F448959

General Info

Members Datasets Scaffolds Average Seq Length
462 272 924 559

Family's Representative Sequence

Representative Sequence 3300042010|Ga0439452_000005|Ga0439452_000005_146144_147943
Length 587
Sequence LRCHSNFVHKISESCLTVFAADLYRFSNGYSYGALSMAITIGLDFGSDSVRALAVDCTSGAEIATSVEWYPRWQEGRYCDAPHNQFRHHPRDYIESMEAALKSVLAELSDAQRAEIKGIGVDSTGSTPAPIDAEGRVLALRPEFADNPNAMFVLWKDHTAVEEAEAITRLCHTSGKTDYSRYIGGIYSSEWFWAKILHVTRADSAVAQAAASWIELCDWVPALLSGTTRPEAIRRGRCSAGHKSLWHESWGGLPPAAFFDELDPIINKHLRWPLFTETFTADRPVGTLTAEWAQRLGLPESVVISGGAFDCHMGAVGAGAQPNTLVKVIGTSTCDILIADKQSVGDRAVKGICGQVDGSVVPDFIGLEAGQSAFGDIYAWFGRILGWPLEQLAQQHPELKEQIKASQKQLLPALTDAWVKNPSLDHLPVVLDWFNGRRTPNANQRLKGVITDLNLATDAPALFGGLIAATAFGARAIMECFTEQGIAVDNVMALGGIARKNRGVMQACCDVLNRPLQVVASEQCCALGAAIPAAQQKMASAIEKTLQPSAQAQQFERLYRRYQQWAVSAEQHYLPSAATVSPAALTH

Samples

Sample ID Description Type Environment
1 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
13 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
14 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
22 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
23 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
24 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
25 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
34 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
35 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
36 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
37 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
38 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
42 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
47 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
48 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
49 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
50 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
52 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
53 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
62 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
65 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
66 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
67 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
68 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
69 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
70 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
71 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
72 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
73 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
74 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
75 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
76 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
77 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
78 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
79 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
80 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
81 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
82 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
83 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
84 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
85 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
86 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
87 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
88 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
89 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
90 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
91 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
92 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
93 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
94 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
95 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
96 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
97 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
98 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
99 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
100 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
101 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
102 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
103 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
104 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
105 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
106 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
107 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
108 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
109 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
110 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
111 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
112 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
113 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
114 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
115 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
116 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
117 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
118 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
119 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
122 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
123 2506520008 Serratia plymuthica AS12 Isolate Unclassified
124 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
125 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
126 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
127 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
128 2547132181 Kosakonia sacchari SP1 Isolate Stem
129 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
130 2561511199 Enterobacter sp. R4-368 Isolate Nodule
131 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
132 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
133 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
134 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
135 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
136 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
137 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
138 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
139 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
140 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
141 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
142 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
143 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
144 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
145 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
146 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
147 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
148 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
149 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
150 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
151 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
152 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
153 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
154 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
155 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
156 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
157 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
158 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
159 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
160 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
161 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
162 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
163 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
164 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
165 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
166 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
167 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
168 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
169 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
170 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
171 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
172 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
173 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
174 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
175 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
176 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
177 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
178 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
179 2636415599 Klebsiella variicola DX120E Isolate Unclassified
180 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
181 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
182 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
183 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
184 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
185 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
186 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
187 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
188 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
189 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
190 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
191 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
192 2751185917 Enterobacter sp. HK169 Isolate Unclassified
193 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
194 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
195 2775507074 Klebsiella sp. D5A Isolate Unclassified
196 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
197 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
198 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
199 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
200 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
201 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
202 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
203 2821118458 Enterobacter asburiae 609 Isolate Unclassified
204 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
205 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
206 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
207 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
208 2847085930 Erwinia persicina B64 Isolate Bulb
209 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
210 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
211 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
212 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
213 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
214 2865014394 Pantoea sp. R-71966 Isolate Unclassified
215 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
216 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
217 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
218 2876601092 Pantoea endophytica 596 Isolate Unclassified
219 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
220 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
221 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
222 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
223 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
224 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
225 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
226 2904504865 Serratia marcescens 1822 Isolate Unclassified
227 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
228 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
229 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
230 2919150387 Rahnella aceris 1817 Isolate Unclassified
231 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
232 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
233 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
234 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
235 2927143783 Rahnella sp. 2050 Isolate Unclassified
236 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
237 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
238 2932406140 Serratia sp. 2723 Isolate Rhizosphere
239 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
240 2937539931 Pantoea sp. LS15 Isolate Unclassified
241 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
242 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
243 2939577877 Serratia sp. 509 Isolate Rhizosphere
244 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
245 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
246 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
247 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
248 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
249 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
250 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
251 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
252 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
253 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
254 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
255 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
256 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
257 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
258 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
259 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
260 640753048 Serratia proteamaculans 568 Isolate Endosphere
261 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
262 8018221730 Enterobacter sp. CM29 Isolate Unclassified
263 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
264 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
265 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
266 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
267 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
268 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
269 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
270 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
271 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
272 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 67.32
Metatranscriptomes 0
Isolates 32.68

Biome Distribution

Category Percentage (%)
Aerial Root 0.87
Bulb 0.22
Endosphere 5.19
Nodule 3.25
Rhizoplane 12.99
Rhizosphere 50.65
Stem 0.22
Stem Tuber 1.3
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439452_000005 3300042010 Bacteria 646919
2 RicEn_C8487 2010549000 Bacteria 3127
3 SwRhRL2b_contig_509347 2162886007 Bacteria 4253
4 JGI25162J39368_1000009 3300002737 Bacteria 389795
5 JGI25154J39366_1000012 3300002738 Bacteria 287601
6 JGI25163J39215_1000246 3300002771 Bacteria 19936
7 JGI25164J39214_1000002 3300002772 Bacteria 406570
8 JGI25152J39213_1003112 3300002773 Bacteria 5801
9 rootH2_10032840 3300003320 Bacteria 5954
10 Ga0055538_1000015 3300003751 Bacteria 311166
11 Ga0055539_1000009 3300003752 Bacteria 406566
12 Ga0055533_1000012 3300003756 Bacteria 406566
13 Ga0055525_1000014 3300003759 Bacteria 406566
14 Ga0055541_1000006 3300003841 Bacteria 406566
15 Ga0058692_1000038 3300003856 Bacteria 140136
16 Ga0058692_1000072 3300003856 Bacteria 77728
17 Ga0058692_1000814 3300003856 Bacteria 12392
18 Ga0058692_1001430 3300003856 Bacteria 8785
19 Ga0058692_1002364 3300003856 Bacteria 6347
20 Ga0058692_1003806 3300003856 Bacteria 4587
21 Ga0065704_10000115 3300005289 Bacteria 75390
22 Ga0065704_10000644 3300005289 Bacteria 24925
23 Ga0070668_100013374 3300005347 Bacteria 6124
24 Ga0070665_100000423 3300005548 Bacteria 61750
25 Ga0070665_100075999 3300005548 Bacteria 3366
26 Ga0068857_100000004 3300005577 Bacteria 171895
27 Ga0075364_10002253 3300006051 Bacteria 10820
28 Ga0079104_1000043 3300006946 Bacteria 185977
29 Ga0079104_1000308 3300006946 Bacteria 61968
30 Ga0079104_1000473 3300006946 Bacteria 44805
31 Ga0079104_1000883 3300006946 Bacteria 24597
32 Ga0079104_1002042 3300006946 Bacteria 11744
33 Ga0079104_1011745 3300006946 Bacteria 2795
34 Ga0105251_10000002 3300009011 Bacteria 350843
35 Ga0105251_10000448 3300009011 Bacteria 39795
36 Ga0105251_10000462 3300009011 Bacteria 38817
37 Ga0105251_10001203 3300009011 Bacteria 22371
38 Ga0105251_10001303 3300009011 Bacteria 21546
39 Ga0105251_10004467 3300009011 Bacteria 9502
40 Ga0105251_10006000 3300009011 Bacteria 7835
41 Ga0105251_10007125 3300009011 Bacteria 6959
42 Ga0105251_10013953 3300009011 Bacteria 4467
43 Ga0105244_10000064 3300009036 Bacteria 122071
44 Ga0105244_10000093 3300009036 Bacteria 94812
45 Ga0105244_10000195 3300009036 Bacteria 61365
46 Ga0105244_10000411 3300009036 Bacteria 39919
47 Ga0105244_10001796 3300009036 Bacteria 16810
48 Ga0105244_10003071 3300009036 Bacteria 12217
49 Ga0105244_10013688 3300009036 Bacteria 4727
50 Ga0105244_10018228 3300009036 Bacteria 3945
51 Ga0105250_10000002 3300009092 Bacteria 566949
52 Ga0105250_10000055 3300009092 Bacteria 114088
53 Ga0105250_10000110 3300009092 Bacteria 74018
54 Ga0105250_10000355 3300009092 Bacteria 34941
55 Ga0105250_10001140 3300009092 Bacteria 14987
56 Ga0105250_10001894 3300009092 Bacteria 10870
57 Ga0105247_10000129 3300009101 Bacteria 73190
58 Ga0105243_10000559 3300009148 Bacteria 37609
59 Ga0105241_10000002 3300009174 Bacteria 869480
60 Ga0157373_10000405 3300013100 Bacteria 34603
61 Ga0157373_10017266 3300013100 Bacteria 5256
62 Ga0157373_10040577 3300013100 Bacteria 3330
63 Ga0157371_10000008 3300013102 Bacteria 393028
64 Ga0157371_10002962 3300013102 Bacteria 15794
65 Ga0157371_10003325 3300013102 Bacteria 14690
66 Ga0157371_10003588 3300013102 Bacteria 13986
67 Ga0157370_10000064 3300013104 Bacteria 114340
68 Ga0157370_10014958 3300013104 Bacteria 7913
69 Ga0157369_10009079 3300013105 Bacteria 11381
70 Ga0157372_10002076 3300013307 Bacteria 21757
71 Ga0157372_10012665 3300013307 Bacteria 8985
72 Ga0157372_10018193 3300013307 Bacteria 7553
73 Ga0157372_10034943 3300013307 Bacteria 5531
74 Ga0182008_10001733 3300014497 Bacteria 14318
75 Ga0182006_1000013 3300015261 Bacteria 363224
76 Ga0183366_1003 3300015679 Bacteria 453474
77 Ga0183370_1003 3300015680 Bacteria 454044
78 Ga0183369_1005 3300015685 Bacteria 453680
79 Ga0183368_1006 3300015687 Bacteria 551576
80 Ga0163161_10000001 3300017792 Bacteria 2041488
81 Ga0213876_10000026 3300021384 Bacteria 231892
82 Ga0209760_100051 3300025207 Bacteria 105257
83 Ga0209784_100001 3300025224 Bacteria 3600592
84 Ga0209566_100001 3300025225 Bacteria 3600765
85 Ga0209674_100002 3300025226 Bacteria 3600592
86 Ga0209563_100002 3300025230 Bacteria 2045675
87 Ga0207427_100020 3300025231 Bacteria 507515
88 Ga0209437_100001 3300025233 Bacteria 2045675
89 Ga0209437_100073 3300025233 Bacteria 302948
90 Ga0209646_1000009 3300025246 Bacteria 652154
91 Ga0209026_1000197 3300025250 Bacteria 84123
92 Ga0209677_100002 3300025253 Bacteria 2045675
93 Ga0209129_1000008 3300025258 Bacteria 640959
94 Ga0209233_1001385 3300025261 Bacteria 9619
95 Ga0207656_10005960 3300025321 Bacteria 4351
96 Ga0207696_1000001 3300025711 Bacteria 2579611
97 Ga0207696_1000066 3300025711 Bacteria 231203
98 Ga0207696_1000086 3300025711 Bacteria 194626
99 Ga0207696_1000154 3300025711 Bacteria 115850
100 Ga0207696_1000292 3300025711 Bacteria 58466
101 Ga0207696_1000396 3300025711 Bacteria 40779
102 Ga0207696_1000725 3300025711 Bacteria 22150
103 Ga0207696_1004671 3300025711 Bacteria 5851
104 Ga0207655_1000017 3300025728 Bacteria 544403
105 Ga0207655_1000026 3300025728 Bacteria 445528
106 Ga0207655_1000069 3300025728 Bacteria 239968
107 Ga0207655_1000090 3300025728 Bacteria 203398
108 Ga0207655_1000101 3300025728 Bacteria 185883
109 Ga0207655_1000797 3300025728 Bacteria 34336
110 Ga0207655_1001273 3300025728 Bacteria 24068
111 Ga0207655_1002281 3300025728 Bacteria 15795
112 Ga0207655_1006647 3300025728 Bacteria 7622
113 Ga0207655_1013684 3300025728 Bacteria 4639
114 Ga0207713_1000001 3300025735 Bacteria 2295391
115 Ga0207713_1000008 3300025735 Bacteria 553952
116 Ga0207713_1000016 3300025735 Bacteria 421689
117 Ga0207713_1000046 3300025735 Bacteria 232796
118 Ga0207713_1000048 3300025735 Bacteria 228272
119 Ga0207713_1000057 3300025735 Bacteria 217090
120 Ga0207713_1001871 3300025735 Bacteria 15999
121 Ga0207713_1010772 3300025735 Bacteria 5035
122 Ga0207713_1017547 3300025735 Bacteria 3582
123 Ga0207710_10000113 3300025900 Bacteria 102300
124 Ga0207654_10000005 3300025911 Bacteria 869492
125 Ga0207709_10002340 3300025935 Bacteria 11961
126 Ga0207674_10000009 3300026116 Bacteria 202730
127 Ga0209281_1000003 3300027111 Bacteria 1260089
128 Ga0209281_1000058 3300027111 Bacteria 300244
129 Ga0209281_1000105 3300027111 Bacteria 220052
130 Ga0209281_1000137 3300027111 Bacteria 182134
131 Ga0209281_1000146 3300027111 Bacteria 169237
132 Ga0209281_1000440 3300027111 Bacteria 60696
133 Ga0209281_1001029 3300027111 Bacteria 21484
134 Ga0209281_1005020 3300027111 Bacteria 3776
135 Ga0209371_1000005 3300027312 Bacteria 1061740
136 Ga0209371_1000014 3300027312 Bacteria 661118
137 Ga0209371_1000030 3300027312 Bacteria 423605
138 Ga0209371_1000054 3300027312 Bacteria 259676
139 Ga0209371_1000093 3300027312 Bacteria 171050
140 Ga0209371_1000124 3300027312 Bacteria 131108
141 Ga0209371_1000212 3300027312 Bacteria 80989
142 Ga0209371_1000510 3300027312 Bacteria 37070
143 Ga0209371_1002128 3300027312 Bacteria 11666
144 Ga0209371_1004345 3300027312 Bacteria 6229
145 Ga0209371_1005785 3300027312 Bacteria 4791
146 Ga0209371_1011025 3300027312 Bacteria 2719
147 Ga0268266_10000290 3300028379 Bacteria 82154
148 Ga0268266_10055922 3300028379 Bacteria 3393
149 Ga0268256_1000006 3300030500 Bacteria 1063991
150 Ga0268256_1000012 3300030500 Bacteria 794553
151 Ga0268256_1000021 3300030500 Bacteria 542735
152 Ga0268256_1000025 3300030500 Bacteria 484317
153 Ga0268256_1000081 3300030500 Bacteria 171742
154 Ga0268256_1000239 3300030500 Bacteria 57839
155 Ga0268256_1000440 3300030500 Bacteria 37070
156 Ga0268256_1001115 3300030500 Bacteria 17475
157 Ga0268256_1001624 3300030500 Bacteria 13011
158 Ga0268256_1001865 3300030500 Bacteria 11666
159 Ga0268256_1002882 3300030500 Bacteria 8256
160 Ga0268256_1003115 3300030500 Bacteria 7733
161 Ga0268256_1003480 3300030500 Bacteria 7069
162 Ga0268256_1005732 3300030500 Bacteria 4791
163 Ga0265339_10000437 3300031249 Bacteria 32747
164 Ga0265316_10039080 3300031344 Bacteria 3815
165 Ga0316582_0030763 3300036647 Bacteria 3274
166 Ga0316584_0043927 3300036712 Bacteria 3333
167 Ga0400489_87447 3300039093 Bacteria 12134
168 Ga0436365_0084998 3300039437 Bacteria 507888
169 Ga0439438_000001 3300041405 Bacteria 1263568
170 Ga0439438_007547 3300041405 Bacteria 3707
171 Ga0439438_014484 3300041405 Bacteria 2345
172 Ga0439447_001346 3300041407 Bacteria 8958
173 Ga0439466_0000009 3300041411 Bacteria 232657
174 Ga0439452_000001 3300042010 Bacteria 1725439
175 Ga0439452_000011 3300042010 Bacteria 428451
176 Ga0439452_000056 3300042010 Bacteria 106151
177 Ga0439452_000271 3300042010 Bacteria 34289
178 Ga0450900_000330 3300042136 Bacteria 3471
179 Ga0439464_0000139 3300042439 Bacteria 11765
180 Ga0451577_0017119 3300042876 Bacteria 6701
181 Ga0466981_0000021 3300044669 Bacteria 83378
182 Ga0453684_0000598 3300044712 Bacteria 133485
183 Ga0453684_0006927 3300044712 Bacteria 21242
184 Ga0453684_0016604 3300044712 Bacteria 11490
185 Ga0453684_0042870 3300044712 Bacteria 6091
186 Ga0451576_0217394 3300045051 Bacteria 1996
187 Ga0451576_0225250 3300045051 Bacteria 1958
188 Ga0451576_0268115 3300045051 Bacteria 1785
189 Ga0495627_000116 3300046453 Bacteria 99916
190 Ga0495591_000013 3300046458 Bacteria 268106
191 Ga0495591_000438 3300046458 Bacteria 33904
192 Ga0495591_005187 3300046458 Bacteria 6104
193 Ga0495591_015344 3300046458 Bacteria 2711
194 Ga0495650_0000028 3300046471 Bacteria 473012
195 Ga0495650_0000043 3300046471 Bacteria 357197
196 Ga0495650_0000204 3300046471 Bacteria 129303
197 Ga0495605_0035877 3300046474 Bacteria 2503
198 Ga0495584_0053553 3300046491 Bacteria 2030
199 Ga0495585_0047555 3300046492 Bacteria 2389
200 Ga0495607_0027467 3300046501 Bacteria 3518
201 Ga0495606_0003230 3300046507 Bacteria 17523
202 Ga0495643_0048233 3300046522 Bacteria 2303
203 Ga0495648_0031566 3300046524 Bacteria 3486
204 Ga0495654_0000041 3300046530 Bacteria 174733
205 Ga0495654_0000149 3300046530 Bacteria 72677
206 Ga0495654_0000167 3300046530 Bacteria 64853
207 Ga0495597_0000550 3300046542 Bacteria 31137
208 Ga0495625_0013568 3300046660 Bacteria 6538
209 Ga0495588_0003883 3300046674 Bacteria 6547
210 Ga0495671_0004512 3300046692 Bacteria 8306
211 Ga0495649_0001014 3300046694 Bacteria 22056
212 Ga0495649_0001806 3300046694 Bacteria 15726
213 Ga0495649_0077335 3300046694 Bacteria 1781
214 Ga0495589_0000001 3300046794 Bacteria 888100
215 Ga0495589_0013350 3300046794 Bacteria 4238
216 Ga0495660_0000012 3300046810 Bacteria 350701
217 Ga0495660_0000048 3300046810 Bacteria 145350
218 Ga0495672_0000002 3300047320 Bacteria 740116
219 Ga0495672_0000043 3300047320 Bacteria 266893
220 Ga0495672_0000051 3300047320 Bacteria 237883
221 Ga0495679_000014 3300047446 Bacteria 292767
222 Ga0495679_006997 3300047446 Bacteria 4772
223 Ga0495679_008792 3300047446 Bacteria 4082
224 Ga0495673_0000047 3300047469 Bacteria 266522
225 Ga0495673_0000167 3300047469 Bacteria 111793
226 Ga0495681_0012835 3300047470 Bacteria 4899
227 Ga0496101_0000055 3300048904 Bacteria 136176
228 Ga0496101_0027800 3300048904 Bacteria 3944
229 Ga0496102_0077157 3300048905 Bacteria 3066
230 Ga0496103_0085955 3300048906 Bacteria 1982
231 Ga0496104_0000818 3300048907 Bacteria 26769
232 Ga0496104_0011598 3300048907 Bacteria 7899
233 Ga0496105_0005125 3300048908 Bacteria 9935
234 Ga0496116_0000001 3300048919 Bacteria 1501681
235 Ga0496116_0000066 3300048919 Bacteria 264035
236 Ga0496116_0000206 3300048919 Bacteria 112462
237 Ga0496116_0000305 3300048919 Bacteria 82397
238 Ga0496116_0001132 3300048919 Bacteria 31772
239 Ga0496116_0004122 3300048919 Bacteria 14002
240 Ga0496116_0076786 3300048919 Bacteria 2091
241 Ga0496117_0000022 3300048920 Bacteria 439512
242 Ga0496117_0000453 3300048920 Bacteria 68285
243 Ga0496117_0001211 3300048920 Bacteria 38710
244 Ga0496117_0002980 3300048920 Bacteria 20413
245 Ga0496117_0003317 3300048920 Bacteria 18805
246 Ga0496117_0003529 3300048920 Bacteria 18089
247 Ga0496117_0003748 3300048920 Bacteria 17399
248 Ga0496117_0007402 3300048920 Bacteria 10741
249 Ga0496118_0000007 3300048921 Bacteria 650986
250 Ga0496118_0000085 3300048921 Bacteria 179731
251 Ga0496118_0000311 3300048921 Bacteria 84212
252 Ga0496118_0003137 3300048921 Bacteria 21147
253 Ga0496118_0011805 3300048921 Bacteria 8480
254 Ga0496118_0020044 3300048921 Bacteria 5949
255 Ga0496119_0000015 3300048922 Bacteria 312979
256 Ga0496119_0000026 3300048922 Bacteria 254759
257 Ga0496119_0000039 3300048922 Bacteria 208631
258 Ga0496119_0001719 3300048922 Bacteria 25553
259 Ga0496119_0002980 3300048922 Bacteria 17974
260 Ga0496119_0012779 3300048922 Bacteria 6775
261 Ga0496119_0030841 3300048922 Bacteria 3606
262 Ga0496119_0057589 3300048922 Bacteria 2347
263 Ga0496120_0000002 3300048923 Bacteria 547999
264 Ga0496120_0000016 3300048923 Bacteria 307608
265 Ga0496120_0000464 3300048923 Bacteria 63910
266 Ga0496120_0000952 3300048923 Bacteria 39508
267 Ga0496120_0003613 3300048923 Bacteria 13877
268 Ga0496120_0004431 3300048923 Bacteria 11779
269 Ga0496120_0006211 3300048923 Bacteria 9232
270 Ga0496120_0014954 3300048923 Bacteria 5142
271 Ga0496121_0002456 3300048924 Bacteria 28303
272 Ga0496121_0003741 3300048924 Bacteria 21307
273 Ga0496121_0009085 3300048924 Bacteria 11505
274 Ga0496121_0021727 3300048924 Bacteria 6270
275 Ga0496122_0000110 3300048925 Bacteria 190142
276 Ga0496122_0000477 3300048925 Bacteria 83335
277 Ga0496122_0001034 3300048925 Bacteria 48967
278 Ga0496122_0001657 3300048925 Bacteria 34574
279 Ga0496122_0001733 3300048925 Bacteria 33832
280 Ga0496122_0023208 3300048925 Bacteria 5480
281 Ga0496123_0000019 3300048926 Bacteria 400216
282 Ga0496123_0000081 3300048926 Bacteria 190142
283 Ga0496123_0000310 3300048926 Bacteria 93838
284 Ga0496123_0001180 3300048926 Bacteria 38508
285 Ga0496123_0001352 3300048926 Bacteria 34568
286 Ga0496123_0002398 3300048926 Bacteria 23426
287 Ga0496123_0004178 3300048926 Bacteria 15437
288 Ga0496123_0010701 3300048926 Bacteria 8064
289 Ga0496124_0000066 3300048927 Bacteria 222815
290 Ga0496124_0000142 3300048927 Bacteria 147311
291 Ga0496124_0000752 3300048927 Bacteria 53203
292 Ga0496124_0013356 3300048927 Bacteria 8024
293 Ga0496124_0013387 3300048927 Bacteria 8010
294 Ga0496124_0017410 3300048927 Bacteria 6772
295 Ga0496124_0021832 3300048927 Bacteria 5888
296 Ga0496124_0023203 3300048927 Bacteria 5669
297 Ga0496124_0036208 3300048927 Bacteria 4307
298 Ga0496124_0043515 3300048927 Bacteria 3860
299 Ga0496125_0000032 3300048928 Bacteria 354078
300 Ga0496125_0000033 3300048928 Bacteria 351850
301 Ga0496125_0012180 3300048928 Bacteria 8557
302 Ga0496126_0001791 3300048929 Bacteria 31600
303 Ga0496126_0001986 3300048929 Bacteria 28995
304 Ga0496126_0002617 3300048929 Bacteria 23990
305 Ga0496126_0007124 3300048929 Bacteria 12318
306 Ga0496126_0025234 3300048929 Bacteria 5722
307 Ga0496126_0184426 3300048929 Bacteria 1770
308 Ga0495678_000354 3300049459 Bacteria 47217
309 Ga0495682_0000001 3300049460 Bacteria 1559116
310 Ga0501047_0033219 3300049581 Bacteria 4980
311 Ga0500621_000003 3300053126 Bacteria 596975
312 2506578264 2506520007 Bacteria 5442880
313 2506583402 2506520008 Bacteria 5443009
314 2508852277 2508501071 Bacteria 5454741
315 2511382797 2511231025 Bacteria 5324661
316 2511437664 2511231035 Bacteria 5341610
317 2538424804 2537561728 Bacteria 5149301
318 2547696591 2547132181 Bacteria 4945084
319 2555261806 2554235234 Bacteria 5762085
320 2562465955 2561511199 Bacteria 5155034
321 2585829596 2585427591 Bacteria 5482980
322 2585832808 2585427592 Bacteria 5370892
323 2599412167 2599185169 Bacteria 5441380
324 2599925582 2599185299 Bacteria 4854625
325 2601525356 2600255254 Bacteria 5281859
326 2601530671 2600255255 Bacteria 5282785
327 2601534003 2600255256 Bacteria 5597742
328 2601540171 2600255257 Bacteria 5597196
329 2601617478 2600255280 Bacteria 5292309
330 2601622511 2600255281 Bacteria 5288753
331 2601644580 2600255287 Bacteria 5210468
332 2601650786 2600255288 Bacteria 5282738
333 2601655836 2600255289 Bacteria 5281907
334 2601660884 2600255290 Bacteria 5282218
335 2601664745 2600255291 Bacteria 5217298
336 2601697387 2600255298 Bacteria 5215185
337 2601702775 2600255299 Bacteria 5218662
338 2601708601 2600255300 Bacteria 5287774
339 2601713460 2600255301 Bacteria 5280532
340 2601718685 2600255302 Bacteria 5288235
341 2601722566 2600255303 Bacteria 5219315
342 2601728834 2600255304 Bacteria 5283973
343 2601733757 2600255305 Bacteria 5282329
344 2601738732 2600255306 Bacteria 5281613
345 2601742936 2600255307 Bacteria 5439064
346 2601753729 2600255309 Bacteria 5431045
347 2601758846 2600255310 Bacteria 5600903
348 2601762804 2600255311 Bacteria 5598766
349 2602020740 2600255392 Bacteria 5437392
350 2603640656 2602042046 Bacteria 5483348
351 2603644566 2602042047 Bacteria 4697674
352 2603662938 2602042052 Bacteria 5215873
353 2603667835 2602042053 Bacteria 5214361
354 2603700420 2602042066 Bacteria 4423871
355 2603705972 2602042067 Bacteria 4863713
356 2603841154 2602042103 Bacteria 5284714
357 2603846227 2602042104 Bacteria 5281639
358 2603851301 2602042105 Bacteria 5282303
359 2603856369 2602042106 Bacteria 5282744
360 2603868594 2602042109 Bacteria 5152801
361 2603873949 2602042110 Bacteria 5283285
362 2603878644 2602042111 Bacteria 5212080
363 2606051128 2603880178 Bacteria 5283018
364 2606072234 2603880184 Bacteria 5217896
365 2606148940 2603880202 Bacteria 5284684
366 2606179020 2603880211 Bacteria 5284226
367 2608669375 2608642108 Bacteria 4104624
368 2609911919 2609459761 Bacteria 5513740
369 2637227113 2636415599 Bacteria 5718434
370 2650898915 2648501693 Bacteria 5069560
371 2656279013 2654587920 Bacteria 5475511
372 2671103666 2667528172 Bacteria 5170840
373 2671109955 2667528173 Bacteria 5375747
374 2676409399 2675903046 Bacteria 5451247
375 2681996882 2681812866 Bacteria 4552357
376 2682008670 2681812869 Bacteria 5014465
377 2686353299 2684622997 Bacteria 4624240
378 2689444815 2687453601 Bacteria 5546041
379 2707099116 2706794495 Bacteria 4536932
380 2712471153 2711768156 Bacteria 4471618
381 2740034504 2739367866 Bacteria 4215900
382 2753854600 2751185917 Bacteria 4551186
383 2765587467 2765235842 Bacteria 4799256
384 2775540848 2775506706 Bacteria 4873073
385 2777021511 2775507074 Bacteria 5532402
386 2791924283 2791354903 Bacteria 4937680
387 2792313366 2791355010 Bacteria 4864581
388 2793404121 2791355275 Bacteria 4429597
389 2807179516 2806310673 Bacteria 4801221
390 2809123626 2808606414 Bacteria 4917181
391 2813730582 2811995292 Bacteria 5303342
392 2814698189 2814123068 Bacteria 5687681
393 2821121462 2821118458 Bacteria 4714306
394 2823377413 2823373977 Bacteria 4779415
395 2833641070 2833640130 Bacteria 4858325
396 2844426153 2844425489 Bacteria 4854065
397 2844530826 2844528606 Bacteria 4733806
398 2847087749 2847085930 Bacteria 5070450
399 2847799921 2847797336 Bacteria 5176640
400 2852104843 2852103415 Bacteria 5193810
401 2854604058 2854601825 Bacteria 4797592
402 2855197300 2855195626 Bacteria 4927512
403 2858468555 2858466076 Bacteria 4722413
404 2865015198 2865014394 Bacteria 4764573
405 2869554222 2869551831 Bacteria 5474685
406 2871272880 2871272651 Bacteria 5042015
407 2871285682 2871282230 Bacteria 4917173
408 2876604339 2876601092 Bacteria 5114497
409 2881612598 2881609920 Bacteria 4405319
410 2884090457 2884086401 Bacteria 5005459
411 2888378066 2888373701 Bacteria 5098052
412 2891674688 2891670763 Bacteria 4967099
413 2900051922 2900051742 Bacteria 4985156
414 2902050083 2902048731 Bacteria 4976191
415 2904477213 2904474040 Bacteria 5504324
416 2904508626 2904504865 Bacteria 5152820
417 2904516164 2904513164 Bacteria 5476410
418 2908669948 2908669403 Bacteria 5740494
419 2919112629 2919108558 Bacteria 5897419
420 2919153380 2919150387 Bacteria 5500879
421 2919494590 2919493220 Bacteria 4598500
422 2919543591 2919543075 Bacteria 4728703
423 2923528186 2923525760 Bacteria 4472324
424 2923637992 2923634449 Bacteria 4753480
425 2927144006 2927143783 Bacteria 5504251
426 2927835570 2927833300 Bacteria 4923934
427 2929243515 2929239360 Bacteria 7745570
428 2932408133 2932406140 Bacteria 5134491
429 2935627955 2935625433 Bacteria 5042964
430 2937544456 2937539931 Bacteria 4639830
431 2939571547 2939568625 Bacteria 4542555
432 2939576084 2939573065 Bacteria 4926053
433 2939578590 2939577877 Bacteria 5132791
434 2939603410 2939602548 Bacteria 4950493
435 2939609459 2939607340 Bacteria 4719256
436 2939619624 2939617950 Bacteria 4820956
437 2939646044 2939642701 Bacteria 4475280
438 2945879743 2945874760 Bacteria 5527237
439 2945953053 2945951305 Bacteria 4918162
440 2969084127 2969079654 Bacteria 5439582
441 2971825620 2971820967 Bacteria 5823634
442 2974313601 2974310843 Bacteria 4947816
443 2974436983 2974435778 Bacteria 4876478
444 2978975572 2978975091 Bacteria 4704313
445 2984496586 2984494565 Bacteria 5000175
446 2984561204 2984559226 Bacteria 5683096
447 2984599277 2984595703 Bacteria 5682994
448 2990262005 2990261002 Bacteria 4919493
449 3000380502 3000376612 Bacteria 4705565
450 640937783 640753048 Bacteria 5495657
451 8016736023 8016733728 Bacteria 5274317
452 8018224034 8018221730 Bacteria 4616064
453 8018410056 8018405270 Bacteria 4978981
454 8019502768 8019499862 Bacteria 5169538
455 8019506854 8019504834 Bacteria 4819156
456 8054848693 8054844752 Bacteria 4450330
457 8054853872 8054849141 Bacteria 5232694
458 8055092574 8055087960 Bacteria 4784273
459 8055092867 8055092621 Bacteria 4873875
460 8055100643 8055097453 Bacteria 4865496
461 8055696163 8055693939 Bacteria 4772047
462 8057307315 8057304971 Bacteria 4649742
463 Ga0439452_000005
464 RicEn_C8487
465 SwRhRL2b_contig_509347
466 JGI25162J39368_1000009
467 JGI25154J39366_1000012
468 JGI25163J39215_1000246
469 JGI25164J39214_1000002
470 JGI25152J39213_1003112
471 rootH2_10032840
472 Ga0055538_1000015
473 Ga0055539_1000009
474 Ga0055533_1000012
475 Ga0055525_1000014
476 Ga0055541_1000006
477 Ga0058692_1000038
478 Ga0058692_1000072
479 Ga0058692_1000814
480 Ga0058692_1001430
481 Ga0058692_1002364
482 Ga0058692_1003806
483 Ga0065704_10000115
484 Ga0065704_10000644
485 Ga0070668_100013374
486 Ga0070665_100000423
487 Ga0070665_100075999
488 Ga0068857_100000004
489 Ga0075364_10002253
490 Ga0079104_1000043
491 Ga0079104_1000308
492 Ga0079104_1000473
493 Ga0079104_1000883
494 Ga0079104_1002042
495 Ga0079104_1011745
496 Ga0105251_10000002
497 Ga0105251_10000448
498 Ga0105251_10000462
499 Ga0105251_10001203
500 Ga0105251_10001303
501 Ga0105251_10004467
502 Ga0105251_10006000
503 Ga0105251_10007125
504 Ga0105251_10013953
505 Ga0105244_10000064
506 Ga0105244_10000093
507 Ga0105244_10000195
508 Ga0105244_10000411
509 Ga0105244_10001796
510 Ga0105244_10003071
511 Ga0105244_10013688
512 Ga0105244_10018228
513 Ga0105250_10000002
514 Ga0105250_10000055
515 Ga0105250_10000110
516 Ga0105250_10000355
517 Ga0105250_10001140
518 Ga0105250_10001894
519 Ga0105247_10000129
520 Ga0105243_10000559
521 Ga0105241_10000002
522 Ga0157373_10000405
523 Ga0157373_10017266
524 Ga0157373_10040577
525 Ga0157371_10000008
526 Ga0157371_10002962
527 Ga0157371_10003325
528 Ga0157371_10003588
529 Ga0157370_10000064
530 Ga0157370_10014958
531 Ga0157369_10009079
532 Ga0157372_10002076
533 Ga0157372_10012665
534 Ga0157372_10018193
535 Ga0157372_10034943
536 Ga0182008_10001733
537 Ga0182006_1000013
538 Ga0183366_1003
539 Ga0183370_1003
540 Ga0183369_1005
541 Ga0183368_1006
542 Ga0163161_10000001
543 Ga0213876_10000026
544 Ga0209760_100051
545 Ga0209784_100001
546 Ga0209566_100001
547 Ga0209674_100002
548 Ga0209563_100002
549 Ga0207427_100020
550 Ga0209437_100001
551 Ga0209437_100073
552 Ga0209646_1000009
553 Ga0209026_1000197
554 Ga0209677_100002
555 Ga0209129_1000008
556 Ga0209233_1001385
557 Ga0207656_10005960
558 Ga0207696_1000001
559 Ga0207696_1000066
560 Ga0207696_1000086
561 Ga0207696_1000154
562 Ga0207696_1000292
563 Ga0207696_1000396
564 Ga0207696_1000725
565 Ga0207696_1004671
566 Ga0207655_1000017
567 Ga0207655_1000026
568 Ga0207655_1000069
569 Ga0207655_1000090
570 Ga0207655_1000101
571 Ga0207655_1000797
572 Ga0207655_1001273
573 Ga0207655_1002281
574 Ga0207655_1006647
575 Ga0207655_1013684
576 Ga0207713_1000001
577 Ga0207713_1000008
578 Ga0207713_1000016
579 Ga0207713_1000046
580 Ga0207713_1000048
581 Ga0207713_1000057
582 Ga0207713_1001871
583 Ga0207713_1010772
584 Ga0207713_1017547
585 Ga0207710_10000113
586 Ga0207654_10000005
587 Ga0207709_10002340
588 Ga0207674_10000009
589 Ga0209281_1000003
590 Ga0209281_1000058
591 Ga0209281_1000105
592 Ga0209281_1000137
593 Ga0209281_1000146
594 Ga0209281_1000440
595 Ga0209281_1001029
596 Ga0209281_1005020
597 Ga0209371_1000005
598 Ga0209371_1000014
599 Ga0209371_1000030
600 Ga0209371_1000054
601 Ga0209371_1000093
602 Ga0209371_1000124
603 Ga0209371_1000212
604 Ga0209371_1000510
605 Ga0209371_1002128
606 Ga0209371_1004345
607 Ga0209371_1005785
608 Ga0209371_1011025
609 Ga0268266_10000290
610 Ga0268266_10055922
611 Ga0268256_1000006
612 Ga0268256_1000012
613 Ga0268256_1000021
614 Ga0268256_1000025
615 Ga0268256_1000081
616 Ga0268256_1000239
617 Ga0268256_1000440
618 Ga0268256_1001115
619 Ga0268256_1001624
620 Ga0268256_1001865
621 Ga0268256_1002882
622 Ga0268256_1003115
623 Ga0268256_1003480
624 Ga0268256_1005732
625 Ga0265339_10000437
626 Ga0265316_10039080
627 Ga0316582_0030763
628 Ga0316584_0043927
629 Ga0400489_87447
630 Ga0436365_0084998
631 Ga0439438_000001
632 Ga0439438_007547
633 Ga0439438_014484
634 Ga0439447_001346
635 Ga0439466_0000009
636 Ga0439452_000001
637 Ga0439452_000011
638 Ga0439452_000056
639 Ga0439452_000271
640 Ga0450900_000330
641 Ga0439464_0000139
642 Ga0451577_0017119
643 Ga0466981_0000021
644 Ga0453684_0000598
645 Ga0453684_0006927
646 Ga0453684_0016604
647 Ga0453684_0042870
648 Ga0451576_0217394
649 Ga0451576_0225250
650 Ga0451576_0268115
651 Ga0495627_000116
652 Ga0495591_000013
653 Ga0495591_000438
654 Ga0495591_005187
655 Ga0495591_015344
656 Ga0495650_0000028
657 Ga0495650_0000043
658 Ga0495650_0000204
659 Ga0495605_0035877
660 Ga0495584_0053553
661 Ga0495585_0047555
662 Ga0495607_0027467
663 Ga0495606_0003230
664 Ga0495643_0048233
665 Ga0495648_0031566
666 Ga0495654_0000041
667 Ga0495654_0000149
668 Ga0495654_0000167
669 Ga0495597_0000550
670 Ga0495625_0013568
671 Ga0495588_0003883
672 Ga0495671_0004512
673 Ga0495649_0001014
674 Ga0495649_0001806
675 Ga0495649_0077335
676 Ga0495589_0000001
677 Ga0495589_0013350
678 Ga0495660_0000012
679 Ga0495660_0000048
680 Ga0495672_0000002
681 Ga0495672_0000043
682 Ga0495672_0000051
683 Ga0495679_000014
684 Ga0495679_006997
685 Ga0495679_008792
686 Ga0495673_0000047
687 Ga0495673_0000167
688 Ga0495681_0012835
689 Ga0496101_0000055
690 Ga0496101_0027800
691 Ga0496102_0077157
692 Ga0496103_0085955
693 Ga0496104_0000818
694 Ga0496104_0011598
695 Ga0496105_0005125
696 Ga0496116_0000001
697 Ga0496116_0000066
698 Ga0496116_0000206
699 Ga0496116_0000305
700 Ga0496116_0001132
701 Ga0496116_0004122
702 Ga0496116_0076786
703 Ga0496117_0000022
704 Ga0496117_0000453
705 Ga0496117_0001211
706 Ga0496117_0002980
707 Ga0496117_0003317
708 Ga0496117_0003529
709 Ga0496117_0003748
710 Ga0496117_0007402
711 Ga0496118_0000007
712 Ga0496118_0000085
713 Ga0496118_0000311
714 Ga0496118_0003137
715 Ga0496118_0011805
716 Ga0496118_0020044
717 Ga0496119_0000015
718 Ga0496119_0000026
719 Ga0496119_0000039
720 Ga0496119_0001719
721 Ga0496119_0002980
722 Ga0496119_0012779
723 Ga0496119_0030841
724 Ga0496119_0057589
725 Ga0496120_0000002
726 Ga0496120_0000016
727 Ga0496120_0000464
728 Ga0496120_0000952
729 Ga0496120_0003613
730 Ga0496120_0004431
731 Ga0496120_0006211
732 Ga0496120_0014954
733 Ga0496121_0002456
734 Ga0496121_0003741
735 Ga0496121_0009085
736 Ga0496121_0021727
737 Ga0496122_0000110
738 Ga0496122_0000477
739 Ga0496122_0001034
740 Ga0496122_0001657
741 Ga0496122_0001733
742 Ga0496122_0023208
743 Ga0496123_0000019
744 Ga0496123_0000081
745 Ga0496123_0000310
746 Ga0496123_0001180
747 Ga0496123_0001352
748 Ga0496123_0002398
749 Ga0496123_0004178
750 Ga0496123_0010701
751 Ga0496124_0000066
752 Ga0496124_0000142
753 Ga0496124_0000752
754 Ga0496124_0013356
755 Ga0496124_0013387
756 Ga0496124_0017410
757 Ga0496124_0021832
758 Ga0496124_0023203
759 Ga0496124_0036208
760 Ga0496124_0043515
761 Ga0496125_0000032
762 Ga0496125_0000033
763 Ga0496125_0012180
764 Ga0496126_0001791
765 Ga0496126_0001986
766 Ga0496126_0002617
767 Ga0496126_0007124
768 Ga0496126_0025234
769 Ga0496126_0184426
770 Ga0495678_000354
771 Ga0495682_0000001
772 Ga0501047_0033219
773 Ga0500621_000003
774 2506578264
775 2506583402
776 2508852277
777 2511382797
778 2511437664
779 2538424804
780 2547696591
781 2555261806
782 2562465955
783 2585829596
784 2585832808
785 2599412167
786 2599925582
787 2601525356
788 2601530671
789 2601534003
790 2601540171
791 2601617478
792 2601622511
793 2601644580
794 2601650786
795 2601655836
796 2601660884
797 2601664745
798 2601697387
799 2601702775
800 2601708601
801 2601713460
802 2601718685
803 2601722566
804 2601728834
805 2601733757
806 2601738732
807 2601742936
808 2601753729
809 2601758846
810 2601762804
811 2602020740
812 2603640656
813 2603644566
814 2603662938
815 2603667835
816 2603700420
817 2603705972
818 2603841154
819 2603846227
820 2603851301
821 2603856369
822 2603868594
823 2603873949
824 2603878644
825 2606051128
826 2606072234
827 2606148940
828 2606179020
829 2608669375
830 2609911919
831 2637227113
832 2650898915
833 2656279013
834 2671103666
835 2671109955
836 2676409399
837 2681996882
838 2682008670
839 2686353299
840 2689444815
841 2707099116
842 2712471153
843 2740034504
844 2753854600
845 2765587467
846 2775540848
847 2777021511
848 2791924283
849 2792313366
850 2793404121
851 2807179516
852 2809123626
853 2813730582
854 2814698189
855 2821121462
856 2823377413
857 2833641070
858 2844426153
859 2844530826
860 2847087749
861 2847799921
862 2852104843
863 2854604058
864 2855197300
865 2858468555
866 2865015198
867 2869554222
868 2871272880
869 2871285682
870 2876604339
871 2881612598
872 2884090457
873 2888378066
874 2891674688
875 2900051922
876 2902050083
877 2904477213
878 2904508626
879 2904516164
880 2908669948
881 2919112629
882 2919153380
883 2919494590
884 2919543591
885 2923528186
886 2923637992
887 2927144006
888 2927835570
889 2929243515
890 2932408133
891 2935627955
892 2937544456
893 2939571547
894 2939576084
895 2939578590
896 2939603410
897 2939609459
898 2939619624
899 2939646044
900 2945879743
901 2945953053
902 2969084127
903 2971825620
904 2974313601
905 2974436983
906 2978975572
907 2984496586
908 2984561204
909 2984599277
910 2990262005
911 3000380502
912 640937783
913 8016736023
914 8018224034
915 8018410056
916 8019502768
917 8019506854
918 8054848693
919 8054853872
920 8055092574
921 8055092867
922 8055100643
923 8055696163
924 8057307315

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02782

FGGY_C

FGGY family of carbohydrate kinases, C-terminal domain

325

536

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pic-assembly1.cif.gz_n 70s ribosome with p/e-site trna in spectinomycin-treated mycoplasma pneumoniae cells 0.9078 14 44
7pip-assembly1.cif.gz_n 70s ribosome with ef-tu-trna and p-site trna in pseudouridimycin-treated mycoplasma pneumoniae cells 0.8682 14 44
7pam-assembly1.cif.gz_n 70s ribosome with a*- and p/e-site trnas in mycoplasma pneumoniae cells 0.858 14 44
6rjd-assembly1.cif.gz_C cryo-em structure of st1cas9-sgrna-tdna59-ntpam complex. 0.8528 16 48
6rj9-assembly1.cif.gz_C cryo-em structure of st1cas9-sgrna-tdna20-acriia6 monomeric assembly. 0.8447 16 48
ID Description Score Start End Superfamily
af_Q4CRA5_13_211_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.982 15 206 3.30.420.40
af_Q4DBR1_13_290_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9628 15 292 3.30.420.40
af_Q4DBR1_13_290_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9526 15 292 3.30.420.40
af_Q4CRA5_13_211_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9383 15 206 3.30.420.40
af_Q4DBR1_294_568_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9285 299 553 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A4Q8X0P2-F1-model_v4 deleted 0.9972 14 228
AF-A0A379TNG3-F1-model_v4 L-ribulokinase (EC 2.7.1.16) 0.9968 14 266 GO:0005737
GO:0008741
GO:0019150
GO:0019321
AF-A0A2U3EY19-F1-model_v4 Ribulokinase 0.9951 14 304 GO:0005737
GO:0019150
GO:0019321
AF-A0A4Q8X0P2-F1-model_v4 deleted 0.9926 14 228
AF-A0A484VTT6-F1-model_v4 Ribulokinase (EC 2.7.1.16) 0.9911 108 277 GO:0005737
GO:0008741
GO:0019150
GO:0019321

Map