F448939

General Info

Members Datasets Scaffolds Average Seq Length
462 270 924 90

Family's Representative Sequence

Representative Sequence 3300031728|Ga0316578_10205360|Ga0316578_102053602
Length 111
Sequence MTDPSVALLTDATIAAEAVTGPILAGALGIGFLLVSAALLMSLARLVIGPDKPDRILALDTLYVNTVALLVLLGIHLSNDLFFEAALLIALIGFIGTVALAKFLTRGDIIE

Samples

Sample ID Description Type Environment
1 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003405 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM Metagenome Rhizosphere
5 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
104 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
178 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
179 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
182 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
183 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
184 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
190 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
191 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
192 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
193 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
194 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
200 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
201 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
202 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
203 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
204 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
205 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
206 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
207 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
208 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
209 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
210 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
211 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
212 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
213 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
214 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
215 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
216 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
217 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
218 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
219 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
220 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
221 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
222 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
223 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
224 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
225 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
226 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
229 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
243 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
254 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
255 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
256 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
257 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
258 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
269 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
270 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.97
Metatranscriptomes 3.03
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.25
Rhizosphere 96.54
Stem 0
Stem Tuber 0
Unclassified 1.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316578_10205360 3300031728 Bacteria 1186
2 JGI24034J26672_10068129 3300002239 Bacteria 634
3 JGI24742J22300_10118869 3300002244 Bacteria 521
4 JGI26132J50249_104774 3300003405 Bacteria 512
5 JGI26141J51220_1011613 3300003503 Bacteria 583
6 Ga0065704_10164877 3300005289 Bacteria 1329
7 Ga0070676_10000774 3300005328 Bacteria 15756
8 Ga0070676_10001175 3300005328 Bacteria 13119
9 Ga0070683_100054794 3300005329 Bacteria 3698
10 Ga0070690_100046925 3300005330 Bacteria 2747
11 Ga0070670_100026878 3300005331 Bacteria 4950
12 Ga0070670_100036317 3300005331 Bacteria 4240
13 Ga0070677_10444375 3300005333 Bacteria 692
14 Ga0068869_100003142 3300005334 Bacteria 10073
15 Ga0068869_100004518 3300005334 Bacteria 8655
16 Ga0070666_10000716 3300005335 Bacteria 20098
17 Ga0070680_100030043 3300005336 Bacteria 4364
18 Ga0070682_100006507 3300005337 Bacteria 6557
19 Ga0068868_100015154 3300005338 Bacteria 5695
20 Ga0068868_100076397 3300005338 Bacteria 2678
21 Ga0070660_100003613 3300005339 Bacteria 10688
22 Ga0070689_100107834 3300005340 Bacteria 2212
23 Ga0070689_100506128 3300005340 Bacteria 1035
24 Ga0070691_10083633 3300005341 Bacteria 1566
25 Ga0070661_100003491 3300005344 Bacteria 10822
26 Ga0070668_100001323 3300005347 Bacteria 17744
27 Ga0070669_100001499 3300005353 Bacteria 16886
28 Ga0070669_100009363 3300005353 Bacteria 6978
29 Ga0070675_100003394 3300005354 Bacteria 12063
30 Ga0070675_100125437 3300005354 Bacteria 2184
31 Ga0070671_100008745 3300005355 Bacteria 8123
32 Ga0070671_100171937 3300005355 Bacteria 1833
33 Ga0070674_100024859 3300005356 Bacteria 3891
34 Ga0070673_100001645 3300005364 Bacteria 13242
35 Ga0070688_100024809 3300005365 Bacteria 3543
36 Ga0070688_101017671 3300005365 Bacteria 659
37 Ga0070659_100011644 3300005366 Bacteria 6508
38 Ga0070667_100001885 3300005367 Bacteria 18604
39 Ga0070667_100047541 3300005367 Bacteria 3610
40 Ga0070703_10008355 3300005406 Bacteria 2910
41 Ga0070701_10019598 3300005438 Bacteria 3197
42 Ga0070705_100015847 3300005440 Bacteria 3903
43 Ga0070700_100120228 3300005441 Bacteria 1759
44 Ga0070694_100078319 3300005444 Bacteria 2292
45 Ga0070708_100000735 3300005445 Bacteria 24829
46 Ga0070708_100591724 3300005445 Bacteria 1046
47 Ga0070663_100018630 3300005455 Bacteria 4556
48 Ga0070678_100001250 3300005456 Bacteria 13457
49 Ga0070662_101372432 3300005457 Bacteria 609
50 Ga0070681_10025228 3300005458 Bacteria 5979
51 Ga0070681_10590122 3300005458 Bacteria 1025
52 Ga0068867_100013240 3300005459 Bacteria 5842
53 Ga0070685_10053447 3300005466 Bacteria 2340
54 Ga0070707_101865562 3300005468 Bacteria 568
55 Ga0070679_100001879 3300005530 Bacteria 18896
56 Ga0068853_100011113 3300005539 Bacteria 7303
57 Ga0068853_100315486 3300005539 Bacteria 1448
58 Ga0068853_100341055 3300005539 Bacteria 1392
59 Ga0070672_100001970 3300005543 Bacteria 12859
60 Ga0070672_100248023 3300005543 Bacteria 1499
61 Ga0070686_101562126 3300005544 Bacteria 557
62 Ga0070695_100012223 3300005545 Bacteria 5149
63 Ga0070696_100018398 3300005546 Bacteria 4721
64 Ga0070693_100202346 3300005547 Bacteria 1290
65 Ga0070665_100009908 3300005548 Bacteria 9637
66 Ga0070704_100001689 3300005549 Bacteria 12011
67 Ga0070704_101194675 3300005549 Bacteria 693
68 Ga0068855_100011388 3300005563 Bacteria 10740
69 Ga0070664_100036940 3300005564 Bacteria 4105
70 Ga0068857_100197024 3300005577 Bacteria 1835
71 Ga0068854_100002332 3300005578 Bacteria 11706
72 Ga0068856_100154544 3300005614 Bacteria 2304
73 Ga0070702_100236596 3300005615 Bacteria 1230
74 Ga0068852_100436931 3300005616 Bacteria 1293
75 Ga0068859_100006568 3300005617 Bacteria 11803
76 Ga0068859_100007175 3300005617 Bacteria 11313
77 Ga0068864_100006114 3300005618 Bacteria 9876
78 Ga0068864_100025840 3300005618 Bacteria 4948
79 Ga0068866_10566168 3300005718 Bacteria 762
80 Ga0068866_10710406 3300005718 Bacteria 690
81 Ga0068861_100006024 3300005719 Bacteria 8244
82 Ga0068861_100025326 3300005719 Bacteria 4302
83 Ga0068870_10003489 3300005840 Bacteria 6669
84 Ga0068870_10254225 3300005840 Bacteria 1090
85 Ga0068863_100002793 3300005841 Bacteria 17293
86 Ga0068863_100029243 3300005841 Bacteria 5260
87 Ga0068858_100005140 3300005842 Bacteria 12823
88 Ga0068858_100016786 3300005842 Bacteria 6874
89 Ga0068860_100005023 3300005843 Bacteria 13463
90 Ga0068860_100007534 3300005843 Bacteria 10888
91 Ga0068862_100009111 3300005844 Bacteria 8217
92 Ga0070716_100895512 3300006173 Bacteria 694
93 Ga0097621_100001779 3300006237 Bacteria 14785
94 Ga0068871_100003595 3300006358 Bacteria 10651
95 Ga0075428_100478377 3300006844 Bacteria 1333
96 Ga0075431_100463165 3300006847 Bacteria 1262
97 Ga0075431_100650680 3300006847 Unclassified 1034
98 Ga0075433_10007076 3300006852 Bacteria 8881
99 Ga0075434_100041765 3300006871 Bacteria 4544
100 Ga0075429_100425903 3300006880 Bacteria 1162
101 Ga0068865_100001873 3300006881 Bacteria 12369
102 Ga0097620_100006568 3300006931 Bacteria 11803
103 Ga0097620_100007175 3300006931 Bacteria 11313
104 Ga0105244_10008784 3300009036 Bacteria 6274
105 Ga0105250_10551260 3300009092 Bacteria 529
106 Ga0105240_10260136 3300009093 Bacteria 2002
107 Ga0105245_10041799 3300009098 Bacteria 4087
108 Ga0114129_11180619 3300009147 Bacteria 954
109 Ga0105243_10498303 3300009148 Bacteria 1153
110 Ga0105243_11213910 3300009148 Bacteria 768
111 Ga0105241_10009352 3300009174 Bacteria 7203
112 Ga0105248_10018359 3300009177 Bacteria 7726
113 Ga0105237_10052739 3300009545 Bacteria 4081
114 Ga0105249_10459918 3300009553 Bacteria 1312
115 Ga0105246_12099753 3300011119 Bacteria 547
116 Ga0157373_10020097 3300013100 Bacteria 4858
117 Ga0157373_10069426 3300013100 Bacteria 2491
118 Ga0157373_10372844 3300013100 Bacteria 1020
119 Ga0157371_10011030 3300013102 Bacteria 7001
120 Ga0157371_10040071 3300013102 Bacteria 3348
121 Ga0157371_10079814 3300013102 Bacteria 2317
122 Ga0157371_10338413 3300013102 Bacteria 1094
123 Ga0157370_10127411 3300013104 Bacteria 2376
124 Ga0157369_10001875 3300013105 Bacteria 25352
125 Ga0157369_10005244 3300013105 Bacteria 15117
126 Ga0157374_10003539 3300013296 Bacteria 13142
127 Ga0157378_10056099 3300013297 Bacteria 3509
128 Ga0157378_10244106 3300013297 Bacteria 1717
129 Ga0163162_10054335 3300013306 Bacteria 4029
130 Ga0157372_10003171 3300013307 Bacteria 17732
131 Ga0157372_10212337 3300013307 Bacteria 2243
132 Ga0157372_10389706 3300013307 Bacteria 1623
133 Ga0157375_10006411 3300013308 Bacteria 10256
134 Ga0163163_10096096 3300014325 Bacteria 2983
135 Ga0163163_10202503 3300014325 Bacteria 2033
136 Ga0157380_10243505 3300014326 Bacteria 1623
137 Ga0157380_10734070 3300014326 Bacteria 997
138 Ga0157377_10128870 3300014745 Bacteria 1543
139 Ga0157379_10004073 3300014968 Bacteria 12470
140 Ga0157376_10003562 3300014969 Bacteria 10737
141 Ga0182006_1142703 3300015261 Bacteria 817
142 Ga0182007_10008129 3300015262 Bacteria 4330
143 Ga0163161_10223478 3300017792 Unclassified 1459
144 Ga0207697_10028171 3300025315 Bacteria 2298
145 Ga0207697_10240665 3300025315 Bacteria 800
146 Ga0207713_1005333 3300025735 Bacteria 8074
147 Ga0207653_10002179 3300025885 Bacteria 6234
148 Ga0207642_10906431 3300025899 Bacteria 565
149 Ga0207688_10009535 3300025901 Bacteria 5285
150 Ga0207680_10044818 3300025903 Bacteria 2604
151 Ga0207680_10395679 3300025903 Bacteria 976
152 Ga0207647_10028049 3300025904 Bacteria 3663
153 Ga0207645_10000812 3300025907 Bacteria 26130
154 Ga0207645_10002937 3300025907 Bacteria 13175
155 Ga0207643_10000722 3300025908 Bacteria 20289
156 Ga0207654_10061354 3300025911 Bacteria 2200
157 Ga0207707_10002355 3300025912 Bacteria 17022
158 Ga0207695_10204409 3300025913 Bacteria 1888
159 Ga0207660_10014617 3300025917 Bacteria 5167
160 Ga0207662_10059424 3300025918 Bacteria 2291
161 Ga0207657_10000385 3300025919 Bacteria 46501
162 Ga0207649_10015334 3300025920 Bacteria 4307
163 Ga0207652_10016056 3300025921 Bacteria 6105
164 Ga0207646_11749377 3300025922 Bacteria 533
165 Ga0207681_10002868 3300025923 Bacteria 10891
166 Ga0207650_10034483 3300025925 Bacteria 3670
167 Ga0207650_10072929 3300025925 Bacteria 2585
168 Ga0207659_10002225 3300025926 Bacteria 11551
169 Ga0207659_10452460 3300025926 Bacteria 1082
170 Ga0207687_11282719 3300025927 Bacteria 630
171 Ga0207644_10006005 3300025931 Bacteria 7915
172 Ga0207644_10525031 3300025931 Bacteria 978
173 Ga0207706_10003911 3300025933 Bacteria 14137
174 Ga0207706_10506718 3300025933 Bacteria 1041
175 Ga0207709_10743267 3300025935 Bacteria 788
176 Ga0207709_11053032 3300025935 Bacteria 667
177 Ga0207670_10084284 3300025936 Bacteria 2231
178 Ga0207670_10622446 3300025936 Bacteria 888
179 Ga0207669_10014819 3300025937 Bacteria 3917
180 Ga0207704_10003782 3300025938 Bacteria 6892
181 Ga0207691_10000041 3300025940 Bacteria 106275
182 Ga0207691_10260034 3300025940 Bacteria 1496
183 Ga0207711_10054791 3300025941 Bacteria 3423
184 Ga0207689_10000204 3300025942 Bacteria 52389
185 Ga0207689_10030654 3300025942 Bacteria 4481
186 Ga0207661_10411109 3300025944 Bacteria 1228
187 Ga0207679_10035706 3300025945 Bacteria 3519
188 Ga0207667_10007006 3300025949 Bacteria 13616
189 Ga0207651_10029214 3300025960 Bacteria 3490
190 Ga0207712_10291253 3300025961 Bacteria 1336
191 Ga0207668_10010094 3300025972 Bacteria 5689
192 Ga0207668_10821323 3300025972 Bacteria 824
193 Ga0207640_10066771 3300025981 Bacteria 2404
194 Ga0207658_10004908 3300025986 Bacteria 9226
195 Ga0207658_10263507 3300025986 Bacteria 1470
196 Ga0207677_10006748 3300026023 Bacteria 6304
197 Ga0207677_10056106 3300026023 Bacteria 2697
198 Ga0207703_10004130 3300026035 Bacteria 11981
199 Ga0207639_10011721 3300026041 Bacteria 6096
200 Ga0207639_10372952 3300026041 Bacteria 1280
201 Ga0207678_10041350 3300026067 Bacteria 3997
202 Ga0207708_10236409 3300026075 Bacteria 1468
203 Ga0207702_10033285 3300026078 Bacteria 4305
204 Ga0207641_10001249 3300026088 Bacteria 25369
205 Ga0207648_10001461 3300026089 Bacteria 25990
206 Ga0207648_10004390 3300026089 Bacteria 14500
207 Ga0207676_10005257 3300026095 Bacteria 9163
208 Ga0207676_10017371 3300026095 Bacteria 5213
209 Ga0207674_10001950 3300026116 Bacteria 26184
210 Ga0207675_100005135 3300026118 Bacteria 12603
211 Ga0207675_100008371 3300026118 Bacteria 9748
212 Ga0207683_10000011 3300026121 Bacteria 140261
213 Ga0209371_1000135 3300027312 Bacteria 121718
214 Ga0209969_1009261 3300027360 Bacteria 1401
215 Ga0209981_1046028 3300027378 Bacteria 656
216 Ga0209996_1000510 3300027395 Bacteria 4668
217 Ga0209984_1001665 3300027424 Bacteria 2424
218 Ga0210000_1053272 3300027462 Bacteria 651
219 Ga0209995_1053270 3300027471 Bacteria 687
220 Ga0209968_1067782 3300027526 Bacteria 634
221 Ga0209999_1034324 3300027543 Bacteria 944
222 Ga0209982_1090629 3300027552 Bacteria 507
223 Ga0209970_1064884 3300027614 Bacteria 673
224 Ga0210002_1006419 3300027617 Bacteria 1774
225 Ga0209983_1002354 3300027665 Bacteria 4148
226 Ga0209971_1004302 3300027682 Bacteria 3380
227 Ga0209971_1192739 3300027682 Bacteria 502
228 Ga0209974_10016365 3300027876 Bacteria 2463
229 Ga0268266_10009550 3300028379 Bacteria 8536
230 Ga0268265_10133019 3300028380 Bacteria 2070
231 Ga0268264_10011762 3300028381 Bacteria 7216
232 Ga0268264_10037926 3300028381 Bacteria 3975
233 Ga0268256_1000148 3300030500 Bacteria 94347
234 Ga0307408_100000005 3300031548 Bacteria 529098
235 Ga0307408_100954931 3300031548 Bacteria 788
236 Ga0316579_10006926 3300031691 Bacteria 4653
237 Ga0316579_10182880 3300031691 Bacteria 1013
238 Ga0316579_10221246 3300031691 Bacteria 916
239 Ga0316579_10485042 3300031691 Bacteria 598
240 Ga0316576_10000526 3300031727 Bacteria 17908
241 Ga0316576_10025645 3300031727 Bacteria 4130
242 Ga0316576_10052640 3300031727 Bacteria 2964
243 Ga0316576_10054830 3300031727 Bacteria 2907
244 Ga0316576_10077273 3300031727 Bacteria 2465
245 Ga0316576_10130658 3300031727 Bacteria 1889
246 Ga0316576_10145946 3300031727 Bacteria 1782
247 Ga0316576_10164301 3300031727 Bacteria 1675
248 Ga0316576_10261132 3300031727 Bacteria 1299
249 Ga0316576_10496834 3300031727 Bacteria 897
250 Ga0316576_10804794 3300031727 Unclassified 676
251 Ga0316576_10869668 3300031727 Bacteria 646
252 Ga0316578_10007930 3300031728 Bacteria 5365
253 Ga0316578_10008122 3300031728 Bacteria 5316
254 Ga0316578_10012798 3300031728 Bacteria 4430
255 Ga0316578_10029330 3300031728 Bacteria 3122
256 Ga0316578_10043372 3300031728 Bacteria 2612
257 Ga0316578_10047387 3300031728 Bacteria 2507
258 Ga0316578_10054639 3300031728 Bacteria 2343
259 Ga0316578_10066182 3300031728 Bacteria 2134
260 Ga0316578_10130558 3300031728 Bacteria 1512
261 Ga0316578_10139890 3300031728 Bacteria 1457
262 Ga0316578_10156880 3300031728 Bacteria 1371
263 Ga0316578_10194416 3300031728 Bacteria 1222
264 Ga0316578_10230852 3300031728 Bacteria 1111
265 Ga0316578_10276289 3300031728 Bacteria 1006
266 Ga0316577_10015253 3300031733 Bacteria 4226
267 Ga0316577_10015859 3300031733 Bacteria 4147
268 Ga0316577_10023832 3300031733 Bacteria 3398
269 Ga0316577_10123391 3300031733 Bacteria 1456
270 Ga0316577_10311833 3300031733 Bacteria 892
271 Ga0316577_10347275 3300031733 Bacteria 842
272 Ga0316577_10397618 3300031733 Bacteria 783
273 Ga0316577_10421352 3300031733 Bacteria 758
274 Ga0316577_10655854 3300031733 Bacteria 596
275 Ga0316577_10709813 3300031733 Bacteria 571
276 Ga0316577_10724964 3300031733 Bacteria 564
277 Ga0307406_10000700 3300031901 Bacteria 18926
278 Ga0307406_10601568 3300031901 Bacteria 907
279 Ga0316583_10004764 3300032133 Bacteria 4849
280 Ga0316583_10060104 3300032133 Bacteria 1332
281 Ga0316583_10119462 3300032133 Bacteria 919
282 Ga0316583_10296583 3300032133 Unclassified 559
283 Ga0316585_10005021 3300032137 Bacteria 3720
284 Ga0316585_10065243 3300032137 Bacteria 1179
285 Ga0316585_10083287 3300032137 Bacteria 1043
286 Ga0316585_10093495 3300032137 Bacteria 984
287 Ga0316585_10105099 3300032137 Bacteria 927
288 Ga0316580_10004071 3300032139 Bacteria 4213
289 Ga0316580_10010047 3300032139 Bacteria 2851
290 Ga0316580_10013867 3300032139 Bacteria 2456
291 Ga0316580_10018053 3300032139 Bacteria 2170
292 Ga0316580_10022901 3300032139 Bacteria 1928
293 Ga0316580_10054900 3300032139 Bacteria 1225
294 Ga0316580_10060526 3300032139 Bacteria 1163
295 Ga0316580_10067492 3300032139 Bacteria 1096
296 Ga0316580_10092838 3300032139 Bacteria 924
297 Ga0316580_10173072 3300032139 Bacteria 663
298 Ga0316593_10019682 3300032168 Bacteria 2089
299 Ga0316593_10026378 3300032168 Bacteria 1857
300 Ga0316593_10061858 3300032168 Bacteria 1281
301 Ga0316593_10078007 3300032168 Bacteria 1153
302 Ga0316592_1004112 3300033524 Bacteria 2681
303 Ga0316592_1123290 3300033524 Bacteria 602
304 Ga0316588_1017143 3300033528 Bacteria 1612
305 Ga0316588_1181053 3300033528 Bacteria 547
306 Ga0316587_1015201 3300033529 Bacteria 1276
307 Ga0316596_1000810 3300033541 Bacteria 5790
308 Ga0316596_1006474 3300033541 Bacteria 2725
309 Ga0316596_1019803 3300033541 Bacteria 1709
310 Ga0316596_1145304 3300033541 Bacteria 650
311 Ga0316596_1196606 3300033541 Unclassified 560
312 Ga0373930_0052665 3300034816 Bacteria 892
313 Ga0373948_0100055 3300034817 Bacteria 682
314 Ga0373958_0028645 3300034819 Bacteria 1079
315 Ga0373959_0040166 3300034820 Bacteria 979
316 Ga0373949_0005972 3300035090 Bacteria 2704
317 Ga0373951_0006144 3300035091 Bacteria 2757
318 Ga0373960_0015681 3300035121 Bacteria 1938
319 Ga0316574_0015612 3300035398 Bacteria 4408
320 Ga0316574_0070958 3300035398 Bacteria 2199
321 Ga0316574_0269787 3300035398 Bacteria 1085
322 Ga0316574_0279312 3300035398 Bacteria 1064
323 Ga0316574_0313237 3300035398 Bacteria 997
324 Ga0316574_0324412 3300035398 Bacteria 977
325 Ga0316574_0464367 3300035398 Bacteria 792
326 Ga0316574_0508626 3300035398 Bacteria 750
327 Ga0316574_0587098 3300035398 Bacteria 689
328 Ga0316574_0870927 3300035398 Unclassified 546
329 Ga0373931_0262611 3300035691 Unclassified 1054
330 Ga0373931_0352674 3300035691 Bacteria 921
331 Ga0373937_0281135 3300036401 Bacteria 1572
332 Ga0316582_0020796 3300036647 Bacteria 3866
333 Ga0316582_0042852 3300036647 Bacteria 2837
334 Ga0316582_0112500 3300036647 Bacteria 1814
335 Ga0316582_0141652 3300036647 Bacteria 1621
336 Ga0316582_0203050 3300036647 Bacteria 1352
337 Ga0316582_0266253 3300036647 Bacteria 1175
338 Ga0316582_0594890 3300036647 Bacteria 761
339 Ga0316582_0932133 3300036647 Bacteria 594
340 Ga0316584_0004497 3300036712 Bacteria 9230
341 Ga0316584_0009304 3300036712 Bacteria 6815
342 Ga0316584_0009994 3300036712 Bacteria 6612
343 Ga0316584_0014968 3300036712 Bacteria 5539
344 Ga0316584_0020077 3300036712 Bacteria 4839
345 Ga0316584_0030384 3300036712 Bacteria 3990
346 Ga0316584_0048007 3300036712 Bacteria 3189
347 Ga0316584_0061957 3300036712 Bacteria 2802
348 Ga0316584_0066820 3300036712 Bacteria 2694
349 Ga0316584_0075823 3300036712 Bacteria 2520
350 Ga0316584_0182628 3300036712 Bacteria 1553
351 Ga0316584_0329937 3300036712 Bacteria 1099
352 Ga0316581_0038722 3300037588 Bacteria 1450
353 Ga0316581_0068440 3300037588 Bacteria 1090
354 Ga0439436_0000830 3300041404 Bacteria 8413
355 Ga0439438_004091 3300041405 Bacteria 5704
356 Ga0439447_013306 3300041407 Bacteria 2338
357 Ga0439466_0002812 3300041411 Bacteria 6816
358 Ga0439466_0005862 3300041411 Bacteria 4680
359 Ga0451795_0567030 3300041456 Bacteria 698
360 Ga0451802_0735241 3300041460 Bacteria 672
361 Ga0451807_0147622 3300041486 Bacteria 510
362 Ga0439431_0013990 3300041997 Bacteria 1856
363 Ga0439431_0030818 3300041997 Bacteria 1330
364 Ga0439448_0006423 3300042005 Bacteria 3380
365 Ga0439432_000779 3300042006 Bacteria 11955
366 Ga0439456_032414 3300042013 Bacteria 1122
367 Ga0450911_000002 3300042115 Bacteria 277703
368 Ga0450913_002648 3300042117 Bacteria 1117
369 Ga0450914_051973 3300042118 Bacteria 541
370 Ga0450917_002513 3300042120 Bacteria 1312
371 Ga0450923_000487 3300042125 Bacteria 4372
372 Ga0450892_017721 3300042130 Bacteria 679
373 Ga0450904_000036 3300042139 Bacteria 30421
374 Ga0450889_006048 3300042144 Bacteria 1212
375 Ga0439446_0007073 3300042156 Bacteria 2940
376 Ga0439446_0014280 3300042156 Bacteria 2190
377 Ga0439446_0223398 3300042156 Bacteria 642
378 Ga0450909_083248 3300042185 Bacteria 519
379 Ga0439459_0027725 3300042438 Bacteria 1132
380 Ga0439464_0003612 3300042439 Bacteria 3920
381 Ga0450893_0001318 3300042532 Bacteria 3766
382 Ga0450893_0013164 3300042532 Bacteria 1377
383 Ga0451577_0017761 3300042876 Bacteria 6563
384 Ga0451577_0018905 3300042876 Bacteria 6343
385 Ga0451577_0020696 3300042876 Bacteria 6033
386 Ga0451577_0029460 3300042876 Bacteria 4962
387 Ga0451577_0220398 3300042876 Bacteria 1715
388 Ga0451577_0775379 3300042876 Bacteria 867
389 Ga0451577_1295757 3300042876 Bacteria 648
390 Ga0453684_0329672 3300044712 Bacteria 1726
391 Ga0453684_0375996 3300044712 Bacteria 1596
392 Ga0453684_0991192 3300044712 Bacteria 894
393 Ga0453684_1047869 3300044712 Bacteria 865
394 Ga0453684_1670318 3300044712 Bacteria 651
395 Ga0453684_1753045 3300044712 Bacteria 633
396 Ga0453684_1973335 3300044712 Bacteria 588
397 Ga0466971_0700988 3300044719 Bacteria 509
398 Ga0466957_1038814 3300044842 Bacteria 589
399 Ga0451576_0002027 3300045051 Bacteria 31971
400 Ga0451576_0009363 3300045051 Bacteria 11360
401 Ga0451576_0035370 3300045051 Bacteria 5300
402 Ga0451576_0487669 3300045051 Bacteria 1295
403 Ga0451576_0620389 3300045051 Bacteria 1136
404 Ga0451576_0792212 3300045051 Bacteria 995
405 Ga0451576_1921852 3300045051 Bacteria 610
406 Ga0466967_0021359 3300045976 Bacteria 5256
407 Ga0496101_0101511 3300048904 Bacteria 2154
408 Ga0496101_0951329 3300048904 Bacteria 676
409 Ga0496102_0123913 3300048905 Bacteria 2415
410 Ga0496104_0081017 3300048907 Bacteria 3095
411 Ga0496106_0379840 3300048909 Bacteria 1135
412 Ga0496107_0174147 3300048910 Bacteria 1597
413 Ga0496108_1431538 3300048911 Bacteria 577
414 Ga0496109_0273765 3300048912 Bacteria 1591
415 Ga0496109_1051622 3300048912 Bacteria 751
416 Ga0496110_0091463 3300048913 Bacteria 2722
417 Ga0496113_1079772 3300048916 Bacteria 630
418 Ga0496114_0124939 3300048917 Bacteria 2217
419 Ga0496117_0198713 3300048920 Bacteria 1135
420 Ga0501031_0128128 3300049568 Bacteria 1658
421 Ga0501031_0593471 3300049568 Bacteria 713
422 Ga0501032_0000863 3300049569 Bacteria 24630
423 Ga0501032_0007624 3300049569 Bacteria 7891
424 Ga0501034_0051254 3300049571 Bacteria 4161
425 Ga0501034_0244724 3300049571 Bacteria 1739
426 Ga0501034_0341520 3300049571 Bacteria 1427
427 Ga0501034_0438614 3300049571 Bacteria 1225
428 Ga0501034_0889253 3300049571 Bacteria 779
429 Ga0501038_0057638 3300049574 Bacteria 3334
430 Ga0501038_0860503 3300049574 Bacteria 671
431 Ga0501039_0030902 3300049575 Bacteria 4129
432 Ga0501039_0582805 3300049575 Bacteria 877
433 Ga0501039_0851211 3300049575 Bacteria 711
434 Ga0501040_0452684 3300049576 Bacteria 924
435 Ga0501041_1117660 3300049577 Bacteria 508
436 Ga0501043_0689809 3300049579 Bacteria 747
437 Ga0501047_0208371 3300049581 Bacteria 1814
438 Ga0501047_0275445 3300049581 Bacteria 1528
439 Ga0501048_0755510 3300049582 Bacteria 698
440 Ga0501067_0000127 3300049583 Bacteria 41508
441 Ga0501068_0009147 3300049584 Bacteria 5532
442 Ga0501073_0000006 3300049589 Bacteria 228761
443 Ga0501075_0395989 3300049591 Bacteria 1053
444 Ga0501076_1450874 3300049592 Bacteria 564
445 Ga0501225_0063452 3300049705 Bacteria 1042
446 Ga0501080_0002191 3300049742 Bacteria 16972
447 Ga0501080_0737550 3300049742 Bacteria 867
448 Ga0501080_1797873 3300049742 Bacteria 515
449 Ga0501083_0954645 3300049744 Bacteria 558
450 Ga0501035_0358368 3300049822 Bacteria 1219
451 Ga0501044_0015081 3300049823 Bacteria 8326
452 Ga0501045_0888142 3300049824 Bacteria 655
453 Ga0501045_0975159 3300049824 Bacteria 622
454 Ga0501226_000007 3300049853 Bacteria 227827
455 nmdc:mga0qj67_1574449_c1 3300050509 Bacteria 504
456 nmdc:mga06r32_345585_c1 3300050510 Bacteria 1472
457 nmdc:mga0a205_80220_c1 3300050515 Bacteria 3154
458 Ga0501084_0642191 3300054114 Bacteria 896
459 Ga0501084_1241533 3300054114 Bacteria 625
460 Ga0590074_012583 3300059423 Bacteria 1424
461 Ga0501082_0148347 3300060353 Bacteria 2037
462 Ga0501082_1625332 3300060353 Bacteria 564
463 Ga0316578_10205360
464 JGI24034J26672_10068129
465 JGI24742J22300_10118869
466 JGI26132J50249_104774
467 JGI26141J51220_1011613
468 Ga0065704_10164877
469 Ga0070676_10000774
470 Ga0070676_10001175
471 Ga0070683_100054794
472 Ga0070690_100046925
473 Ga0070670_100026878
474 Ga0070670_100036317
475 Ga0070677_10444375
476 Ga0068869_100003142
477 Ga0068869_100004518
478 Ga0070666_10000716
479 Ga0070680_100030043
480 Ga0070682_100006507
481 Ga0068868_100015154
482 Ga0068868_100076397
483 Ga0070660_100003613
484 Ga0070689_100107834
485 Ga0070689_100506128
486 Ga0070691_10083633
487 Ga0070661_100003491
488 Ga0070668_100001323
489 Ga0070669_100001499
490 Ga0070669_100009363
491 Ga0070675_100003394
492 Ga0070675_100125437
493 Ga0070671_100008745
494 Ga0070671_100171937
495 Ga0070674_100024859
496 Ga0070673_100001645
497 Ga0070688_100024809
498 Ga0070688_101017671
499 Ga0070659_100011644
500 Ga0070667_100001885
501 Ga0070667_100047541
502 Ga0070703_10008355
503 Ga0070701_10019598
504 Ga0070705_100015847
505 Ga0070700_100120228
506 Ga0070694_100078319
507 Ga0070708_100000735
508 Ga0070708_100591724
509 Ga0070663_100018630
510 Ga0070678_100001250
511 Ga0070662_101372432
512 Ga0070681_10025228
513 Ga0070681_10590122
514 Ga0068867_100013240
515 Ga0070685_10053447
516 Ga0070707_101865562
517 Ga0070679_100001879
518 Ga0068853_100011113
519 Ga0068853_100315486
520 Ga0068853_100341055
521 Ga0070672_100001970
522 Ga0070672_100248023
523 Ga0070686_101562126
524 Ga0070695_100012223
525 Ga0070696_100018398
526 Ga0070693_100202346
527 Ga0070665_100009908
528 Ga0070704_100001689
529 Ga0070704_101194675
530 Ga0068855_100011388
531 Ga0070664_100036940
532 Ga0068857_100197024
533 Ga0068854_100002332
534 Ga0068856_100154544
535 Ga0070702_100236596
536 Ga0068852_100436931
537 Ga0068859_100006568
538 Ga0068859_100007175
539 Ga0068864_100006114
540 Ga0068864_100025840
541 Ga0068866_10566168
542 Ga0068866_10710406
543 Ga0068861_100006024
544 Ga0068861_100025326
545 Ga0068870_10003489
546 Ga0068870_10254225
547 Ga0068863_100002793
548 Ga0068863_100029243
549 Ga0068858_100005140
550 Ga0068858_100016786
551 Ga0068860_100005023
552 Ga0068860_100007534
553 Ga0068862_100009111
554 Ga0070716_100895512
555 Ga0097621_100001779
556 Ga0068871_100003595
557 Ga0075428_100478377
558 Ga0075431_100463165
559 Ga0075431_100650680
560 Ga0075433_10007076
561 Ga0075434_100041765
562 Ga0075429_100425903
563 Ga0068865_100001873
564 Ga0097620_100006568
565 Ga0097620_100007175
566 Ga0105244_10008784
567 Ga0105250_10551260
568 Ga0105240_10260136
569 Ga0105245_10041799
570 Ga0114129_11180619
571 Ga0105243_10498303
572 Ga0105243_11213910
573 Ga0105241_10009352
574 Ga0105248_10018359
575 Ga0105237_10052739
576 Ga0105249_10459918
577 Ga0105246_12099753
578 Ga0157373_10020097
579 Ga0157373_10069426
580 Ga0157373_10372844
581 Ga0157371_10011030
582 Ga0157371_10040071
583 Ga0157371_10079814
584 Ga0157371_10338413
585 Ga0157370_10127411
586 Ga0157369_10001875
587 Ga0157369_10005244
588 Ga0157374_10003539
589 Ga0157378_10056099
590 Ga0157378_10244106
591 Ga0163162_10054335
592 Ga0157372_10003171
593 Ga0157372_10212337
594 Ga0157372_10389706
595 Ga0157375_10006411
596 Ga0163163_10096096
597 Ga0163163_10202503
598 Ga0157380_10243505
599 Ga0157380_10734070
600 Ga0157377_10128870
601 Ga0157379_10004073
602 Ga0157376_10003562
603 Ga0182006_1142703
604 Ga0182007_10008129
605 Ga0163161_10223478
606 Ga0207697_10028171
607 Ga0207697_10240665
608 Ga0207713_1005333
609 Ga0207653_10002179
610 Ga0207642_10906431
611 Ga0207688_10009535
612 Ga0207680_10044818
613 Ga0207680_10395679
614 Ga0207647_10028049
615 Ga0207645_10000812
616 Ga0207645_10002937
617 Ga0207643_10000722
618 Ga0207654_10061354
619 Ga0207707_10002355
620 Ga0207695_10204409
621 Ga0207660_10014617
622 Ga0207662_10059424
623 Ga0207657_10000385
624 Ga0207649_10015334
625 Ga0207652_10016056
626 Ga0207646_11749377
627 Ga0207681_10002868
628 Ga0207650_10034483
629 Ga0207650_10072929
630 Ga0207659_10002225
631 Ga0207659_10452460
632 Ga0207687_11282719
633 Ga0207644_10006005
634 Ga0207644_10525031
635 Ga0207706_10003911
636 Ga0207706_10506718
637 Ga0207709_10743267
638 Ga0207709_11053032
639 Ga0207670_10084284
640 Ga0207670_10622446
641 Ga0207669_10014819
642 Ga0207704_10003782
643 Ga0207691_10000041
644 Ga0207691_10260034
645 Ga0207711_10054791
646 Ga0207689_10000204
647 Ga0207689_10030654
648 Ga0207661_10411109
649 Ga0207679_10035706
650 Ga0207667_10007006
651 Ga0207651_10029214
652 Ga0207712_10291253
653 Ga0207668_10010094
654 Ga0207668_10821323
655 Ga0207640_10066771
656 Ga0207658_10004908
657 Ga0207658_10263507
658 Ga0207677_10006748
659 Ga0207677_10056106
660 Ga0207703_10004130
661 Ga0207639_10011721
662 Ga0207639_10372952
663 Ga0207678_10041350
664 Ga0207708_10236409
665 Ga0207702_10033285
666 Ga0207641_10001249
667 Ga0207648_10001461
668 Ga0207648_10004390
669 Ga0207676_10005257
670 Ga0207676_10017371
671 Ga0207674_10001950
672 Ga0207675_100005135
673 Ga0207675_100008371
674 Ga0207683_10000011
675 Ga0209371_1000135
676 Ga0209969_1009261
677 Ga0209981_1046028
678 Ga0209996_1000510
679 Ga0209984_1001665
680 Ga0210000_1053272
681 Ga0209995_1053270
682 Ga0209968_1067782
683 Ga0209999_1034324
684 Ga0209982_1090629
685 Ga0209970_1064884
686 Ga0210002_1006419
687 Ga0209983_1002354
688 Ga0209971_1004302
689 Ga0209971_1192739
690 Ga0209974_10016365
691 Ga0268266_10009550
692 Ga0268265_10133019
693 Ga0268264_10011762
694 Ga0268264_10037926
695 Ga0268256_1000148
696 Ga0307408_100000005
697 Ga0307408_100954931
698 Ga0316579_10006926
699 Ga0316579_10182880
700 Ga0316579_10221246
701 Ga0316579_10485042
702 Ga0316576_10000526
703 Ga0316576_10025645
704 Ga0316576_10052640
705 Ga0316576_10054830
706 Ga0316576_10077273
707 Ga0316576_10130658
708 Ga0316576_10145946
709 Ga0316576_10164301
710 Ga0316576_10261132
711 Ga0316576_10496834
712 Ga0316576_10804794
713 Ga0316576_10869668
714 Ga0316578_10007930
715 Ga0316578_10008122
716 Ga0316578_10012798
717 Ga0316578_10029330
718 Ga0316578_10043372
719 Ga0316578_10047387
720 Ga0316578_10054639
721 Ga0316578_10066182
722 Ga0316578_10130558
723 Ga0316578_10139890
724 Ga0316578_10156880
725 Ga0316578_10194416
726 Ga0316578_10230852
727 Ga0316578_10276289
728 Ga0316577_10015253
729 Ga0316577_10015859
730 Ga0316577_10023832
731 Ga0316577_10123391
732 Ga0316577_10311833
733 Ga0316577_10347275
734 Ga0316577_10397618
735 Ga0316577_10421352
736 Ga0316577_10655854
737 Ga0316577_10709813
738 Ga0316577_10724964
739 Ga0307406_10000700
740 Ga0307406_10601568
741 Ga0316583_10004764
742 Ga0316583_10060104
743 Ga0316583_10119462
744 Ga0316583_10296583
745 Ga0316585_10005021
746 Ga0316585_10065243
747 Ga0316585_10083287
748 Ga0316585_10093495
749 Ga0316585_10105099
750 Ga0316580_10004071
751 Ga0316580_10010047
752 Ga0316580_10013867
753 Ga0316580_10018053
754 Ga0316580_10022901
755 Ga0316580_10054900
756 Ga0316580_10060526
757 Ga0316580_10067492
758 Ga0316580_10092838
759 Ga0316580_10173072
760 Ga0316593_10019682
761 Ga0316593_10026378
762 Ga0316593_10061858
763 Ga0316593_10078007
764 Ga0316592_1004112
765 Ga0316592_1123290
766 Ga0316588_1017143
767 Ga0316588_1181053
768 Ga0316587_1015201
769 Ga0316596_1000810
770 Ga0316596_1006474
771 Ga0316596_1019803
772 Ga0316596_1145304
773 Ga0316596_1196606
774 Ga0373930_0052665
775 Ga0373948_0100055
776 Ga0373958_0028645
777 Ga0373959_0040166
778 Ga0373949_0005972
779 Ga0373951_0006144
780 Ga0373960_0015681
781 Ga0316574_0015612
782 Ga0316574_0070958
783 Ga0316574_0269787
784 Ga0316574_0279312
785 Ga0316574_0313237
786 Ga0316574_0324412
787 Ga0316574_0464367
788 Ga0316574_0508626
789 Ga0316574_0587098
790 Ga0316574_0870927
791 Ga0373931_0262611
792 Ga0373931_0352674
793 Ga0373937_0281135
794 Ga0316582_0020796
795 Ga0316582_0042852
796 Ga0316582_0112500
797 Ga0316582_0141652
798 Ga0316582_0203050
799 Ga0316582_0266253
800 Ga0316582_0594890
801 Ga0316582_0932133
802 Ga0316584_0004497
803 Ga0316584_0009304
804 Ga0316584_0009994
805 Ga0316584_0014968
806 Ga0316584_0020077
807 Ga0316584_0030384
808 Ga0316584_0048007
809 Ga0316584_0061957
810 Ga0316584_0066820
811 Ga0316584_0075823
812 Ga0316584_0182628
813 Ga0316584_0329937
814 Ga0316581_0038722
815 Ga0316581_0068440
816 Ga0439436_0000830
817 Ga0439438_004091
818 Ga0439447_013306
819 Ga0439466_0002812
820 Ga0439466_0005862
821 Ga0451795_0567030
822 Ga0451802_0735241
823 Ga0451807_0147622
824 Ga0439431_0013990
825 Ga0439431_0030818
826 Ga0439448_0006423
827 Ga0439432_000779
828 Ga0439456_032414
829 Ga0450911_000002
830 Ga0450913_002648
831 Ga0450914_051973
832 Ga0450917_002513
833 Ga0450923_000487
834 Ga0450892_017721
835 Ga0450904_000036
836 Ga0450889_006048
837 Ga0439446_0007073
838 Ga0439446_0014280
839 Ga0439446_0223398
840 Ga0450909_083248
841 Ga0439459_0027725
842 Ga0439464_0003612
843 Ga0450893_0001318
844 Ga0450893_0013164
845 Ga0451577_0017761
846 Ga0451577_0018905
847 Ga0451577_0020696
848 Ga0451577_0029460
849 Ga0451577_0220398
850 Ga0451577_0775379
851 Ga0451577_1295757
852 Ga0453684_0329672
853 Ga0453684_0375996
854 Ga0453684_0991192
855 Ga0453684_1047869
856 Ga0453684_1670318
857 Ga0453684_1753045
858 Ga0453684_1973335
859 Ga0466971_0700988
860 Ga0466957_1038814
861 Ga0451576_0002027
862 Ga0451576_0009363
863 Ga0451576_0035370
864 Ga0451576_0487669
865 Ga0451576_0620389
866 Ga0451576_0792212
867 Ga0451576_1921852
868 Ga0466967_0021359
869 Ga0496101_0101511
870 Ga0496101_0951329
871 Ga0496102_0123913
872 Ga0496104_0081017
873 Ga0496106_0379840
874 Ga0496107_0174147
875 Ga0496108_1431538
876 Ga0496109_0273765
877 Ga0496109_1051622
878 Ga0496110_0091463
879 Ga0496113_1079772
880 Ga0496114_0124939
881 Ga0496117_0198713
882 Ga0501031_0128128
883 Ga0501031_0593471
884 Ga0501032_0000863
885 Ga0501032_0007624
886 Ga0501034_0051254
887 Ga0501034_0244724
888 Ga0501034_0341520
889 Ga0501034_0438614
890 Ga0501034_0889253
891 Ga0501038_0057638
892 Ga0501038_0860503
893 Ga0501039_0030902
894 Ga0501039_0582805
895 Ga0501039_0851211
896 Ga0501040_0452684
897 Ga0501041_1117660
898 Ga0501043_0689809
899 Ga0501047_0208371
900 Ga0501047_0275445
901 Ga0501048_0755510
902 Ga0501067_0000127
903 Ga0501068_0009147
904 Ga0501073_0000006
905 Ga0501075_0395989
906 Ga0501076_1450874
907 Ga0501225_0063452
908 Ga0501080_0002191
909 Ga0501080_0737550
910 Ga0501080_1797873
911 Ga0501083_0954645
912 Ga0501035_0358368
913 Ga0501044_0015081
914 Ga0501045_0888142
915 Ga0501045_0975159
916 Ga0501226_000007
917 nmdc:mga0qj67_1574449_c1
918 nmdc:mga06r32_345585_c1
919 nmdc:mga0a205_80220_c1
920 Ga0501084_0642191
921 Ga0501084_1241533
922 Ga0590074_012583
923 Ga0501082_0148347
924 Ga0501082_1625332

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04066

MrpF_PhaF

Multiple resistance and pH regulation protein F (MrpF / PhaF)

53

105

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cj3-assembly1.cif.gz_A crystal structure of the transmembrane domain of salpingoeca rosetta rhodopsin phosphodiesterase 0.921 3 54
7qru-assembly1.cif.gz_F structure of bacillus pseudofirmus mrp antiporter complex, monomer 0.9123 1 88
7n0e-assembly1.cif.gz_B co-complex of the histidine kinase region of rets and the dimerization and histidine phosphotransfer domain of gacs 0.9093 3 54
6z16-assembly1.cif.gz_f structure of the mrp antiporter complex 0.9024 6 89
7qru-assembly1.cif.gz_F structure of bacillus pseudofirmus mrp antiporter complex, monomer 0.8936 1 88
ID Description Score Start End Superfamily
6g72K00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9172 7 84 1.10.287.3510
af_A0A0R0I378_34_190_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8965 6 55 1.20.1260.10
af_P81309_1_82_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8716 9 85 1.10.287.3510
5xtdk00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8335 7 81 1.10.287.3510
af_P03926_3_170_1.20.120.1200 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);NADH-ubiquinone/plastoquinone oxidoreductase chain 6, subunit NuoJ 0.825 10 86 1.20.120.1200
ID Description Score Start End GO Terms
AF-A0A6B1G8P7-F1-model_v4 Cation transporter 0.9897 6 80 GO:0005886
GO:0015385
AF-A0A2A6RLA1-F1-model_v4 Cation transporter 0.9821 4 85 GO:0005886
GO:0015385
AF-A0A6N8WCM8-F1-model_v4 pH regulation protein F 0.9821 6 84 GO:0005886
GO:0015385
AF-A0A3B8UC84-F1-model_v4 Sodium:proton antiporter 0.981 4 80 GO:0005886
GO:0015385
AF-A0A178P621-F1-model_v4 deleted 0.9781 5 89

Map