F448963

General Info

Members Datasets Scaffolds Average Seq Length
462 241 924 303

Family's Representative Sequence

Representative Sequence 3300042438|Ga0439459_0002784|Ga0439459_0002784_236_1240
Length 334
Sequence VNWIGFFCAVDDIFLRHSHLDVHTQKRPWRSGYIVFRHLLLGFAMSLGVAAVSVAADTDYDQQIAQWRSQRLARLQAPDGWLSLIGLEWLNVGVNLIGSGADNDIVLRAGPAKLGTIVLAEDGGLRIQLDPASGARIDGTDALQAVLVDDMHAGQGAPTKISFGHANFYVIDRDGRKALRVKDADAVTRTQFLGLDYFPVDPSWRVVADWVPFDPPHTLQIGNVLGKLDTVEVPGKAVFQRNGHTYELLPYQEEPGGELFFVMADQTSGKQTYGAGRFLYAQLPKDGKVVLDFNRAYNPPCAFTPFATCPLAPPENRLALAVTAGEKSYRGGHH

Samples

Sample ID Description Type Environment
1 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
12 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
18 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
19 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
22 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
23 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
24 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
61 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
71 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
72 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
73 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
83 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
85 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
88 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
121 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
122 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
123 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
124 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
125 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
126 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
127 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
128 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
134 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
135 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
143 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
155 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
156 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
157 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
158 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
159 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
160 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
174 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
175 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
195 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
210 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
225 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
226 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
227 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
230 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
231 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
232 2734482264 Dyella sp. AD052 Isolate Unclassified
233 2738543009 Luteibacter sp. OK325 Isolate Unclassified
234 2739367700 Dyella sp. YR388 Isolate Unclassified
235 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
236 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
237 2884411467 Dyella sp. AD56 Isolate Rhizosphere
238 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
239 2919085039 Luteibacter sp. 1214 Isolate Unclassified
240 2928963466 Dyella japonica 1073 Isolate Unclassified
241 2941471342 Luteibacter sp. 621 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.19
Metatranscriptomes 0.22
Isolates 2.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.45
Nodule 0
Rhizoplane 2.6
Rhizosphere 66.67
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439459_0002784 3300042438 Bacteria 2725
2 JGI24736J21556_1005346 3300001904 Bacteria 2170
3 JGI24740J21852_10036882 3300001979 Bacteria 1514
4 JGI24739J22299_10000301 3300001989 Bacteria 16793
5 JGI24739J22299_10011742 3300001989 Bacteria 3228
6 JGI24737J22298_10013115 3300001990 Bacteria 2700
7 JGI24735J21928_10002905 3300002067 Bacteria 5900
8 JGI25156J39149_1003537 3300002705 Bacteria 5077
9 JGI25156J39149_1018358 3300002705 Bacteria 1294
10 JGI25162J39368_1000226 3300002737 Bacteria 57732
11 JGI25162J39368_1000311 3300002737 Bacteria 43163
12 JGI25162J39368_1001518 3300002737 Bacteria 12030
13 JGI25154J39366_1003123 3300002738 Bacteria 3697
14 JGI25157J39369_1000345 3300002741 Bacteria 32775
15 JGI25157J39369_1000541 3300002741 Bacteria 22715
16 JGI25157J39369_1001544 3300002741 Bacteria 8331
17 JGI25157J39369_1002040 3300002741 Bacteria 5784
18 JGI25163J39215_1000171 3300002771 Bacteria 25502
19 JGI25164J39214_1000035 3300002772 Bacteria 139987
20 JGI25164J39214_1000214 3300002772 Bacteria 47762
21 JGI25165J46597_1000226 3300003214 Bacteria 78481
22 JGI25165J46597_1000260 3300003214 Bacteria 70453
23 rootH1_10078943 3300003316 Bacteria 2802
24 rootH1_10110464 3300003316 Bacteria 3249
25 rootH2_10004402 3300003320 Bacteria 19303
26 rootH1_10081813 3300003323 Bacteria 2454
27 Ga0006562J51391_1016739 3300003578 Bacteria 11740
28 Ga0055538_1002687 3300003751 Bacteria 2505
29 Ga0055539_1002136 3300003752 Bacteria 3195
30 Ga0055525_1000452 3300003759 Bacteria 23636
31 Ga0055527_1000082 3300003760 Bacteria 75048
32 Ga0055527_1000215 3300003760 Bacteria 37505
33 Ga0055535_1000143 3300003761 Bacteria 75049
34 Ga0055535_1000323 3300003761 Bacteria 48370
35 Ga0055535_1000593 3300003761 Bacteria 29891
36 Ga0055535_1000764 3300003761 Bacteria 23857
37 Ga0055535_1001245 3300003761 Bacteria 14198
38 Ga0055542_1000067 3300003762 Bacteria 154585
39 Ga0055542_1000190 3300003762 Bacteria 75049
40 Ga0055542_1000275 3300003762 Bacteria 57732
41 Ga0055542_1000474 3300003762 Bacteria 37493
42 Ga0055542_1000622 3300003762 Bacteria 29891
43 Ga0055542_1001232 3300003762 Bacteria 14228
44 Ga0055529_1000217 3300003763 Bacteria 75049
45 Ga0055529_1000233 3300003763 Bacteria 70453
46 Ga0055529_1000785 3300003763 Bacteria 19519
47 Ga0055529_1000981 3300003763 Bacteria 14206
48 Ga0065165_1001244 3300005262 Bacteria 29035
49 Ga0070682_100003164 3300005337 Bacteria 9117
50 Ga0070660_100007972 3300005339 Bacteria 7400
51 Ga0070689_100026023 3300005340 Bacteria 4401
52 Ga0070661_100040150 3300005344 Bacteria 3412
53 Ga0070661_100064440 3300005344 Bacteria 2693
54 Ga0070659_100003931 3300005366 Bacteria 10575
55 Ga0070659_100005746 3300005366 Bacteria 8927
56 Ga0070667_100026038 3300005367 Bacteria 4864
57 Ga0070694_100129815 3300005444 Bacteria 1819
58 Ga0070708_100013915 3300005445 Bacteria 6608
59 Ga0070708_100250207 3300005445 Unclassified 1665
60 Ga0070663_100009533 3300005455 Bacteria 6016
61 Ga0070663_100173414 3300005455 Bacteria 1668
62 Ga0070662_100440461 3300005457 Bacteria 1080
63 Ga0070681_10005861 3300005458 Bacteria 11895
64 Ga0070706_100002803 3300005467 Bacteria 17437
65 Ga0070706_100010630 3300005467 Bacteria 8545
66 Ga0070706_100245799 3300005467 Bacteria 1671
67 Ga0070707_100010560 3300005468 Bacteria 8601
68 Ga0070698_100287192 3300005471 Bacteria 1576
69 Ga0070684_100312131 3300005535 Bacteria 1444
70 Ga0070697_100019797 3300005536 Bacteria 5316
71 Ga0068853_100007191 3300005539 Bacteria 8911
72 Ga0070686_100093804 3300005544 Bacteria 2013
73 Ga0070696_100018008 3300005546 Bacteria 4771
74 Ga0070696_100107858 3300005546 Bacteria 2003
75 Ga0070696_100240690 3300005546 Bacteria 1365
76 Ga0070665_100000062 3300005548 Bacteria 220304
77 Ga0068855_100003219 3300005563 Bacteria 19978
78 Ga0068855_100012550 3300005563 Bacteria 10226
79 Ga0068854_100000486 3300005578 Bacteria 24257
80 Ga0068856_100000652 3300005614 Bacteria 37607
81 Ga0068852_100013145 3300005616 Bacteria 6326
82 Ga0068851_10023482 3300005834 Bacteria 3015
83 Ga0068860_100042799 3300005843 Bacteria 4323
84 Ga0068862_100244573 3300005844 Bacteria 1633
85 Ga0097621_100062453 3300006237 Bacteria 3058
86 Ga0105240_10003480 3300009093 Bacteria 24428
87 Ga0105240_10104070 3300009093 Bacteria 3447
88 Ga0105247_10006226 3300009101 Bacteria 7402
89 Ga0105241_10057833 3300009174 Bacteria 2976
90 Ga0105237_10000007 3300009545 Bacteria 367690
91 Ga0105237_10000152 3300009545 Bacteria 96802
92 Ga0105238_10010397 3300009551 Bacteria 9340
93 Ga0105238_10054149 3300009551 Bacteria 4031
94 Ga0105239_10000020 3300010375 Bacteria 264435
95 Ga0105239_10012353 3300010375 Bacteria 9511
96 Ga0105239_10066714 3300010375 Bacteria 3953
97 Ga0157314_1000152 3300012500 Bacteria 7571
98 Ga0157347_1004411 3300012502 Bacteria 1306
99 Ga0157373_10005976 3300013100 Bacteria 9105
100 Ga0157371_10015441 3300013102 Bacteria 5727
101 Ga0157371_10060816 3300013102 Bacteria 2678
102 Ga0157370_10000422 3300013104 Bacteria 53330
103 Ga0157370_10006899 3300013104 Bacteria 12425
104 Ga0157370_10027335 3300013104 Bacteria 5626
105 Ga0157370_10594755 3300013104 Bacteria 1013
106 Ga0157369_10018954 3300013105 Bacteria 7708
107 Ga0157369_10383813 3300013105 Bacteria 1458
108 Ga0157369_10459262 3300013105 Bacteria 1319
109 Ga0163162_10008117 3300013306 Bacteria 10243
110 Ga0157372_10010257 3300013307 Bacteria 9951
111 Ga0157372_10130489 3300013307 Bacteria 2891
112 Ga0157372_10388165 3300013307 Bacteria 1627
113 Ga0182008_10014201 3300014497 Bacteria 4175
114 Ga0157376_10128370 3300014969 Bacteria 2259
115 Ga0182006_1000475 3300015261 Bacteria 31392
116 Ga0182005_1000261 3300015265 Bacteria 33393
117 Ga0182005_1005465 3300015265 Bacteria 3966
118 Ga0183369_1006 3300015685 Bacteria 449058
119 Ga0183368_1003 3300015687 Bacteria 1276390
120 Ga0163161_10002263 3300017792 Bacteria 13801
121 Ga0209760_100210 3300025207 Bacteria 26868
122 Ga0209784_100068 3300025224 Bacteria 152526
123 Ga0209566_102136 3300025225 Bacteria 4002
124 Ga0209674_100012 3300025226 Bacteria 950162
125 Ga0209674_100119 3300025226 Bacteria 135468
126 Ga0209674_100748 3300025226 Bacteria 11058
127 Ga0209672_100007 3300025228 Bacteria 959482
128 Ga0209672_100016 3300025228 Bacteria 522604
129 Ga0209672_100357 3300025228 Bacteria 28997
130 Ga0209672_100955 3300025228 Bacteria 12863
131 Ga0209672_101331 3300025228 Bacteria 9392
132 Ga0209563_100051 3300025230 Bacteria 340545
133 Ga0207427_100033 3300025231 Bacteria 338459
134 Ga0207427_100156 3300025231 Bacteria 77311
135 Ga0207427_102011 3300025231 Bacteria 6166
136 Ga0209437_100105 3300025233 Bacteria 220034
137 Ga0209437_100126 3300025233 Bacteria 192521
138 Ga0209437_100147 3300025233 Bacteria 161997
139 Ga0209437_102839 3300025233 Bacteria 3251
140 Ga0209258_100012 3300025242 Bacteria 825544
141 Ga0209258_100046 3300025242 Bacteria 369794
142 Ga0209258_100049 3300025242 Bacteria 358328
143 Ga0209258_100095 3300025242 Bacteria 223270
144 Ga0209258_100245 3300025242 Bacteria 100255
145 Ga0209258_101576 3300025242 Bacteria 7587
146 Ga0209646_1000517 3300025246 Bacteria 17280
147 Ga0209646_1001035 3300025246 Bacteria 8397
148 Ga0209026_1000099 3300025250 Bacteria 161750
149 Ga0209026_1000140 3300025250 Bacteria 115081
150 Ga0209026_1000391 3300025250 Bacteria 39130
151 Ga0209148_1000002 3300025254 Bacteria 2399500
152 Ga0209148_1000010 3300025254 Bacteria 1265567
153 Ga0209148_1000014 3300025254 Bacteria 925277
154 Ga0209148_1000039 3300025254 Bacteria 482479
155 Ga0209148_1000087 3300025254 Bacteria 260905
156 Ga0209148_1000098 3300025254 Bacteria 233172
157 Ga0209759_1000316 3300025256 Bacteria 64846
158 Ga0209759_1000338 3300025256 Bacteria 61744
159 Ga0209759_1000483 3300025256 Bacteria 44049
160 Ga0209759_1003052 3300025256 Bacteria 6895
161 Ga0209129_1003064 3300025258 Bacteria 7551
162 Ga0209233_1000009 3300025261 Bacteria 1265567
163 Ga0209233_1000080 3300025261 Bacteria 338459
164 Ga0209233_1016038 3300025261 Bacteria 2071
165 Ga0209455_1000010 3300025272 Bacteria 959482
166 Ga0209455_1000014 3300025272 Bacteria 806601
167 Ga0209455_1000034 3300025272 Bacteria 483129
168 Ga0209455_1000086 3300025272 Bacteria 244650
169 Ga0209455_1000357 3300025272 Bacteria 42718
170 Ga0209455_1003310 3300025272 Bacteria 5779
171 Ga0209455_1008200 3300025272 Bacteria 2863
172 Ga0209758_1008379 3300025297 Bacteria 6719
173 Ga0207656_10021374 3300025321 Bacteria 2585
174 Ga0207710_10007900 3300025900 Bacteria 4499
175 Ga0207647_10000287 3300025904 Bacteria 41379
176 Ga0207647_10001225 3300025904 Bacteria 19750
177 Ga0207647_10155733 3300025904 Bacteria 1334
178 Ga0207684_10001469 3300025910 Bacteria 25388
179 Ga0207684_10011852 3300025910 Bacteria 7597
180 Ga0207695_10001214 3300025913 Bacteria 44135
181 Ga0207695_10001325 3300025913 Bacteria 41991
182 Ga0207695_10005709 3300025913 Bacteria 16406
183 Ga0207671_10000031 3300025914 Bacteria 247030
184 Ga0207671_10000074 3300025914 Bacteria 156482
185 Ga0207657_10020103 3300025919 Bacteria 6320
186 Ga0207649_10141818 3300025920 Bacteria 1645
187 Ga0207649_10188609 3300025920 Bacteria 1448
188 Ga0207694_10253528 3300025924 Bacteria 1440
189 Ga0207690_10004302 3300025932 Bacteria 8402
190 Ga0207690_10013951 3300025932 Bacteria 4842
191 Ga0207690_10126821 3300025932 Bacteria 1862
192 Ga0207706_10108056 3300025933 Bacteria 2448
193 Ga0207667_10001044 3300025949 Bacteria 35297
194 Ga0207667_10001074 3300025949 Bacteria 34666
195 Ga0207667_10025715 3300025949 Bacteria 6440
196 Ga0207667_10063039 3300025949 Bacteria 3874
197 Ga0207640_10000485 3300025981 Bacteria 24115
198 Ga0207640_10001056 3300025981 Bacteria 15239
199 Ga0207639_10023136 3300026041 Bacteria 4484
200 Ga0207678_10002963 3300026067 Bacteria 15378
201 Ga0207678_10050731 3300026067 Bacteria 3584
202 Ga0207678_10054243 3300026067 Bacteria 3452
203 Ga0207702_10000185 3300026078 Bacteria 74602
204 Ga0207702_10003329 3300026078 Bacteria 14753
205 Ga0207702_10523748 3300026078 Bacteria 1157
206 Ga0207702_10609296 3300026078 Bacteria 1072
207 Ga0207674_10000685 3300026116 Bacteria 44017
208 Ga0207674_10367913 3300026116 Bacteria 1390
209 Ga0207698_10387901 3300026142 Bacteria 1331
210 Ga0268266_10000001 3300028379 Bacteria 4040580
211 Ga0268265_10173583 3300028380 Bacteria 1845
212 Ga0265327_10000585 3300031251 Bacteria 61215
213 Ga0265327_10006343 3300031251 Bacteria 9491
214 Ga0265327_10016325 3300031251 Bacteria 4721
215 Ga0265327_10039192 3300031251 Unclassified 2576
216 Ga0265313_10005166 3300031595 Bacteria 9699
217 Ga0265314_10009610 3300031711 Bacteria 8145
218 Ga0395899_0000175 3300037312 Bacteria 95781
219 Ga0395900_0000012 3300037418 Bacteria 401198
220 Ga0395900_0002590 3300037418 Bacteria 19782
221 Ga0395900_0009916 3300037418 Bacteria 9753
222 Ga0395900_0060414 3300037418 Bacteria 3900
223 Ga0395898_0000034 3300037466 Bacteria 356745
224 Ga0395898_0000902 3300037466 Bacteria 47801
225 Ga0395898_0005590 3300037466 Bacteria 13559
226 Ga0395898_0082804 3300037466 Bacteria 3092
227 Ga0395898_0127400 3300037466 Bacteria 2439
228 Ga0395905_0047249 3300037471 Bacteria 4035
229 Ga0395901_0000153 3300038443 Bacteria 89901
230 Ga0395901_0022740 3300038443 Bacteria 6428
231 Ga0395901_0023368 3300038443 Bacteria 6336
232 Ga0395901_0077277 3300038443 Bacteria 3474
233 Ga0395901_0114051 3300038443 Bacteria 2838
234 Ga0395901_0140323 3300038443 Bacteria 2540
235 Ga0395901_0390557 3300038443 Bacteria 1431
236 Ga0451789_0860401 3300041443 Bacteria 1515
237 Ga0451793_0647713 3300041452 Bacteria 4454
238 Ga0439448_0006105 3300042005 Bacteria 3456
239 Ga0439459_0028482 3300042438 Bacteria 1121
240 Ga0466988_0129586 3300044536 Bacteria 1480
241 Ga0466969_0004104 3300044656 Bacteria 7728
242 Ga0466972_0096835 3300044658 Bacteria 1397
243 Ga0466975_0100364 3300044661 Bacteria 2060
244 Ga0466982_0000013 3300044672 Bacteria 136227
245 Ga0466965_0059372 3300044683 Bacteria 1908
246 Ga0466966_0002357 3300044684 Bacteria 12336
247 Ga0466966_0012331 3300044684 Bacteria 5662
248 Ga0466961_0000967 3300044693 Bacteria 17790
249 Ga0466961_0018450 3300044693 Bacteria 4487
250 Ga0466961_0034543 3300044693 Bacteria 3246
251 Ga0466961_0207976 3300044693 Bacteria 1208
252 Ga0466963_0331887 3300044694 Bacteria 1071
253 Ga0466964_0135477 3300044706 Bacteria 1126
254 Ga0466971_0013734 3300044719 Bacteria 3560
255 Ga0466968_0003334 3300044735 Bacteria 5928
256 Ga0466968_0034951 3300044735 Bacteria 2100
257 Ga0466970_0001936 3300044765 Bacteria 10013
258 Ga0466970_0042885 3300044765 Bacteria 2406
259 Ga0466970_0058537 3300044765 Bacteria 2063
260 Ga0466957_0021058 3300044842 Bacteria 3839
261 Ga0466960_0053071 3300044901 Bacteria 1963
262 Ga0466959_0000068 3300045049 Bacteria 73132
263 Ga0466959_0006835 3300045049 Bacteria 7952
264 Ga0466959_0014589 3300045049 Bacteria 5716
265 Ga0466959_0026130 3300045049 Bacteria 4329
266 Ga0451576_0002230 3300045051 Bacteria 29806
267 Ga0451576_0003351 3300045051 Bacteria 22193
268 Ga0451576_0019917 3300045051 Bacteria 7313
269 Ga0451576_0044827 3300045051 Bacteria 4659
270 Ga0466958_0009492 3300045836 Bacteria 5425
271 Ga0466958_0103421 3300045836 Bacteria 1773
272 Ga0466958_0117920 3300045836 Bacteria 1660
273 Ga0466967_0153027 3300045976 Bacteria 2158
274 Ga0466967_0265503 3300045976 Bacteria 1643
275 Ga0495617_000213 3300046452 Bacteria 35551
276 Ga0495617_000596 3300046452 Bacteria 18398
277 Ga0495590_0045702 3300046457 Bacteria 1528
278 Ga0495629_0051555 3300046459 Bacteria 2880
279 Ga0495638_0000007 3300046460 Bacteria 602783
280 Ga0495638_0001525 3300046460 Bacteria 20852
281 Ga0495638_0001952 3300046460 Bacteria 17692
282 Ga0495638_0001995 3300046460 Bacteria 17416
283 Ga0495650_0001484 3300046471 Bacteria 22453
284 Ga0495650_0003493 3300046471 Bacteria 11412
285 Ga0495605_0137391 3300046474 Bacteria 1098
286 Ga0495639_0008860 3300046475 Bacteria 4312
287 Ga0495584_0020467 3300046491 Bacteria 3361
288 Ga0495585_0000625 3300046492 Bacteria 32826
289 Ga0495585_0004279 3300046492 Bacteria 9295
290 Ga0495607_0000012 3300046501 Bacteria 195369
291 Ga0495607_0003406 3300046501 Bacteria 12186
292 Ga0495607_0003808 3300046501 Bacteria 11381
293 Ga0495583_0024175 3300046506 Bacteria 3058
294 Ga0495606_0001257 3300046507 Bacteria 35388
295 Ga0495606_0001303 3300046507 Bacteria 34371
296 Ga0495606_0002115 3300046507 Bacteria 24116
297 Ga0495606_0103278 3300046507 Bacteria 1731
298 Ga0495610_0095547 3300046512 Bacteria 1339
299 Ga0495616_0000423 3300046513 Bacteria 32568
300 Ga0495616_0018072 3300046513 Bacteria 3879
301 Ga0495620_0001298 3300046515 Bacteria 15206
302 Ga0495620_0020755 3300046515 Bacteria 3201
303 Ga0495631_0003656 3300046518 Bacteria 8398
304 Ga0495631_0008140 3300046518 Bacteria 5292
305 Ga0495632_0000019 3300046519 Bacteria 215713
306 Ga0495632_0048278 3300046519 Bacteria 2108
307 Ga0495632_0048953 3300046519 Bacteria 2091
308 Ga0495637_0013907 3300046520 Bacteria 3810
309 Ga0495648_0001269 3300046524 Bacteria 25185
310 Ga0495648_0004834 3300046524 Bacteria 11371
311 Ga0495645_0091699 3300046543 Bacteria 2170
312 Ga0495622_0023172 3300046557 Bacteria 2894
313 Ga0495668_0003294 3300046616 Bacteria 12234
314 Ga0495611_0000001 3300046648 Bacteria 2628469
315 Ga0495611_0000302 3300046648 Bacteria 33489
316 Ga0495625_0000325 3300046660 Bacteria 72731
317 Ga0495625_0005118 3300046660 Bacteria 12121
318 Ga0495625_0103878 3300046660 Bacteria 1948
319 Ga0495661_0001502 3300046665 Bacteria 19421
320 Ga0495661_0088458 3300046665 Bacteria 1768
321 Ga0495613_0211457 3300046689 Unclassified 1364
322 Ga0495670_0001722 3300046691 Bacteria 10770
323 Ga0495670_0010124 3300046691 Bacteria 4639
324 Ga0495671_0001281 3300046692 Bacteria 17150
325 Ga0495660_0000436 3300046810 Bacteria 34957
326 Ga0495660_0000755 3300046810 Bacteria 24422
327 Ga0495581_0203440 3300047315 Bacteria 1158
328 Ga0495676_0014567 3300047321 Bacteria 7035
329 Ga0495683_0000513 3300047323 Bacteria 29708
330 Ga0495679_000001 3300047446 Bacteria 1607568
331 Ga0495673_0000072 3300047469 Bacteria 213166
332 Ga0495673_0000498 3300047469 Bacteria 41800
333 Ga0495673_0001239 3300047469 Bacteria 21140
334 Ga0495673_0091420 3300047469 Bacteria 1243
335 Ga0495686_0000263 3300047472 Bacteria 94308
336 Ga0495686_0002324 3300047472 Bacteria 18174
337 Ga0495686_0007081 3300047472 Bacteria 8453
338 Ga0495686_0029536 3300047472 Bacteria 3565
339 Ga0495686_0047687 3300047472 Bacteria 2704
340 Ga0496101_0001284 3300048904 Bacteria 15020
341 Ga0496101_0027427 3300048904 Bacteria 3968
342 Ga0496104_0059537 3300048907 Bacteria 3616
343 Ga0496105_0001649 3300048908 Bacteria 15902
344 Ga0496106_0001522 3300048909 Bacteria 17429
345 Ga0496107_0317177 3300048910 Bacteria 1160
346 Ga0496115_0000025 3300048918 Bacteria 151658
347 Ga0496115_0001594 3300048918 Bacteria 16290
348 Ga0496115_0002239 3300048918 Bacteria 13857
349 Ga0496115_0022208 3300048918 Bacteria 4913
350 Ga0496116_0087529 3300048919 Bacteria 1906
351 Ga0496117_0004951 3300048920 Bacteria 14305
352 Ga0496117_0079718 3300048920 Bacteria 2156
353 Ga0496118_0002079 3300048921 Bacteria 28158
354 Ga0496118_0003060 3300048921 Bacteria 21484
355 Ga0496118_0004438 3300048921 Bacteria 16651
356 Ga0496118_0007552 3300048921 Bacteria 11483
357 Ga0496119_0000058 3300048922 Bacteria 173131
358 Ga0496119_0005728 3300048922 Bacteria 11775
359 Ga0496120_0001252 3300048923 Bacteria 31938
360 Ga0496120_0001892 3300048923 Bacteria 23232
361 Ga0496121_0000355 3300048924 Bacteria 94479
362 Ga0496121_0000401 3300048924 Bacteria 86663
363 Ga0496121_0003768 3300048924 Bacteria 21184
364 Ga0496121_0028181 3300048924 Bacteria 5234
365 Ga0496121_0052377 3300048924 Bacteria 3429
366 Ga0496121_0091335 3300048924 Bacteria 2377
367 Ga0496122_0011094 3300048925 Bacteria 9186
368 Ga0496122_0058326 3300048925 Bacteria 2859
369 Ga0496122_0103132 3300048925 Bacteria 1899
370 Ga0496122_0107430 3300048925 Bacteria 1844
371 Ga0496123_0017675 3300048926 Bacteria 5721
372 Ga0496123_0023067 3300048926 Bacteria 4776
373 Ga0496123_0147083 3300048926 Bacteria 1277
374 Ga0496124_0000472 3300048927 Bacteria 69226
375 Ga0496124_0001586 3300048927 Bacteria 32782
376 Ga0496125_0000137 3300048928 Bacteria 160328
377 Ga0496125_0112444 3300048928 Bacteria 1967
378 Ga0496126_0001102 3300048929 Bacteria 45348
379 Ga0496126_0010180 3300048929 Bacteria 9894
380 Ga0496126_0018597 3300048929 Bacteria 6879
381 Ga0496126_0024590 3300048929 Bacteria 5812
382 Ga0495678_000938 3300049459 Bacteria 25345
383 Ga0495678_045488 3300049459 Bacteria 1731
384 Ga0495682_0001348 3300049460 Bacteria 13552
385 Ga0495682_0006528 3300049460 Bacteria 4713
386 Ga0501031_0063950 3300049568 Bacteria 2396
387 Ga0501031_0227429 3300049568 Bacteria 1214
388 Ga0501032_0054014 3300049569 Bacteria 2704
389 Ga0501032_0142830 3300049569 Bacteria 1576
390 Ga0501033_0003826 3300049570 Bacteria 12248
391 Ga0501033_0049942 3300049570 Bacteria 3104
392 Ga0501034_0007216 3300049571 Bacteria 11862
393 Ga0501034_0103078 3300049571 Bacteria 2846
394 Ga0501034_0505762 3300049571 Bacteria 1122
395 Ga0501036_0093706 3300049572 Bacteria 2537
396 Ga0501036_0287613 3300049572 Bacteria 1375
397 Ga0501037_0014600 3300049573 Bacteria 5779
398 Ga0501037_0021707 3300049573 Bacteria 4749
399 Ga0501037_0119955 3300049573 Bacteria 1891
400 Ga0501038_0121558 3300049574 Bacteria 2152
401 Ga0501039_0019563 3300049575 Bacteria 5191
402 Ga0501039_0106446 3300049575 Bacteria 2190
403 Ga0501042_0121766 3300049578 Bacteria 1878
404 Ga0501043_0027969 3300049579 Bacteria 4425
405 Ga0501043_0079090 3300049579 Bacteria 2584
406 Ga0501043_0095879 3300049579 Bacteria 2331
407 Ga0501043_0109109 3300049579 Bacteria 2173
408 Ga0501046_0060278 3300049580 Bacteria 2969
409 Ga0501046_0258767 3300049580 Bacteria 1279
410 Ga0501047_0021278 3300049581 Bacteria 6226
411 Ga0501047_0069306 3300049581 Bacteria 3397
412 Ga0501047_0082631 3300049581 Bacteria 3087
413 Ga0501048_0043031 3300049582 Bacteria 3232
414 Ga0501048_0187866 3300049582 Bacteria 1464
415 Ga0501067_0016315 3300049583 Bacteria 4104
416 Ga0501068_0069678 3300049584 Bacteria 2144
417 Ga0501069_0004500 3300049585 Bacteria 7201
418 Ga0501070_0055622 3300049586 Bacteria 3280
419 Ga0501070_0111764 3300049586 Bacteria 2258
420 Ga0501071_0008690 3300049587 Bacteria 6720
421 Ga0501072_0066492 3300049588 Bacteria 2843
422 Ga0501073_0062716 3300049589 Bacteria 2592
423 Ga0501074_0126195 3300049590 Bacteria 1830
424 Ga0501074_0352268 3300049590 Bacteria 1045
425 Ga0501079_0181922 3300049741 Bacteria 1640
426 Ga0501080_0067951 3300049742 Bacteria 3315
427 Ga0501080_0134691 3300049742 Bacteria 2286
428 Ga0501081_0026028 3300049743 Bacteria 3942
429 Ga0501083_0019313 3300049744 Bacteria 4747
430 Ga0501035_0022115 3300049822 Bacteria 5840
431 Ga0501035_0029797 3300049822 Bacteria 4977
432 Ga0501035_0070551 3300049822 Bacteria 3094
433 Ga0501035_0072196 3300049822 Bacteria 3055
434 Ga0501035_0150545 3300049822 Bacteria 2019
435 Ga0501044_0009120 3300049823 Bacteria 10836
436 Ga0501044_0011125 3300049823 Bacteria 9758
437 Ga0501044_0011526 3300049823 Bacteria 9579
438 Ga0501044_0039154 3300049823 Bacteria 4946
439 Ga0501044_0069687 3300049823 Bacteria 3579
440 Ga0501044_0146283 3300049823 Bacteria 2348
441 Ga0501044_0503697 3300049823 Bacteria 1112
442 Ga0501045_0042743 3300049824 Bacteria 3299
443 Ga0500643_000120 3300053087 Bacteria 81701
444 Ga0500555_003312 3300053103 Bacteria 4589
445 Ga0500633_0047848 3300053160 Bacteria 1464
446 Ga0500645_054758 3300053730 Bacteria 1160
447 Ga0501082_0013739 3300060353 Bacteria 6960
448 Ga0466962_0002058 3300061719 Bacteria 9523
449 Ga0466962_0011870 3300061719 Bacteria 4193
450 Ga0466962_0034803 3300061719 Bacteria 2412
451 2687583356 2687453130 Bacteria 4227172
452 2721028591 2718218334 Bacteria 4765486
453 2735835818 2734482264 Unclassified 5014763
454 2739226977 2738543009 Bacteria 4944499
455 2739731923 2739367700 Bacteria 4747630
456 2842915036 2842914999 Bacteria 4419378
457 2884339597 2884338543 Bacteria 4610696
458 2884413346 2884411467 Bacteria 5246714
459 2895396911 2895395659 Bacteria 3983269
460 2919086767 2919085039 Bacteria 4532964
461 2928964621 2928963466 Bacteria 5165703
462 2941473815 2941471342 Bacteria 5018624
463 Ga0439459_0002784
464 JGI24736J21556_1005346
465 JGI24740J21852_10036882
466 JGI24739J22299_10000301
467 JGI24739J22299_10011742
468 JGI24737J22298_10013115
469 JGI24735J21928_10002905
470 JGI25156J39149_1003537
471 JGI25156J39149_1018358
472 JGI25162J39368_1000226
473 JGI25162J39368_1000311
474 JGI25162J39368_1001518
475 JGI25154J39366_1003123
476 JGI25157J39369_1000345
477 JGI25157J39369_1000541
478 JGI25157J39369_1001544
479 JGI25157J39369_1002040
480 JGI25163J39215_1000171
481 JGI25164J39214_1000035
482 JGI25164J39214_1000214
483 JGI25165J46597_1000226
484 JGI25165J46597_1000260
485 rootH1_10078943
486 rootH1_10110464
487 rootH2_10004402
488 rootH1_10081813
489 Ga0006562J51391_1016739
490 Ga0055538_1002687
491 Ga0055539_1002136
492 Ga0055525_1000452
493 Ga0055527_1000082
494 Ga0055527_1000215
495 Ga0055535_1000143
496 Ga0055535_1000323
497 Ga0055535_1000593
498 Ga0055535_1000764
499 Ga0055535_1001245
500 Ga0055542_1000067
501 Ga0055542_1000190
502 Ga0055542_1000275
503 Ga0055542_1000474
504 Ga0055542_1000622
505 Ga0055542_1001232
506 Ga0055529_1000217
507 Ga0055529_1000233
508 Ga0055529_1000785
509 Ga0055529_1000981
510 Ga0065165_1001244
511 Ga0070682_100003164
512 Ga0070660_100007972
513 Ga0070689_100026023
514 Ga0070661_100040150
515 Ga0070661_100064440
516 Ga0070659_100003931
517 Ga0070659_100005746
518 Ga0070667_100026038
519 Ga0070694_100129815
520 Ga0070708_100013915
521 Ga0070708_100250207
522 Ga0070663_100009533
523 Ga0070663_100173414
524 Ga0070662_100440461
525 Ga0070681_10005861
526 Ga0070706_100002803
527 Ga0070706_100010630
528 Ga0070706_100245799
529 Ga0070707_100010560
530 Ga0070698_100287192
531 Ga0070684_100312131
532 Ga0070697_100019797
533 Ga0068853_100007191
534 Ga0070686_100093804
535 Ga0070696_100018008
536 Ga0070696_100107858
537 Ga0070696_100240690
538 Ga0070665_100000062
539 Ga0068855_100003219
540 Ga0068855_100012550
541 Ga0068854_100000486
542 Ga0068856_100000652
543 Ga0068852_100013145
544 Ga0068851_10023482
545 Ga0068860_100042799
546 Ga0068862_100244573
547 Ga0097621_100062453
548 Ga0105240_10003480
549 Ga0105240_10104070
550 Ga0105247_10006226
551 Ga0105241_10057833
552 Ga0105237_10000007
553 Ga0105237_10000152
554 Ga0105238_10010397
555 Ga0105238_10054149
556 Ga0105239_10000020
557 Ga0105239_10012353
558 Ga0105239_10066714
559 Ga0157314_1000152
560 Ga0157347_1004411
561 Ga0157373_10005976
562 Ga0157371_10015441
563 Ga0157371_10060816
564 Ga0157370_10000422
565 Ga0157370_10006899
566 Ga0157370_10027335
567 Ga0157370_10594755
568 Ga0157369_10018954
569 Ga0157369_10383813
570 Ga0157369_10459262
571 Ga0163162_10008117
572 Ga0157372_10010257
573 Ga0157372_10130489
574 Ga0157372_10388165
575 Ga0182008_10014201
576 Ga0157376_10128370
577 Ga0182006_1000475
578 Ga0182005_1000261
579 Ga0182005_1005465
580 Ga0183369_1006
581 Ga0183368_1003
582 Ga0163161_10002263
583 Ga0209760_100210
584 Ga0209784_100068
585 Ga0209566_102136
586 Ga0209674_100012
587 Ga0209674_100119
588 Ga0209674_100748
589 Ga0209672_100007
590 Ga0209672_100016
591 Ga0209672_100357
592 Ga0209672_100955
593 Ga0209672_101331
594 Ga0209563_100051
595 Ga0207427_100033
596 Ga0207427_100156
597 Ga0207427_102011
598 Ga0209437_100105
599 Ga0209437_100126
600 Ga0209437_100147
601 Ga0209437_102839
602 Ga0209258_100012
603 Ga0209258_100046
604 Ga0209258_100049
605 Ga0209258_100095
606 Ga0209258_100245
607 Ga0209258_101576
608 Ga0209646_1000517
609 Ga0209646_1001035
610 Ga0209026_1000099
611 Ga0209026_1000140
612 Ga0209026_1000391
613 Ga0209148_1000002
614 Ga0209148_1000010
615 Ga0209148_1000014
616 Ga0209148_1000039
617 Ga0209148_1000087
618 Ga0209148_1000098
619 Ga0209759_1000316
620 Ga0209759_1000338
621 Ga0209759_1000483
622 Ga0209759_1003052
623 Ga0209129_1003064
624 Ga0209233_1000009
625 Ga0209233_1000080
626 Ga0209233_1016038
627 Ga0209455_1000010
628 Ga0209455_1000014
629 Ga0209455_1000034
630 Ga0209455_1000086
631 Ga0209455_1000357
632 Ga0209455_1003310
633 Ga0209455_1008200
634 Ga0209758_1008379
635 Ga0207656_10021374
636 Ga0207710_10007900
637 Ga0207647_10000287
638 Ga0207647_10001225
639 Ga0207647_10155733
640 Ga0207684_10001469
641 Ga0207684_10011852
642 Ga0207695_10001214
643 Ga0207695_10001325
644 Ga0207695_10005709
645 Ga0207671_10000031
646 Ga0207671_10000074
647 Ga0207657_10020103
648 Ga0207649_10141818
649 Ga0207649_10188609
650 Ga0207694_10253528
651 Ga0207690_10004302
652 Ga0207690_10013951
653 Ga0207690_10126821
654 Ga0207706_10108056
655 Ga0207667_10001044
656 Ga0207667_10001074
657 Ga0207667_10025715
658 Ga0207667_10063039
659 Ga0207640_10000485
660 Ga0207640_10001056
661 Ga0207639_10023136
662 Ga0207678_10002963
663 Ga0207678_10050731
664 Ga0207678_10054243
665 Ga0207702_10000185
666 Ga0207702_10003329
667 Ga0207702_10523748
668 Ga0207702_10609296
669 Ga0207674_10000685
670 Ga0207674_10367913
671 Ga0207698_10387901
672 Ga0268266_10000001
673 Ga0268265_10173583
674 Ga0265327_10000585
675 Ga0265327_10006343
676 Ga0265327_10016325
677 Ga0265327_10039192
678 Ga0265313_10005166
679 Ga0265314_10009610
680 Ga0395899_0000175
681 Ga0395900_0000012
682 Ga0395900_0002590
683 Ga0395900_0009916
684 Ga0395900_0060414
685 Ga0395898_0000034
686 Ga0395898_0000902
687 Ga0395898_0005590
688 Ga0395898_0082804
689 Ga0395898_0127400
690 Ga0395905_0047249
691 Ga0395901_0000153
692 Ga0395901_0022740
693 Ga0395901_0023368
694 Ga0395901_0077277
695 Ga0395901_0114051
696 Ga0395901_0140323
697 Ga0395901_0390557
698 Ga0451789_0860401
699 Ga0451793_0647713
700 Ga0439448_0006105
701 Ga0439459_0028482
702 Ga0466988_0129586
703 Ga0466969_0004104
704 Ga0466972_0096835
705 Ga0466975_0100364
706 Ga0466982_0000013
707 Ga0466965_0059372
708 Ga0466966_0002357
709 Ga0466966_0012331
710 Ga0466961_0000967
711 Ga0466961_0018450
712 Ga0466961_0034543
713 Ga0466961_0207976
714 Ga0466963_0331887
715 Ga0466964_0135477
716 Ga0466971_0013734
717 Ga0466968_0003334
718 Ga0466968_0034951
719 Ga0466970_0001936
720 Ga0466970_0042885
721 Ga0466970_0058537
722 Ga0466957_0021058
723 Ga0466960_0053071
724 Ga0466959_0000068
725 Ga0466959_0006835
726 Ga0466959_0014589
727 Ga0466959_0026130
728 Ga0451576_0002230
729 Ga0451576_0003351
730 Ga0451576_0019917
731 Ga0451576_0044827
732 Ga0466958_0009492
733 Ga0466958_0103421
734 Ga0466958_0117920
735 Ga0466967_0153027
736 Ga0466967_0265503
737 Ga0495617_000213
738 Ga0495617_000596
739 Ga0495590_0045702
740 Ga0495629_0051555
741 Ga0495638_0000007
742 Ga0495638_0001525
743 Ga0495638_0001952
744 Ga0495638_0001995
745 Ga0495650_0001484
746 Ga0495650_0003493
747 Ga0495605_0137391
748 Ga0495639_0008860
749 Ga0495584_0020467
750 Ga0495585_0000625
751 Ga0495585_0004279
752 Ga0495607_0000012
753 Ga0495607_0003406
754 Ga0495607_0003808
755 Ga0495583_0024175
756 Ga0495606_0001257
757 Ga0495606_0001303
758 Ga0495606_0002115
759 Ga0495606_0103278
760 Ga0495610_0095547
761 Ga0495616_0000423
762 Ga0495616_0018072
763 Ga0495620_0001298
764 Ga0495620_0020755
765 Ga0495631_0003656
766 Ga0495631_0008140
767 Ga0495632_0000019
768 Ga0495632_0048278
769 Ga0495632_0048953
770 Ga0495637_0013907
771 Ga0495648_0001269
772 Ga0495648_0004834
773 Ga0495645_0091699
774 Ga0495622_0023172
775 Ga0495668_0003294
776 Ga0495611_0000001
777 Ga0495611_0000302
778 Ga0495625_0000325
779 Ga0495625_0005118
780 Ga0495625_0103878
781 Ga0495661_0001502
782 Ga0495661_0088458
783 Ga0495613_0211457
784 Ga0495670_0001722
785 Ga0495670_0010124
786 Ga0495671_0001281
787 Ga0495660_0000436
788 Ga0495660_0000755
789 Ga0495581_0203440
790 Ga0495676_0014567
791 Ga0495683_0000513
792 Ga0495679_000001
793 Ga0495673_0000072
794 Ga0495673_0000498
795 Ga0495673_0001239
796 Ga0495673_0091420
797 Ga0495686_0000263
798 Ga0495686_0002324
799 Ga0495686_0007081
800 Ga0495686_0029536
801 Ga0495686_0047687
802 Ga0496101_0001284
803 Ga0496101_0027427
804 Ga0496104_0059537
805 Ga0496105_0001649
806 Ga0496106_0001522
807 Ga0496107_0317177
808 Ga0496115_0000025
809 Ga0496115_0001594
810 Ga0496115_0002239
811 Ga0496115_0022208
812 Ga0496116_0087529
813 Ga0496117_0004951
814 Ga0496117_0079718
815 Ga0496118_0002079
816 Ga0496118_0003060
817 Ga0496118_0004438
818 Ga0496118_0007552
819 Ga0496119_0000058
820 Ga0496119_0005728
821 Ga0496120_0001252
822 Ga0496120_0001892
823 Ga0496121_0000355
824 Ga0496121_0000401
825 Ga0496121_0003768
826 Ga0496121_0028181
827 Ga0496121_0052377
828 Ga0496121_0091335
829 Ga0496122_0011094
830 Ga0496122_0058326
831 Ga0496122_0103132
832 Ga0496122_0107430
833 Ga0496123_0017675
834 Ga0496123_0023067
835 Ga0496123_0147083
836 Ga0496124_0000472
837 Ga0496124_0001586
838 Ga0496125_0000137
839 Ga0496125_0112444
840 Ga0496126_0001102
841 Ga0496126_0010180
842 Ga0496126_0018597
843 Ga0496126_0024590
844 Ga0495678_000938
845 Ga0495678_045488
846 Ga0495682_0001348
847 Ga0495682_0006528
848 Ga0501031_0063950
849 Ga0501031_0227429
850 Ga0501032_0054014
851 Ga0501032_0142830
852 Ga0501033_0003826
853 Ga0501033_0049942
854 Ga0501034_0007216
855 Ga0501034_0103078
856 Ga0501034_0505762
857 Ga0501036_0093706
858 Ga0501036_0287613
859 Ga0501037_0014600
860 Ga0501037_0021707
861 Ga0501037_0119955
862 Ga0501038_0121558
863 Ga0501039_0019563
864 Ga0501039_0106446
865 Ga0501042_0121766
866 Ga0501043_0027969
867 Ga0501043_0079090
868 Ga0501043_0095879
869 Ga0501043_0109109
870 Ga0501046_0060278
871 Ga0501046_0258767
872 Ga0501047_0021278
873 Ga0501047_0069306
874 Ga0501047_0082631
875 Ga0501048_0043031
876 Ga0501048_0187866
877 Ga0501067_0016315
878 Ga0501068_0069678
879 Ga0501069_0004500
880 Ga0501070_0055622
881 Ga0501070_0111764
882 Ga0501071_0008690
883 Ga0501072_0066492
884 Ga0501073_0062716
885 Ga0501074_0126195
886 Ga0501074_0352268
887 Ga0501079_0181922
888 Ga0501080_0067951
889 Ga0501080_0134691
890 Ga0501081_0026028
891 Ga0501083_0019313
892 Ga0501035_0022115
893 Ga0501035_0029797
894 Ga0501035_0070551
895 Ga0501035_0072196
896 Ga0501035_0150545
897 Ga0501044_0009120
898 Ga0501044_0011125
899 Ga0501044_0011526
900 Ga0501044_0039154
901 Ga0501044_0069687
902 Ga0501044_0146283
903 Ga0501044_0503697
904 Ga0501045_0042743
905 Ga0500643_000120
906 Ga0500555_003312
907 Ga0500633_0047848
908 Ga0500645_054758
909 Ga0501082_0013739
910 Ga0466962_0002058
911 Ga0466962_0011870
912 Ga0466962_0034803
913 2687583356
914 2721028591
915 2735835818
916 2739226977
917 2739731923
918 2842915036
919 2884339597
920 2884413346
921 2895396911
922 2919086767
923 2928964621
924 2941473815

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07920

DUF1684

Protein of unknown function (DUF1684)

190

327

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fj4-assembly2.cif.gz_A crystal structure of the protein q9hre7 complexed with mercury from halobacterium salinarium at the resolution 2.1a, northeast structural genomics consortium target hsr50 0.9077 150 289
4fj4-assembly1.cif.gz_B crystal structure of the protein q9hre7 complexed with mercury from halobacterium salinarium at the resolution 2.1a, northeast structural genomics consortium target hsr50 0.8941 150 290
4dlh-assembly2.cif.gz_B crystal structure of the protein q9hre7 from halobacterium salinarium at the resolution 1.9a, northeast structural genomics consortium (nesg) target hsr50 0.876 150 289
2lok-assembly1.cif.gz_A solution nmr structure of the uncharacterized protein from gene locus vng_0733h of halobacterium salinarium, northeast structural genomics consortium target hsr50 0.8456 150 293
2lnu-assembly1.cif.gz_A solution nmr structure of the uncharacterized protein from gene locus rrnac0354 of haloarcula marismortui, northeast structural genomics consortium target hmr11 0.7673 150 292
ID Description Score Start End Superfamily
2grgA01 Alpha Beta;3-Layer(aba) Sandwich;Profilin-like;YNR034W-A-like 0.7944 123 144 3.40.1840.10
af_Q54ST8_470_584_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.7438 53 143 2.60.200.20
af_B7Z0D7_3_100_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.7339 53 124 2.60.200.20
af_A2VEV2_3_96_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.7323 53 125 2.60.200.20
af_Q851R6_746_850_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.7237 45 134 2.60.200.20
ID Description Score Start End GO Terms
AF-A0A7X5TQA8-F1-model_v4 DUF1684 domain-containing protein 0.9794 23 291
AF-A0A0K8QR94-F1-model_v4 DUF1684 domain-containing protein 0.963 22 291
AF-A0A3D1B1V7-F1-model_v4 DUF1684 domain-containing protein 0.96 121 292
AF-A0A7X5TQA8-F1-model_v4 DUF1684 domain-containing protein 0.9583 23 291
AF-A0A539E1D3-F1-model_v4 DUF1684 domain-containing protein 0.9558 23 290

Map