081 3300046533 Bacteria 11683
296 Ga0495640_0188046 3300046533 Bacteria 1314
297 Ga0495586_0003437 3300046535 Bacteria 8486
298 Ga0495586_0035239 3300046535 Bacteria 2688
299 Ga0495587_0023883 3300046536 Bacteria 3753
300 Ga0495587_0097391 3300046536 Bacteria 1696
301 Ga0495645_0000958 3300046543 Bacteria 19749
302 Ga0495667_0016672 3300046559 Bacteria 4960
303 Ga0495667_0059553 3300046559 Bacteria 2506
304 Ga0495634_0049922 3300046642 Bacteria 2811
305 Ga0495634_0116185 3300046642 Bacteria 1716
306 Ga0495635_0023691 3300046663 Bacteria 4277
307 Ga0495635_0029362 3300046663 Bacteria 3823
308 Ga0495635_0086847 3300046663 Bacteria 2140
309 Ga0495657_0050206 3300046675 Bacteria 2805
310 Ga0495599_0002184 3300046678 Bacteria 11358
311 Ga0495599_0013048 3300046678 Bacteria 5129
312 Ga0495647_0000295 3300046681 Bacteria 13928
313 Ga0495658_0007328 3300046683 Bacteria 5454
314 Ga0495613_0007991 3300046689 Bacteria 7868
315 Ga0495613_0034147 3300046689 Bacteria 3778
316 Ga0495624_0027976 3300046690 Bacteria 3686
317 Ga0495624_0038222 3300046690 Bacteria 3084
318 Ga0495581_0152275 3300047315 Bacteria 1351
319 Ga0495604_0007589 3300047317 Bacteria 8585
320 Ga0495604_0062390 3300047317 Bacteria 2847
321 Ga0495604_0201499 3300047317 Bacteria 1380
322 Ga0495636_0015431 3300047318 Bacteria 3045
323 Ga0495674_0002146 3300047319 Bacteria 19384
324 Ga0495680_0078475 3300047322 Bacteria 2498
325 Ga0495684_0126819 3300047471 Bacteria 1919
326 Ga0495614_0022973 3300048089 Bacteria 2690
327 Ga0496108_0083693 3300048911 Bacteria 2706
328 Ga0496108_0173908 3300048911 Bacteria 1864
329 Ga0496109_0109415 3300048912 Bacteria 2569
330 Ga0496109_0244088 3300048912 Bacteria 1691
331 Ga0496114_0001990 3300048917 Bacteria 15553
332 Ga0496114_0032170 3300048917 Bacteria 4316
333 Ga0501031_0011595 3300049568 Bacteria 5748
334 Ga0501031_0024467 3300049568 Bacteria 3936
335 Ga0501032_0004102 3300049569 Bacteria 11037
336 Ga0501032_0006442 3300049569 Bacteria 8637
337 Ga0501032_0126742 3300049569 Bacteria 1686
338 Ga0501033_0002315 3300049570 Bacteria 16251
339 Ga0501033_0002794 3300049570 Bacteria 14620
340 Ga0501033_0020969 3300049570 Bacteria 4934
341 Ga0501033_0110400 3300049570 Bacteria 2002
342 Ga0501034_0000487 3300049571 Bacteria 64548
343 Ga0501036_0032254 3300049572 Bacteria 4426
344 Ga0501036_0050848 3300049572 Bacteria 3509
345 Ga0501036_0166291 3300049572 Bacteria 1859
346 Ga0501036_0279849 3300049572 Bacteria 1396
347 Ga0501037_0009510 3300049573 Bacteria 7132
348 Ga0501037_0027666 3300049573 Bacteria 4190
349 Ga0501037_0153638 3300049573 Bacteria 1644
350 Ga0501038_0003775 3300049574 Bacteria 14090
351 Ga0501038_0005751 3300049574 Bacteria 11488
352 Ga0501038_0010300 3300049574 Bacteria 8553
353 Ga0501039_0008865 3300049575 Bacteria 7664
354 Ga0501039_0024155 3300049575 Bacteria 4668
355 Ga0501039_0027129 3300049575 Bacteria 4404
356 Ga0501039_0053257 3300049575 Bacteria 3131
357 Ga0501039_0065750 3300049575 Bacteria 2813
358 Ga0501040_0002876 3300049576 Bacteria 11122
359 Ga0501040_0005878 3300049576 Bacteria 7943
360 Ga0501040_0014676 3300049576 Bacteria 5167
361 Ga0501040_0084559 3300049576 Bacteria 2201
362 Ga0501040_0214038 3300049576 Bacteria 1370
363 Ga0501041_0005283 3300049577 Bacteria 7549
364 Ga0501041_0021859 3300049577 Bacteria 3832
365 Ga0501041_0042902 3300049577 Bacteria 2749
366 Ga0501041_0198269 3300049577 Bacteria 1258
367 Ga0501042_0045296 3300049578 Bacteria 3135
368 Ga0501042_0088037 3300049578 Bacteria 2228
369 Ga0501043_0001775 3300049579 Bacteria 18543
370 Ga0501043_0002706 3300049579 Bacteria 14854
371 Ga0501043_0027679 3300049579 Bacteria 4450
372 Ga0501043_0037705 3300049579 Bacteria 3801
373 Ga0501046_0010030 3300049580 Bacteria 8158
374 Ga0501046_0087149 3300049580 Bacteria 2406
375 Ga0501047_0011008 3300049581 Bacteria 8560
376 Ga0501048_0001726 3300049582 Bacteria 16642
377 Ga0501048_0066328 3300049582 Bacteria 2552
378 Ga0501048_0120060 3300049582 Bacteria 1857
379 Ga0501067_0060061 3300049583 Bacteria 2104
380 Ga0501068_0000783 3300049584 Bacteria 16418
381 Ga0501068_0005521 3300049584 Bacteria 6929
382 Ga0501068_0042398 3300049584 Bacteria 2737
383 Ga0501068_0143833 3300049584 Bacteria 1496
384 Ga0501070_0021847 3300049586 Bacteria 5362
385 Ga0501071_0003552 3300049587 Bacteria 9761
386 Ga0501072_0009015 3300049588 Bacteria 7582
387 Ga0501072_0012944 3300049588 Bacteria 6382
388 Ga0501072_0042872 3300049588 Bacteria 3555
389 Ga0501073_0002905 3300049589 Bacteria 12860
390 Ga0501074_0025968 3300049590 Bacteria 4248
391 Ga0501075_0000841 3300049591 Bacteria 19343
392 Ga0501075_0007617 3300049591 Bacteria 7511
393 Ga0501075_0011495 3300049591 Bacteria 6267
394 Ga0501075_0054664 3300049591 Bacteria 3004
395 Ga0501076_0000166 3300049592 Bacteria 38261
396 Ga0501076_0003381 3300049592 Bacteria 11203
397 Ga0501079_0003440 3300049741 Bacteria 11629
398 Ga0501079_0203317 3300049741 Bacteria 1547
399 Ga0501080_0002322 3300049742 Bacteria 16602
400 Ga0501080_0035646 3300049742 Bacteria 4643
401 Ga0501080_0050197 3300049742 Bacteria 3884
402 Ga0501081_0003318 3300049743 Bacteria 10229
403 Ga0501081_0024336 3300049743 Bacteria 4065
404 Ga0501081_0044594 3300049743 Bacteria 3044
405 Ga0501081_0064468 3300049743 Bacteria 2545
406 Ga0501083_0008073 3300049744 Bacteria 7445
407 Ga0501280_002327 3300049776 Bacteria 3205
408 Ga0501035_0001382 3300049822 Bacteria 24950
409 Ga0501035_0033451 3300049822 Bacteria 4676
410 Ga0501035_0054170 3300049822 Bacteria 3584
411 Ga0501044_0000066 3300049823 Bacteria 128533
412 Ga0501044_0005140 3300049823 Bacteria 14594
413 Ga0501044_0012269 3300049823 Bacteria 9276
414 Ga0501044_0038871 3300049823 Bacteria 4968
415 Ga0501044_0268104 3300049823 Bacteria 1644
416 Ga0501045_0024666 3300049824 Bacteria 4318
417 Ga0501045_0067210 3300049824 Bacteria 2632
418 Ga0501045_0080856 3300049824 Bacteria 2396
419 nmdc:mga05p37_181328_c1 3300050507 Bacteria 2561
420 nmdc:mga05p37_486948_c1 3300050507 Bacteria 1419
421 nmdc:mga09592_29450_c1 3300050508 Bacteria 4567
422 nmdc:mga09592_3138_c1 3300050508 Bacteria 13418
423 nmdc:mga09592_35684_c1 3300050508 Bacteria 4163
424 nmdc:mga09592_93988_c1 3300050508 Bacteria 2564
425 nmdc:mga0qj67_101628_c1 3300050509 Bacteria 2318
426 nmdc:mga0qj67_23511_c1 3300050509 Bacteria 4743
427 nmdc:mga0qj67_29222_c1 3300050509 Bacteria 4281
428 nmdc:mga0qj67_2922_c1 3300050509 Bacteria 12269
429 nmdc:mga0qj67_54054_c1 3300050509 Bacteria 3180
430 nmdc:mga0qj67_70280_c1 3300050509 Bacteria 2793
431 nmdc:mga06r32_133774_c1 3300050510 Bacteria 2454
432 nmdc:mga06r32_157066_c1 3300050510 Bacteria 2256
433 nmdc:mga06r32_19344_c1 3300050510 Bacteria 6248
434 nmdc:mga06r32_291882_c1 3300050510 Bacteria 1617
435 nmdc:mga06r32_34661_c1 3300050510 Bacteria 4761
436 nmdc:mga08y16_536705_c1 3300050511 Bacteria 1185
437 nmdc:mga08y16_5382_c1 3300050511 Bacteria 13389
438 nmdc:mga08y16_583170_c1 3300050511 Bacteria 1129
439 nmdc:mga08y16_77693_c1 3300050511 Bacteria 3461
440 nmdc:mga08y16_79758_c1 3300050511 Bacteria 3412
441 nmdc:mga0n895_151_c1 3300050512 Bacteria 42739
442 nmdc:mga0n895_8493_c1 3300050512 Bacteria 8896
443 nmdc:mga0rr50_18966_c1 3300050513 Bacteria 4633
444 nmdc:mga0rr50_56319_c1 3300050513 Bacteria 2937
445 nmdc:mga08x19_139749_c1 3300050514 Bacteria 1635
446 nmdc:mga08x19_150166_c1 3300050514 Bacteria 1577
447 nmdc:mga08x19_29876_c1 3300050514 Bacteria 3420
448 nmdc:mga08x19_68200_c1 3300050514 Bacteria 2315
449 Ga0495601_0002012 3300053077 Bacteria 11407
450 Ga0495619_0024402 3300053085 Bacteria 3879
451 Ga0495619_0090629 3300053085 Bacteria 2070
452 Ga0501084_0023906 3300054114 Bacteria 5098
453 Ga0501084_0082600 3300054114 Bacteria 2696
454 Ga0501084_0089179 3300054114 Bacteria 2589
455 Ga0501082_0004974 3300060353 Bacteria 11604
456 Ga0501082_0011950 3300060353 Bacteria 7466
457 Ga0501082_0296738 3300060353 Bacteria 1407
458 Ga0530510_0000956 3300061734 Bacteria 19075
459 Ga0530510_0053854 3300061734 Bacteria 2907
460 2574431009 2574179768 Bacteria 4907129
461 2891634054 2891633521 Bacteria 4602265
462 639786198 639633007 Bacteria 4376040
463 Ga0265316_10226946
464 Ga0070690_100023318
465 Ga0070690_100042097
466 Ga0070670_100034318
467 Ga0070677_10002463
468 Ga0070666_10004998
469 Ga0068868_100079706
470 Ga0068868_100112852
471 Ga0070689_100048619
472 Ga0070691_10064085
473 Ga0070687_100016203
474 Ga0070687_100046055
475 Ga0070692_10015816
476 Ga0070692_10023653
477 Ga0070669_100318838
478 Ga0070675_100091675
479 Ga0070675_100290232
480 Ga0070671_100041992
481 Ga0070674_100022812
482 Ga0070673_100127573
483 Ga0070659_100188873
484 Ga0070667_100071764
485 Ga0070714_100001917
486 Ga0070705_100038490
487 Ga0070700_100002980
488 Ga0070700_100007202
489 Ga0070700_100020323
490 Ga0070700_100069946
491 Ga0070694_100078555
492 Ga0070662_100078967
493 Ga0070681_10000685
494 Ga0070681_10008164
495 Ga0068867_100002134
496 Ga0068867_100002723
497 Ga0068867_100034081
498 Ga0068867_100041867
499 Ga0068867_100072530
500 Ga0070684_100007846
501 Ga0070697_100114902
502 Ga0070697_100160548
503 Ga0070697_100222734
504 Ga0070686_100000425
505 Ga0070695_100034487
506 Ga0070695_100035637
507 Ga0070695_100041189
508 Ga0070695_100222703
509 Ga0070696_100004260
510 Ga0070696_100022721
511 Ga0070704_100007675
512 Ga0070704_100008861
513 Ga0070704_100052864
514 Ga0070704_100063605
515 Ga0068856_100114452
516 Ga0070702_100000216
517 Ga0070702_100027021
518 Ga0068859_100022141
519 Ga0068859_100070211
520 Ga0068859_100262819
521 Ga0068859_100279434
522 Ga0068864_100024494
523 Ga0068866_10000880
524 Ga0068866_10101064
525 Ga0068861_100000406
526 Ga0068861_100391074
527 Ga0068858_100053346
528 Ga0068862_100255738
529 Ga0070715_10009063
530 Ga0097621_100035601
531 Ga0068871_100000638
532 Ga0068871_100002996
533 Ga0068871_100143006
534 Ga0075428_100039788
535 Ga0075428_100131389
536 Ga0075428_100204237
537 Ga0075428_100270073
538 Ga0075428_100287315
539 Ga0075430_100005230
540 Ga0075430_100008533
541 Ga0075430_100104450
542 Ga0075430_100251478
543 Ga0075431_100005453
544 Ga0075434_100000017
545 Ga0075434_100063439
546 Ga0075429_100000003
547 Ga0075429_100011652
548 Ga0075429_100025516
549 Ga0075429_100042611
550 Ga0068865_100001425
551 Ga0068865_100005462
552 Ga0068865_100115988
553 Ga0075436_100012475
554 Ga0075436_100041119
555 Ga0075436_100045861
556 Ga0097620_100022140
557 Ga0097620_100070216
558 Ga0097620_100262828
559 Ga0097620_100279444
560 Ga0075435_100025665
561 Ga0075435_100074129
562 Ga0075435_100085143
563 Ga0099795_10035999
564 Ga0105240_10333289
565 Ga0111539_10002346
566 Ga0111539_10006612
567 Ga0111539_10024928
568 Ga0111539_10103982
569 Ga0111539_10177880
570 Ga0111539_10253607
571 Ga0111539_10423426
572 Ga0105245_10000182
573 Ga0105245_10081271
574 Ga0105245_10140385
575 Ga0105247_10190728
576 Ga0114129_10009603
577 Ga0114129_10317022
578 Ga0105243_10009415
579 Ga0105243_10016134
580 Ga0105243_10024968
581 Ga0105243_10082140
582 Ga0105242_10001174
583 Ga0105242_10011877
584 Ga0105242_10098157
585 Ga0105248_10125845
586 Ga0105249_10010145
587 Ga0105249_10072623
588 Ga0105239_10230970
589 Ga0105246_10125542
590 Ga0157370_10021267
591 Ga0157374_10186185
592 Ga0157374_10419827
593 Ga0157378_10001114
594 Ga0157378_10066853
595 Ga0163162_10055505
596 Ga0157372_10098937
597 Ga0157375_10021483
598 Ga0157375_10049269
599 Ga0157375_10179947
600 Ga0157375_10202428
601 Ga0163163_10181247
602 Ga0157380_10073176
603 Ga0157380_10132790
604 Ga0157379_10020793
605 Ga0157379_10111670
606 Ga0157379_10142277
607 Ga0157376_10035597
608 Ga0207697_10001747
609 Ga0207682_10033701
610 Ga0207642_10016651
611 Ga0207645_10005279
612 Ga0207643_10012125
613 Ga0207643_10059823
614 Ga0207707_10096785
615 Ga0207695_10114354
616 Ga0207660_10039252
617 Ga0207660_10209247
618 Ga0207662_10039783
619 Ga0207662_10074111
620 Ga0207649_10042514
621 Ga0207652_10028471
622 Ga0207681_10004318
623 Ga0207650_10066192
624 Ga0207659_10019165
625 Ga0207659_10168004
626 Ga0207687_10077940
627 Ga0207664_10045874
628 Ga0207690_10163614
629 Ga0207706_10007327
630 Ga0207686_10003193
631 Ga0207686_10018944
632 Ga0207686_10029917
633 Ga0207686_10030074
634 Ga0207709_10136348
635 Ga0207670_10008966
636 Ga0207704_10004505
637 Ga0207704_10005103
638 Ga0207711_10169356
639 Ga0207689_10000074
640 Ga0207689_10013398
641 Ga0207661_10101870
642 Ga0207661_10171123
643 Ga0207679_10092639
644 Ga0207712_10012958
645 Ga0207712_10013238
646 Ga0207668_10082189
647 Ga0207677_10037738
648 Ga0207677_10147625
649 Ga0207678_10101866
650 Ga0207708_10001899
651 Ga0207708_10011421
652 Ga0207708_10019279
653 Ga0207708_10093899
654 Ga0207708_10189724
655 Ga0207702_10067349
656 Ga0207702_10140825
657 Ga0207641_10163820
658 Ga0207648_10000059
659 Ga0207648_10004249
660 Ga0207648_10009053
661 Ga0207648_10035402
662 Ga0207648_10089096
663 Ga0207676_10119120
664 Ga0207674_10089786
665 Ga0207675_100000261
666 Ga0207675_100008426
667 Ga0207675_100013344
668 Ga0207683_10008821
669 Ga0207683_10017212
670 Ga0209969_1001748
671 Ga0209969_1008401
672 Ga0210000_1000583
673 Ga0209995_1004293
674 Ga0209999_1000354
675 Ga0209999_1006448
676 Ga0209983_1003592
677 Ga0207428_10022384
678 Ga0207428_10072469
679 Ga0268266_10052173
680 Ga0268265_10000957
681 Ga0268265_10185065
682 Ga0268265_10321810
683 Ga0265318_10002659
684 Ga0265330_10003509
685 Ga0265332_10001156
686 Ga0265328_10002609
687 Ga0265331_10000012
688 Ga0265331_10006686
689 Ga0265331_10007252
690 Ga0265331_10020603
691 Ga0265327_10000173
692 Ga0265327_10000458
693 Ga0265327_10004140
694 Ga0265327_10058894
695 Ga0265316_10004417
696 Ga0265316_10020215
697 Ga0265314_10000450
698 Ga0265342_10026131
699 Ga0307406_10166407
700 Ga0307412_10052963
701 Ga0307412_10228696
702 Ga0307416_100055008
703 Ga0307416_100261449
704 Ga0307415_100076163
705 Ga0373934_0039407
706 Ga0373952_0000876
707 Ga0373936_0061266
708 Ga0373954_0000072
709 Ga0373954_0000934
710 Ga0373954_0007933
711 Ga0373956_0000005
712 Ga0373957_0006999
713 Ga0373955_0002156
714 Ga0373955_0101107
715 Ga0373924_0015595
716 Ga0373924_0023103
717 Ga0373931_0017533
718 Ga0373935_0011122
719 Ga0373935_0194780
720 Ga0373933_0003113
721 Ga0373933_0003169
722 Ga0373933_0004028
723 Ga0373937_0001775
724 Ga0373937_0058619
725 Ga0373925_0040181
726 Ga0395900_0061165
727 Ga0436361_0480295
728 Ga0451843_1618263
729 Ga0439441_006814
730 Ga0439443_003563
731 Ga0439443_004496
732 Ga0439456_016244
733 Ga0439435_0000164
734 Ga0439435_0000651
735 Ga0439444_0008763
736 Ga0439460_0000630
737 Ga0466965_0063300
738 Ga0453684_0004586
739 Ga0451576_0026308
740 Ga0466967_0003407
741 Ga0495592_0006887
742 Ga0495592_0013182
743 Ga0495651_0002160
744 Ga0495651_0020407
745 Ga0495580_0041365
746 Ga0495582_0067939
747 Ga0495639_0023166
748 Ga0495662_0007694
749 Ga0495608_0052775
750 Ga0495628_0013602
751 Ga0495628_0015463
752 Ga0495630_0001395
753 Ga0495630_0007934
754 Ga0495666_0007640
755 Ga0495652_0010394
756 Ga0495665_0023516
757 Ga0495640_0004081
758 Ga0495640_0188046
759 Ga0495586_0003437
760 Ga0495586_0035239
761 Ga0495587_0023883
762 Ga0495587_0097391
763 Ga0495645_0000958
764 Ga0495667_0016672
765 Ga0495667_0059553
766 Ga0495634_0049922
767 Ga0495634_0116185
768 Ga0495635_0023691
769 Ga0495635_0029362
770 Ga0495635_0086847
771 Ga0495657_0050206
772 Ga0495599_0002184
773 Ga0495599_0013048
774 Ga0495647_0000295
775 Ga0495658_0007328
776 Ga0495613_0007991
777 Ga0495613_0034147
778 Ga0495624_0027976
779 Ga0495624_0038222
780 Ga0495581_0152275
781 Ga0495604_0007589
782 Ga0495604_0062390
783 Ga0495604_0201499
784 Ga0495636_0015431
785 Ga0495674_0002146
786 Ga0495680_0078475
787 Ga0495684_0126819
788 Ga0495614_0022973
789 Ga0496108_0083693
790 Ga0496108_0173908
791 Ga0496109_0109415
792 Ga0496109_0244088
793 Ga0496114_0001990
794 Ga0496114_0032170
795 Ga0501031_0011595
796 Ga0501031_0024467
797 Ga0501032_0004102
798 Ga0501032_0006442
799 Ga0501032_0126742
800 Ga0501033_0002315
801 Ga0501033_0002794
802 Ga0501033_0020969
803 Ga0501033_0110400
804 Ga0501034_0000487
805 Ga0501036_0032254
806 Ga0501036_0050848
807 Ga0501036_0166291
808 Ga0501036_0279849
809 Ga0501037_0009510
810 Ga0501037_0027666
811 Ga0501037_0153638
812 Ga0501038_0003775
813 Ga0501038_0005751
814 Ga0501038_0010300
815 Ga0501039_0008865
816 Ga0501039_0024155
817 Ga0501039_0027129
818 Ga0501039_0053257
819 Ga0501039_0065750
820 Ga0501040_0002876
821 Ga0501040_0005878
822 Ga0501040_0014676
823 Ga0501040_0084559
824 Ga0501040_0214038
825 Ga0501041_0005283
826 Ga0501041_0021859
827 Ga0501041_0042902
828 Ga0501041_0198269
829 Ga0501042_0045296
830 Ga0501042_0088037
831 Ga0501043_0001775
832 Ga0501043_0002706
833 Ga0501043_0027679
834 Ga0501043_0037705
835 Ga0501046_0010030
836 Ga0501046_0087149
837 Ga0501047_0011008
838 Ga0501048_0001726
839 Ga0501048_0066328
840 Ga0501048_0120060
841 Ga0501067_0060061
842 Ga0501068_0000783
843 Ga0501068_0005521
844 Ga0501068_0042398
845 Ga0501068_0143833
846 Ga0501070_0021847
847 Ga0501071_0003552
848 Ga0501072_0009015
849 Ga0501072_0012944
850 Ga0501072_0042872
851 Ga0501073_0002905
852 Ga0501074_0025968
853 Ga0501075_0000841
854 Ga0501075_0007617
855 Ga0501075_0011495
856 Ga0501075_0054664
857 Ga0501076_0000166
858 Ga0501076_0003381
859 Ga0501079_0003440
860 Ga0501079_0203317
861 Ga0501080_0002322
862 Ga0501080_0035646
863 Ga0501080_0050197
864 Ga0501081_0003318
865 Ga0501081_0024336
866 Ga0501081_0044594
867 Ga0501081_0064468
868 Ga0501083_0008073
869 Ga0501280_002327
870 Ga0501035_0001382
871 Ga0501035_0033451
872 Ga0501035_0054170
873 Ga0501044_0000066
874 Ga0501044_0005140
875 Ga0501044_0012269
876 Ga0501044_0038871
877 Ga0501044_0268104
878 Ga0501045_0024666
879 Ga0501045_0067210
880 Ga0501045_0080856
881 nmdc:mga05p37_181328_c1
882 nmdc:mga05p37_486948_c1
883 nmdc:mga09592_29450_c1
884 nmdc:mga09592_3138_c1
885 nmdc:mga09592_35684_c1
886 nmdc:mga09592_93988_c1
887 nmdc:mga0qj67_101628_c1
888 nmdc:mga0qj67_23511_c1
889 nmdc:mga0qj67_29222_c1
890 nmdc:mga0qj67_2922_c1
891 nmdc:mga0qj67_54054_c1
892 nmdc:mga0qj67_70280_c1
893 nmdc:mga06r32_133774_c1
894 nmdc:mga06r32_157066_c1
895 nmdc:mga06r32_19344_c1
896 nmdc:mga06r32_291882_c1
897 nmdc:mga06r32_34661_c1
898 nmdc:mga08y16_536705_c1
899 nmdc:mga08y16_5382_c1
900 nmdc:mga08y16_583170_c1
901 nmdc:mga08y16_77693_c1
902 nmdc:mga08y16_79758_c1
903 nmdc:mga0n895_151_c1
904 nmdc:mga0n895_8493_c1
905 nmdc:mga0rr50_18966_c1
906 nmdc:mga0rr50_56319_c1
907 nmdc:mga08x19_139749_c1
908 nmdc:mga08x19_150166_c1
909 nmdc:mga08x19_29876_c1
910 nmdc:mga08x19_68200_c1
911 Ga0495601_0002012
912 Ga0495619_0024402
913 Ga0495619_0090629
914 Ga0501084_0023906
915 Ga0501084_0082600
916 Ga0501084_0089179
917 Ga0501082_0004974
918 Ga0501082_0011950
919 Ga0501082_0296738
920 Ga0530510_0000956
921 Ga0530510_0053854
922 2574431009
923 2891634054
924 639786198

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

35

358

0.95

PF00266

Aminotran_5

Aminotransferase class-V

72

247

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ly1-assembly1.cif.gz_B crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution 0.9376 39 363
1lc7-assembly1.cif.gz_A crystal structure of l-threonine-o-3-phosphate decarboxylase from s. enterica complexed with a substrate 0.9195 19 363
3ffh-assembly1.cif.gz_A the crystal structure of histidinol-phosphate aminotransferase from listeria innocua clip11262. 0.9169 15 365
4wbt-assembly2.cif.gz_B-3 crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate 0.9135 13 368
3ftb-assembly2.cif.gz_E the crystal structure of the histidinol-phosphate aminotransferase from clostridium acetobutylicum 0.9123 39 368
ID Description Score Start End Superfamily
af_Q2G087_68_261_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9749 78 269 3.40.640.10
4r5zC02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9666 53 274 3.40.640.10
3ffhA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9611 76 274 3.40.640.10
af_Q2G087_68_261_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9601 78 269 3.40.640.10
af_P9WML5_24_353_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9535 40 369 3.50.50.60
ID Description Score Start End GO Terms
AF-F1VZB7-F1-model_v4 Putative histidinol-phosphate aminotransferase protein 0.9772 193 367 GO:0008483
GO:0009058
GO:0030170
AF-A0A382NAJ8-F1-model_v4 Aminotransferase class I/classII large domain-containing protein 0.9771 114 365 GO:0008483
GO:0009058
GO:0030170
AF-A0A7V1K5B9-F1-model_v4 deleted 0.9743 114 369
AF-A0A1Q7RDV9-F1-model_v4 Histidinol-phosphate transaminase 0.974 53 368 GO:0000105
GO:0004400
GO:0030170
AF-A0A6M0K5Q0-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9726 39 363 GO:0008483
GO:0009058
GO:0030170

Map