F448986

General Info

Members Datasets Scaffolds Average Seq Length
462 288 429 487

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0001324|Ga0501034_0001324_3079_4521
Length 480
Sequence MGKVTGFLEYQRLAEAAENKDERVKHYREFVLHLTDQEAGQQGARCMDCGIPFCMTGCPINNIIPDWNDLVYRQNWKQAIETLHSTNNFPEFTGRVCPAPCEAACTLNINNDPVGIKSIEHAIIDKAWEEGWVGAEPSSGRTGKKVAVVGSGPAGLACAQQLARAGHEVVLMEKNDRIGGLLRYGIPDFKMEKHLIDRRMEQMQDEGVRFQTNTHVGGTGPNAVSAESLLKEYDAVVLSGGAEQPRDLPIPGRDLAGVHFAMEFLPQQNKVVAGDKVPNQIMATGKHVVVIGGGDTGSDCVGTSNRHGAASVTQFELMPQPPEQENKPLVWPNWPLKLRTSSSHEEGCQRDWAVATKAFVGENGKVKALKAVRVEWKDGKMAEVPGSEWEVKADLVLLAMGFVGPVQGGLLEQFGVDKDARSNVKADTDGPKAYATSVPKVFAAGDMRRGQSLVVWAIREGRQCARAVDEFLMGTSDLPR

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
3 2547132512 Azospira oryzae 6a3 Isolate Unclassified
4 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
5 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
6 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
7 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
8 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
9 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
10 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
11 2643221570 Acidovorax sp. Root568 Isolate Unclassified
12 2643221585 Pelomonas sp. Root662 Isolate Unclassified
13 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
14 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
15 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
16 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
17 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
18 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
19 2643221652 Acidovorax sp. Root402 Isolate Unclassified
20 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
21 2643221656 Pelomonas sp. Root405 Isolate Unclassified
22 2643221660 Methylibium sp. Root1272 Isolate Unclassified
23 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
24 2738541337 Pelomonas sp. BT06 Isolate Unclassified
25 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
26 2831864461 Roseateles noduli HZ7 Isolate Nodule
27 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
28 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
29 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
30 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
31 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
32 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
33 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
34 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
35 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
36 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
37 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
38 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
39 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
40 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
41 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
42 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
43 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
44 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
45 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
46 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
47 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
48 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
49 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
50 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
51 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
52 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
53 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
54 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
55 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
56 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
57 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
58 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
59 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
60 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
61 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
62 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
63 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
64 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
85 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
94 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
107 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
108 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
109 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
114 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
115 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
116 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
118 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
119 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
159 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
160 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
168 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
169 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
170 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
171 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
172 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
173 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
174 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
189 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
190 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
191 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
192 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
201 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
202 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
203 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
204 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
207 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
208 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
223 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
224 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
225 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
226 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
227 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
228 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
229 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
230 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
231 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
235 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
240 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
241 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
242 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
254 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
257 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
258 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
266 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
267 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
268 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
269 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
270 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
271 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
279 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
280 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
281 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
282 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
283 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
284 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
285 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
286 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.86
Metatranscriptomes 0
Isolates 7.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.92
Nodule 1.52
Rhizoplane 3.25
Rhizosphere 51.52
Stem 0
Stem Tuber 0
Unclassified 15.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003711 3300001979 Bacteria 6650
2 JGI25155J39150_1000022 3300002704 Bacteria 142950
3 JGI25156J39149_1000005 3300002705 Bacteria 263980
4 JGI25154J39366_1000017 3300002738 Bacteria 252448
5 JGI25157J39369_1000003 3300002741 Bacteria 274935
6 JGI25152J39213_1000662 3300002773 Bacteria 17998
7 JGI25152J39213_1000883 3300002773 Bacteria 14764
8 JGI25150J39212_1009308 3300002774 Bacteria 1878
9 JGI25153J46596_10002020 3300003215 Bacteria 11977
10 JGI25153J46596_10002816 3300003215 Bacteria 9881
11 JGI25160J50197_1000302 3300003354 Bacteria 34832
12 JGI25160J50197_1000691 3300003354 Bacteria 18646
13 JGI25161J50226_1000341 3300003374 Bacteria 25069
14 Ga0055525_1000004 3300003759 Bacteria 888039
15 Ga0055529_1000948 3300003763 Bacteria 15232
16 Ga0055526_1001565 3300003771 Bacteria 16108
17 Ga0055526_1001607 3300003771 Bacteria 15868
18 Ga0055537_1000205 3300003773 Bacteria 44266
19 Ga0055524_1000052 3300003775 Bacteria 144959
20 Ga0055524_1000073 3300003775 Bacteria 123033
21 Ga0055524_1001048 3300003775 Bacteria 17068
22 Ga0055524_1002553 3300003775 Bacteria 9291
23 Ga0055536_1007193 3300003781 Bacteria 5027
24 Ga0055528_1004238 3300003790 Bacteria 6950
25 Ga0055530_10001844 3300003791 Bacteria 14594
26 Ga0055530_10014402 3300003791 Bacteria 2637
27 Ga0055540_1000037 3300003792 Bacteria 162957
28 Ga0055540_1000123 3300003792 Bacteria 80351
29 Ga0055531_10000108 3300003794 Bacteria 90059
30 Ga0055531_10001826 3300003794 Bacteria 15080
31 Ga0055531_10003190 3300003794 Bacteria 10533
32 Ga0055531_10007545 3300003794 Bacteria 5907
33 Ga0055531_10009569 3300003794 Bacteria 4940
34 Ga0055543_1001154 3300004625 Bacteria 11280
35 Ga0055543_1006077 3300004625 Bacteria 2980
36 Ga0065165_1000290 3300005262 Bacteria 85623
37 Ga0065165_1000684 3300005262 Bacteria 48557
38 Ga0065165_1001212 3300005262 Bacteria 29719
39 Ga0065165_1026999 3300005262 Bacteria 1878
40 Ga0070676_10003787 3300005328 Bacteria 7937
41 Ga0068868_100019190 3300005338 Bacteria 5122
42 Ga0070660_100000555 3300005339 Bacteria 25061
43 Ga0070661_100002687 3300005344 Bacteria 12175
44 Ga0070675_100005061 3300005354 Bacteria 10064
45 Ga0070671_100033006 3300005355 Bacteria 4279
46 Ga0070671_100064618 3300005355 Bacteria 3047
47 Ga0070674_100007278 3300005356 Bacteria 6517
48 Ga0070667_100012357 3300005367 Bacteria 7062
49 Ga0070708_100161699 3300005445 Bacteria 2087
50 Ga0070663_100010090 3300005455 Bacteria 5875
51 Ga0070663_100032401 3300005455 Bacteria 3602
52 Ga0070678_100038037 3300005456 Bacteria 3384
53 Ga0068867_100000039 3300005459 Bacteria 80301
54 Ga0068867_100005426 3300005459 Bacteria 9022
55 Ga0068867_100043161 3300005459 Bacteria 3301
56 Ga0070706_100001854 3300005467 Bacteria 21867
57 Ga0070679_100012650 3300005530 Bacteria 8072
58 Ga0070672_100004285 3300005543 Bacteria 9326
59 Ga0068855_100046126 3300005563 Bacteria 5152
60 Ga0068857_100020031 3300005577 Bacteria 5881
61 Ga0068856_100151763 3300005614 Bacteria 2326
62 Ga0068852_100128212 3300005616 Bacteria 2333
63 Ga0068864_100127027 3300005618 Bacteria 2286
64 Ga0068863_100150337 3300005841 Bacteria 2228
65 Ga0075368_10015805 3300006042 Bacteria 2804
66 Ga0075364_10009124 3300006051 Bacteria 5941
67 Ga0075367_10051207 3300006178 Bacteria 2440
68 Ga0075369_10000297 3300006186 Bacteria 14806
69 Ga0075366_10003152 3300006195 Bacteria 8631
70 Ga0075366_10030163 3300006195 Bacteria 3187
71 Ga0075366_10051256 3300006195 Bacteria 2452
72 Ga0075370_10014328 3300006353 Bacteria 4228
73 Ga0075370_10061547 3300006353 Bacteria 2138
74 Ga0075430_100104660 3300006846 Bacteria 2362
75 Ga0099823_1000016 3300006944 Bacteria 87614
76 Ga0079104_1000073 3300006946 Bacteria 152269
77 Ga0105251_10000708 3300009011 Bacteria 30704
78 Ga0105244_10045606 3300009036 Bacteria 2254
79 Ga0105240_10006365 3300009093 Bacteria 17386
80 Ga0105240_10238409 3300009093 Bacteria 2110
81 Ga0105243_10004160 3300009148 Bacteria 11482
82 Ga0105237_10109306 3300009545 Bacteria 2757
83 Ga0105238_10011454 3300009551 Bacteria 8929
84 Ga0105239_10005759 3300010375 Bacteria 14455
85 Ga0157319_1000005 3300012497 Bacteria 372810
86 Ga0157326_1000719 3300012513 Bacteria 3878
87 Ga0157373_10071137 3300013100 Bacteria 2458
88 Ga0157370_10048004 3300013104 Bacteria 4091
89 Ga0157369_10092998 3300013105 Bacteria 3219
90 Ga0157374_10000251 3300013296 Bacteria 49614
91 Ga0157378_10009948 3300013297 Bacteria 8291
92 Ga0163162_10002127 3300013306 Bacteria 18607
93 Ga0163162_10152837 3300013306 Bacteria 2426
94 Ga0157372_10002048 3300013307 Bacteria 21930
95 Ga0157375_10037995 3300013308 Bacteria 4619
96 Ga0157375_10223883 3300013308 Bacteria 2040
97 Ga0157375_10261979 3300013308 Bacteria 1890
98 Ga0157377_10000044 3300014745 Bacteria 100420
99 Ga0157376_10041299 3300014969 Bacteria 3776
100 Ga0163161_10072049 3300017792 Bacteria 2530
101 Ga0213872_10000067 3300021361 Bacteria 92410
102 Ga0213872_10000104 3300021361 Bacteria 78306
103 Ga0213872_10000131 3300021361 Bacteria 68632
104 Ga0213872_10020215 3300021361 Bacteria 3068
105 Ga0209435_100002 3300025206 Bacteria 794178
106 Ga0209436_109593 3300025208 Bacteria 1830
107 Ga0209566_100312 3300025225 Bacteria 43942
108 Ga0209672_100054 3300025228 Bacteria 222217
109 Ga0209672_100214 3300025228 Bacteria 45404
110 Ga0209147_100085 3300025229 Bacteria 185813
111 Ga0209563_100013 3300025230 Bacteria 941463
112 Ga0207425_1000513 3300025245 Bacteria 23641
113 Ga0207425_1000700 3300025245 Bacteria 18130
114 Ga0207425_1002914 3300025245 Bacteria 5732
115 Ga0209646_1000001 3300025246 Bacteria 3092932
116 Ga0209026_1000001 3300025250 Bacteria 1228671
117 Ga0209148_1000119 3300025254 Bacteria 188079
118 Ga0209759_1000001 3300025256 Bacteria 2799452
119 Ga0209129_1000012 3300025258 Bacteria 541516
120 Ga0209565_1000128 3300025263 Bacteria 108959
121 Ga0209565_1006771 3300025263 Bacteria 3174
122 Ga0209455_1000244 3300025272 Bacteria 67136
123 Ga0209673_1000008 3300025273 Bacteria 626013
124 Ga0209673_1026045 3300025273 Bacteria 1930
125 Ga0209130_1000072 3300025284 Bacteria 175726
126 Ga0209130_1000338 3300025284 Bacteria 53907
127 Ga0209675_1000099 3300025291 Bacteria 128911
128 Ga0209675_1009712 3300025291 Bacteria 3370
129 Ga0209676_1000023 3300025292 Bacteria 589732
130 Ga0209676_1002528 3300025292 Bacteria 12755
131 Ga0209025_1003424 3300025294 Bacteria 15050
132 Ga0209025_1006683 3300025294 Bacteria 8854
133 Ga0209564_1000008 3300025295 Bacteria 953227
134 Ga0209564_1000022 3300025295 Bacteria 555109
135 Ga0209564_1000543 3300025295 Bacteria 60959
136 Ga0209564_1001126 3300025295 Bacteria 31456
137 Ga0209564_1003454 3300025295 Bacteria 10790
138 Ga0209758_1000124 3300025297 Bacteria 189933
139 Ga0209758_1000234 3300025297 Bacteria 116217
140 Ga0209758_1008785 3300025297 Bacteria 6441
141 Ga0209050_1000022 3300025298 Bacteria 565239
142 Ga0209050_1000691 3300025298 Bacteria 50632
143 Ga0209050_1000718 3300025298 Bacteria 48528
144 Ga0209050_1005250 3300025298 Bacteria 8254
145 Ga0209256_1000001 3300025299 Bacteria 2166974
146 Ga0209256_1000036 3300025299 Bacteria 386664
147 Ga0209256_1000410 3300025299 Bacteria 67789
148 Ga0209256_1000820 3300025299 Bacteria 39537
149 Ga0207426_1000199 3300025302 Bacteria 145826
150 Ga0207426_1000319 3300025302 Bacteria 92696
151 Ga0207426_1010030 3300025302 Bacteria 3704
152 Ga0209051_1000013 3300025303 Bacteria 565239
153 Ga0209051_1000068 3300025303 Bacteria 220063
154 Ga0209051_1000196 3300025303 Bacteria 107028
155 Ga0209051_1000726 3300025303 Bacteria 35771
156 Ga0209051_1003464 3300025303 Bacteria 10334
157 Ga0209257_1000033 3300025304 Bacteria 671006
158 Ga0209257_1000042 3300025304 Bacteria 537149
159 Ga0209257_1000146 3300025304 Bacteria 194261
160 Ga0209257_1000305 3300025304 Bacteria 107001
161 Ga0209257_1000774 3300025304 Bacteria 47334
162 Ga0209257_1029362 3300025304 Bacteria 1792
163 Ga0207713_1006261 3300025735 Bacteria 7282
164 Ga0207682_10012836 3300025893 Bacteria 3268
165 Ga0207680_10040997 3300025903 Bacteria 2699
166 Ga0207647_10060710 3300025904 Bacteria 2310
167 Ga0207645_10012827 3300025907 Bacteria 5674
168 Ga0207705_10041012 3300025909 Bacteria 3321
169 Ga0207684_10003264 3300025910 Bacteria 15912
170 Ga0207695_10054142 3300025913 Bacteria 4192
171 Ga0207671_10026445 3300025914 Bacteria 4348
172 Ga0207657_10001751 3300025919 Bacteria 23419
173 Ga0207652_10026392 3300025921 Bacteria 4837
174 Ga0207652_10029190 3300025921 Bacteria 4609
175 Ga0207681_10003514 3300025923 Bacteria 9755
176 Ga0207650_10001276 3300025925 Bacteria 18258
177 Ga0207644_10000523 3300025931 Bacteria 24867
178 Ga0207706_10001906 3300025933 Bacteria 20489
179 Ga0207706_10064645 3300025933 Bacteria 3221
180 Ga0207709_10001856 3300025935 Bacteria 14068
181 Ga0207691_10003381 3300025940 Bacteria 15525
182 Ga0207679_10000586 3300025945 Bacteria 24349
183 Ga0207679_10045027 3300025945 Bacteria 3189
184 Ga0207667_10008622 3300025949 Bacteria 12092
185 Ga0207667_10131525 3300025949 Bacteria 2578
186 Ga0207658_10027073 3300025986 Bacteria 4026
187 Ga0207677_10100440 3300026023 Bacteria 2127
188 Ga0207677_10109322 3300026023 Bacteria 2055
189 Ga0207678_10019929 3300026067 Bacteria 5895
190 Ga0207648_10000109 3300026089 Bacteria 80648
191 Ga0207648_10004239 3300026089 Bacteria 14817
192 Ga0207648_10010311 3300026089 Bacteria 8871
193 Ga0207676_10106296 3300026095 Bacteria 2338
194 Ga0207676_10198170 3300026095 Bacteria 1772
195 Ga0207683_10057106 3300026121 Bacteria 3426
196 Ga0209281_1000736 3300027111 Bacteria 32018
197 Ga0209389_1005959 3300027296 Bacteria 10495
198 Ga0209996_1000374 3300027395 Bacteria 5459
199 Ga0209995_1000276 3300027471 Bacteria 8046
200 Ga0209968_1000055 3300027526 Bacteria 20254
201 Ga0209970_1001251 3300027614 Bacteria 4494
202 Ga0209966_1000136 3300027695 Bacteria 30875
203 Ga0209974_10002020 3300027876 Bacteria 7405
204 Ga0268264_10068446 3300028381 Bacteria 3000
205 Ga0307517_10001980 3300028786 Bacteria 33373
206 Ga0307515_10000011 3300028794 Bacteria 633903
207 Ga0307515_10000138 3300028794 Bacteria 173220
208 Ga0307515_10000281 3300028794 Bacteria 125306
209 Ga0307515_10001206 3300028794 Bacteria 59045
210 Ga0307515_10010956 3300028794 Bacteria 17284
211 Ga0307515_10028743 3300028794 Bacteria 9433
212 Ga0307515_10109937 3300028794 Bacteria 3231
213 Ga0307515_10143574 3300028794 Bacteria 2544
214 Ga0307515_10162215 3300028794 Bacteria 2273
215 Ga0307515_10180559 3300028794 Bacteria 2062
216 Ga0307512_10043659 3300030522 Bacteria 3695
217 Ga0307512_10091582 3300030522 Bacteria 2114
218 Ga0265332_10000027 3300031238 Bacteria 190796
219 Ga0265332_10000271 3300031238 Bacteria 41210
220 Ga0265328_10009718 3300031239 Bacteria 3906
221 Ga0265331_10012169 3300031250 Bacteria 4673
222 Ga0265327_10000035 3300031251 Bacteria 314419
223 Ga0265327_10001687 3300031251 Bacteria 26413
224 Ga0265316_10088600 3300031344 Bacteria 2363
225 Ga0307513_10000029 3300031456 Bacteria 191823
226 Ga0307513_10000038 3300031456 Bacteria 174780
227 Ga0307513_10017125 3300031456 Bacteria 8704
228 Ga0307513_10045776 3300031456 Bacteria 4778
229 Ga0307509_10000249 3300031507 Bacteria 87094
230 Ga0307509_10003703 3300031507 Bacteria 22876
231 Ga0307509_10073474 3300031507 Bacteria 3560
232 Ga0307408_100000023 3300031548 Bacteria 295931
233 Ga0307408_100007014 3300031548 Bacteria 7451
234 Ga0307408_100019582 3300031548 Bacteria 4558
235 Ga0307408_100029368 3300031548 Bacteria 3809
236 Ga0307508_10000143 3300031616 Bacteria 85046
237 Ga0307508_10000216 3300031616 Bacteria 69990
238 Ga0307508_10004816 3300031616 Bacteria 13012
239 Ga0307508_10095785 3300031616 Bacteria 2559
240 Ga0307514_10001392 3300031649 Bacteria 30115
241 Ga0307514_10002699 3300031649 Bacteria 17971
242 Ga0265314_10002853 3300031711 Bacteria 17200
243 Ga0307516_10000237 3300031730 Bacteria 70929
244 Ga0307516_10000476 3300031730 Bacteria 53151
245 Ga0307516_10002212 3300031730 Bacteria 26344
246 Ga0307516_10005411 3300031730 Bacteria 15306
247 Ga0307410_10044731 3300031852 Bacteria 2943
248 Ga0307406_10020368 3300031901 Bacteria 3904
249 Ga0307406_10117794 3300031901 Bacteria 1840
250 Ga0307412_10020834 3300031911 Bacteria 3996
251 Ga0307412_10045165 3300031911 Bacteria 2878
252 Ga0307409_100001504 3300031995 Bacteria 11516
253 Ga0307411_10003949 3300032005 Bacteria 7002
254 Ga0307415_100034756 3300032126 Bacteria 3286
255 Ga0307507_10089634 3300033179 Bacteria 2645
256 Ga0307510_10003506 3300033180 Bacteria 18283
257 Ga0307510_10111528 3300033180 Bacteria 2475
258 Ga0373948_0006547 3300034817 Bacteria 1930
259 Ga0373960_0002964 3300035121 Bacteria 3839
260 Ga0373962_0013959 3300035242 Bacteria 2042
261 Ga0373931_0000092 3300035691 Bacteria 41580
262 Ga0373937_0013987 3300036401 Bacteria 7076
263 Ga0395899_0009672 3300037312 Bacteria 7400
264 Ga0395899_0026974 3300037312 Bacteria 4332
265 Ga0395900_0000183 3300037418 Bacteria 100749
266 Ga0395900_0002678 3300037418 Bacteria 19463
267 Ga0395900_0162329 3300037418 Bacteria 2278
268 Ga0395900_0191311 3300037418 Bacteria 2075
269 Ga0395898_0010303 3300037466 Bacteria 9781
270 Ga0395898_0013391 3300037466 Bacteria 8447
271 Ga0395898_0021023 3300037466 Bacteria 6620
272 Ga0395898_0024924 3300037466 Bacteria 6030
273 Ga0395898_0103773 3300037466 Bacteria 2727
274 Ga0395905_0000027 3300037471 Bacteria 297239
275 Ga0395905_0000151 3300037471 Bacteria 115485
276 Ga0395905_0000166 3300037471 Bacteria 108507
277 Ga0395905_0000544 3300037471 Bacteria 51411
278 Ga0395905_0001411 3300037471 Bacteria 29041
279 Ga0395905_0002682 3300037471 Bacteria 19512
280 Ga0395905_0014823 3300037471 Bacteria 7432
281 Ga0395905_0055256 3300037471 Bacteria 3716
282 Ga0395905_0182292 3300037471 Bacteria 1971
283 Ga0395901_0007060 3300038443 Bacteria 11351
284 Ga0395901_0052658 3300038443 Bacteria 4230
285 Ga0436361_0070738 3300039447 Bacteria 27213
286 Ga0436361_0128279 3300039447 Bacteria 6459
287 Ga0436361_0378401 3300039447 Bacteria 33354
288 Ga0436361_0745691 3300039447 Bacteria 89622
289 Ga0436361_0750298 3300039447 Bacteria 51036
290 Ga0439448_0000066 3300042005 Bacteria 17566
291 Ga0450911_000507 3300042115 Bacteria 12353
292 Ga0450892_000709 3300042130 Bacteria 3725
293 Ga0450918_000297 3300042531 Bacteria 11148
294 Ga0451577_0000270 3300042876 Bacteria 101581
295 Ga0451577_0005435 3300042876 Bacteria 13068
296 Ga0451577_0011781 3300042876 Bacteria 8253
297 Ga0451577_0026356 3300042876 Bacteria 5265
298 Ga0451577_0026573 3300042876 Bacteria 5242
299 Ga0466969_0000020 3300044656 Bacteria 101861
300 Ga0466969_0006790 3300044656 Bacteria 6089
301 Ga0466969_0011619 3300044656 Bacteria 4660
302 Ga0466972_0000594 3300044658 Bacteria 17607
303 Ga0466972_0027751 3300044658 Bacteria 2799
304 Ga0453683_0003884 3300044673 Bacteria 10830
305 Ga0466966_0035306 3300044684 Bacteria 3230
306 Ga0466961_0009114 3300044693 Bacteria 6322
307 Ga0466963_0105812 3300044694 Bacteria 1929
308 Ga0453684_0000868 3300044712 Bacteria 101512
309 Ga0453684_0067993 3300044712 Bacteria 4526
310 Ga0453684_0116644 3300044712 Bacteria 3233
311 Ga0466959_0015424 3300045049 Bacteria 5565
312 Ga0451576_0004667 3300045051 Bacteria 17660
313 Ga0451576_0004748 3300045051 Bacteria 17449
314 Ga0451576_0014978 3300045051 Bacteria 8613
315 Ga0451576_0017824 3300045051 Bacteria 7799
316 Ga0466958_0001549 3300045836 Bacteria 11008
317 Ga0495592_0001883 3300046454 Bacteria 14765
318 Ga0495592_0167266 3300046454 Bacteria 1508
319 Ga0495603_0065943 3300046455 Bacteria 2133
320 Ga0495603_0149808 3300046455 Bacteria 1356
321 Ga0495590_0006273 3300046457 Bacteria 4654
322 Ga0495629_0011785 3300046459 Bacteria 6345
323 Ga0495650_0025886 3300046471 Bacteria 2739
324 Ga0495580_0029451 3300046472 Bacteria 3985
325 Ga0495580_0047558 3300046472 Bacteria 3040
326 Ga0495605_0018073 3300046474 Bacteria 3786
327 Ga0495605_0018453 3300046474 Bacteria 3739
328 Ga0495584_0031394 3300046491 Bacteria 2689
329 Ga0495583_0020034 3300046506 Bacteria 3476
330 Ga0495606_0017643 3300046507 Bacteria 5386
331 Ga0495606_0028649 3300046507 Bacteria 3924
332 Ga0495610_0036260 3300046512 Bacteria 2522
333 Ga0495632_0001731 3300046519 Bacteria 17729
334 Ga0495632_0013288 3300046519 Bacteria 4705
335 Ga0495648_0018519 3300046524 Bacteria 4925
336 Ga0495642_0048379 3300046528 Bacteria 1744
337 Ga0495665_0005073 3300046531 Bacteria 7099
338 Ga0495597_0004826 3300046542 Bacteria 7277
339 Ga0495645_0083057 3300046543 Bacteria 2296
340 Ga0495645_0089485 3300046543 Bacteria 2201
341 Ga0495624_0026667 3300046690 Bacteria 3785
342 Ga0495649_0020597 3300046694 Bacteria 3698
343 Ga0495589_0017005 3300046794 Bacteria 3734
344 Ga0495581_0009300 3300047315 Bacteria 5687
345 Ga0495604_0062867 3300047317 Bacteria 2834
346 Ga0495674_0038141 3300047319 Bacteria 4315
347 Ga0495687_001868 3300047443 Bacteria 18265
348 Ga0495677_0010772 3300047445 Bacteria 3350
349 Ga0495673_0013849 3300047469 Bacteria 4214
350 Ga0495686_0024104 3300047472 Bacteria 4001
351 Ga0496101_0007637 3300048904 Bacteria 7020
352 Ga0496101_0044068 3300048904 Bacteria 3191
353 Ga0496102_0002898 3300048905 Bacteria 14539
354 Ga0496102_0007263 3300048905 Bacteria 9456
355 Ga0496102_0043214 3300048905 Bacteria 4085
356 Ga0496102_0059794 3300048905 Bacteria 3485
357 Ga0496103_0004009 3300048906 Bacteria 8943
358 Ga0496105_0145191 3300048908 Bacteria 1951
359 Ga0496106_0000162 3300048909 Bacteria 48305
360 Ga0496107_0013632 3300048910 Bacteria 5683
361 Ga0496107_0044809 3300048910 Bacteria 3181
362 Ga0496108_0146347 3300048911 Bacteria 2037
363 Ga0496112_0049466 3300048915 Bacteria 4121
364 Ga0496113_0036117 3300048916 Bacteria 3619
365 Ga0496115_0175183 3300048918 Bacteria 1774
366 Ga0496117_0019451 3300048920 Bacteria 5575
367 Ga0496118_0027188 3300048921 Bacteria 4849
368 Ga0496118_0074031 3300048921 Bacteria 2436
369 Ga0496121_0018436 3300048924 Bacteria 7037
370 Ga0496121_0027134 3300048924 Bacteria 5368
371 Ga0496121_0033848 3300048924 Bacteria 4612
372 Ga0496121_0071072 3300048924 Bacteria 2800
373 Ga0496122_0011903 3300048925 Bacteria 8738
374 Ga0496124_0134839 3300048927 Bacteria 1956
375 Ga0496125_0008960 3300048928 Bacteria 10379
376 Ga0496125_0009524 3300048928 Bacteria 9968
377 Ga0496126_0004713 3300048929 Bacteria 16102
378 Ga0496126_0009026 3300048929 Bacteria 10663
379 Ga0501034_0001324 3300049571 Bacteria 33484
380 Ga0501034_0026652 3300049571 Bacteria 5882
381 Ga0501043_0000002 3300049579 Bacteria 351081
382 Ga0501043_0138052 3300049579 Bacteria 1910
383 Ga0501046_0000008 3300049580 Bacteria 351167
384 Ga0501047_0000003 3300049581 Bacteria 508375
385 Ga0501047_0012729 3300049581 Bacteria 7970
386 Ga0501048_0003054 3300049582 Bacteria 12758
387 Ga0501072_0114940 3300049588 Bacteria 2142
388 Ga0501073_0000801 3300049589 Bacteria 22374
389 Ga0501074_0024003 3300049590 Bacteria 4432
390 Ga0501198_000024 3300049649 Bacteria 67171
391 Ga0501222_000020 3300049662 Bacteria 67164
392 Ga0501080_0010353 3300049742 Bacteria 8530
393 Ga0501080_0085594 3300049742 Bacteria 2929
394 nmdc:mga03n38_11784_c1 3300050490 Bacteria 3270
395 nmdc:mga0yw44_9362_c1 3300050492 Bacteria 4947
396 nmdc:mga0k408_100985_c1 3300050493 Bacteria 1701
397 nmdc:mga0k408_1135_c1 3300050493 Bacteria 14614
398 nmdc:mga0k408_1527_c1 3300050493 Bacteria 12499
399 nmdc:mga0k408_15688_c1 3300050493 Bacteria 4194
400 nmdc:mga0k408_1574_c1 3300050493 Bacteria 12323
401 nmdc:mga0k408_2262_c1 3300050493 Bacteria 10276
402 nmdc:mga0k408_24154_c1 3300050493 Bacteria 3435
403 nmdc:mga0k408_3365_c1 3300050493 Bacteria 8469
404 nmdc:mga0k408_5563_c1 3300050493 Bacteria 4324
405 nmdc:mga0k408_669_c1 3300050493 Bacteria 18779
406 nmdc:mga06z11_3842_c1 3300050494 Bacteria 5851
407 nmdc:mga07m45_16841_c1 3300050496 Bacteria 3917
408 nmdc:mga07m45_23028_c1 3300050496 Bacteria 3403
409 nmdc:mga07m45_38148_c1 3300050496 Bacteria 2681
410 nmdc:mga07m45_4284_c1 3300050496 Bacteria 6982
411 nmdc:mga07m45_4955_c1 3300050496 Bacteria 6567
412 nmdc:mga07m45_6153_c1 3300050496 Bacteria 6052
413 nmdc:mga09592_115584_c1 3300050508 Bacteria 2303
414 nmdc:mga0qj67_71171_c1 3300050509 Bacteria 2775
415 Ga0500578_0001754 3300053086 Bacteria 20477
416 Ga0500578_0020238 3300053086 Bacteria 4276
417 Ga0500651_0002891 3300053093 Bacteria 9229
418 Ga0500594_0007316 3300053118 Bacteria 2497
419 Ga0500652_000522 3300053131 Bacteria 13551
420 Ga0500559_0000032 3300053136 Bacteria 113579
421 Ga0500568_0006581 3300053139 Bacteria 5814
422 Ga0500568_0023028 3300053139 Bacteria 2653
423 Ga0500619_000006 3300053154 Bacteria 77270
424 Ga0500622_0000872 3300053156 Bacteria 25676
425 Ga0500622_0001884 3300053156 Bacteria 15840
426 Ga0500622_0011846 3300053156 Bacteria 4739
427 Ga0500645_001112 3300053730 Bacteria 14708
428 Ga0501084_0081579 3300054114 Bacteria 2713
429 Ga0590071_000469 3300059421 Bacteria 11764

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046694 Ga0495649_0020597 Ga0495649_0020597_11_1300 427
2 3300049579 Ga0501043_0138052 Ga0501043_0138052_20_1324 434
3 3300046455 Ga0495603_0149808 Ga0495603_0149808_15_1343 440
4 3300048920 Ga0496117_0019451 Ga0496117_0019451_28_1368 442
5 3300053139 Ga0500568_0006581 Ga0500568_0006581_4083_5411 442
6 3300046454 Ga0495592_0167266 Ga0495592_0167266_146_1486 446
7 3300048910 Ga0496107_0013632 Ga0496107_0013632_1971_3374 446
8 3300048911 Ga0496108_0146347 Ga0496108_0146347_485_2002 462
9 3300005339 Ga0070660_100000555 Ga0070660_10000055529 465
10 3300009545 Ga0105237_10109306 Ga0105237_101093063 465
11 3300010375 Ga0105239_10005759 Ga0105239_1000575913 465
12 3300013100 Ga0157373_10071137 Ga0157373_100711372 465
13 3300013104 Ga0157370_10048004 Ga0157370_100480042 465
14 3300013105 Ga0157369_10092998 Ga0157369_100929982 465
15 3300013296 Ga0157374_10000251 Ga0157374_1000025143 465
16 3300013307 Ga0157372_10002048 Ga0157372_1000204817 465
17 3300025904 Ga0207647_10060710 Ga0207647_100607101 465
18 3300025909 Ga0207705_10041012 Ga0207705_100410123 465
19 3300025919 Ga0207657_10001751 Ga0207657_1000175125 465
20 3300025949 Ga0207667_10008622 Ga0207667_100086222 465
21 3300037466 Ga0395898_0024924 Ga0395898_0024924_4058_5524 465
22 3300042005 Ga0439448_0000066 Ga0439448_0000066_11919_13385 465
23 3300048909 Ga0496106_0000162 Ga0496106_0000162_44626_46092 465
24 3300048924 Ga0496121_0018436 Ga0496121_0018436_5543_7009 465
25 3300048927 Ga0496124_0134839 Ga0496124_0134839_186_1652 465
26 3300005455 Ga0070663_100010090 Ga0070663_1000100902 466
27 3300013306 Ga0163162_10002127 Ga0163162_1000212710 466
28 3300013308 Ga0157375_10037995 Ga0157375_100379952 466
29 3300025225 Ga0209566_100312 Ga0209566_10031214 466
30 3300025903 Ga0207680_10040997 Ga0207680_100409972 466
31 3300026067 Ga0207678_10019929 Ga0207678_100199292 466
32 3300046474 Ga0495605_0018073 Ga0495605_0018073_926_2392 466
33 3300046507 Ga0495606_0017643 Ga0495606_0017643_3150_4616 466
34 3300046794 Ga0495589_0017005 Ga0495589_0017005_1388_2854 466
35 3300048918 Ga0496115_0175183 Ga0496115_0175183_35_1501 466
36 3300033179 Ga0307507_10089634 Ga0307507_100896341 469
37 3300025228 Ga0209672_100214 Ga0209672_10021428 470
38 3300048929 Ga0496126_0009026 Ga0496126_0009026_7863_9329 471
39 3300003763 Ga0055529_1000948 Ga0055529_10009482 473
40 3300025228 Ga0209672_100054 Ga0209672_100054188 473
41 3300025229 Ga0209147_100085 Ga0209147_1000852 473
42 3300025254 Ga0209148_1000119 Ga0209148_100011958 473
43 3300025272 Ga0209455_1000244 Ga0209455_100024458 473
44 3300003354 JGI25160J50197_1000302 JGI25160J50197_10003021 474
45 3300005262 Ga0065165_1026999 Ga0065165_10269991 474
46 3300009093 Ga0105240_10238409 Ga0105240_102384092 474
47 3300025302 Ga0207426_1000199 Ga0207426_100019947 474
48 3300025913 Ga0207695_10054142 Ga0207695_100541421 474
49 3300037471 Ga0395905_0000166 Ga0395905_0000166_96518_98035 474
50 3300046543 Ga0495645_0083057 Ga0495645_0083057_453_1919 474
51 3300048904 Ga0496101_0044068 Ga0496101_0044068_1408_2925 474
52 3300048905 Ga0496102_0043214 Ga0496102_0043214_268_1785 474
53 3300048906 Ga0496103_0004009 Ga0496103_0004009_4009_5526 474
54 3300048921 Ga0496118_0074031 Ga0496118_0074031_712_2229 474
55 3300048924 Ga0496121_0027134 Ga0496121_0027134_254_1771 474
56 3300048929 Ga0496126_0004713 Ga0496126_0004713_11396_12862 474
57 3300049590 Ga0501074_0024003 Ga0501074_0024003_447_1874 474
58 3300037418 Ga0395900_0000183 Ga0395900_0000183_61050_62531 479
59 3300045836 Ga0466958_0001549 Ga0466958_0001549_757_2238 479
60 3300049571 Ga0501034_0001324 Ga0501034_0001324_3079_4521 479
61 3300049571 Ga0501034_0026652 Ga0501034_0026652_707_2149 479
62 3300049588 Ga0501072_0114940 Ga0501072_0114940_636_2078 479
63 3300049589 Ga0501073_0000801 Ga0501073_0000801_16402_17844 479
64 3300049742 Ga0501080_0010353 Ga0501080_0010353_579_2021 479
65 3300054114 Ga0501084_0081579 Ga0501084_0081579_1062_2504 479
66 3300047472 Ga0495686_0024104 Ga0495686_0024104_1429_2907 480
67 3300037471 Ga0395905_0000151 Ga0395905_0000151_54309_55763 481
68 3300044656 Ga0466969_0006790 Ga0466969_0006790_4167_5648 482
69 3300045051 Ga0451576_0014978 Ga0451576_0014978_1344_2792 482
70 iso_pu_bacteria 2513237166 2514050868 482
71 iso_pu_bacteria 2547132512 2548846914 482
72 iso_pu_bacteria 2562617112 2563061556 482
73 iso_pu_bacteria 2600255067 2600813835 482
74 iso_pu_bacteria 2711768613 2713478579 482
75 iso_pu_bacteria 2791355137 2792837026 482
76 iso_pu_bacteria 2904615490 2904621528 482
77 iso_pu_bacteria 2921643360 2921651523 482
78 iso_pu_bacteria 2511231002 2511244675 484
79 iso_pu_bacteria 2643221544 2643743087 484
80 iso_pu_bacteria 2643221570 2643867706 484
81 iso_pu_bacteria 2643221585 2643932887 484
82 iso_pu_bacteria 2643221639 2644218496 484
83 iso_pu_bacteria 2643221646 2644260390 484
84 iso_pu_bacteria 2643221652 2644293315 484
85 iso_pu_bacteria 2643221656 2644314137 484
86 iso_pu_bacteria 2643221660 2644338697 484
87 iso_pu_bacteria 2738541337 2739055949 484
88 iso_pu_bacteria 2831864461 2831864626 484
89 iso_pu_bacteria 2881101125 2881103392 484
90 iso_pu_bacteria 2886848708 2886849307 484
91 iso_pu_bacteria 2919704043 2919707077 484
92 iso_pu_bacteria 2939631187 2939636242 484
93 iso_pu_bacteria 2990710928 2990713985 484
94 3300044658 Ga0466972_0000594 Ga0466972_0000594_14872_16329 485
95 3300006051 Ga0075364_10009124 Ga0075364_100091242 486
96 3300006186 Ga0075369_10000297 Ga0075369_100002975 486
97 3300006195 Ga0075366_10003152 Ga0075366_100031522 486
98 3300006353 Ga0075370_10061547 Ga0075370_100615472 486
99 3300009011 Ga0105251_10000708 Ga0105251_1000070817 486
100 3300009036 Ga0105244_10045606 Ga0105244_100456062 486
101 3300009551 Ga0105238_10011454 Ga0105238_100114542 486
102 3300025302 Ga0207426_1010030 Ga0207426_10100302 486
103 3300025735 Ga0207713_1006261 Ga0207713_10062616 486
104 3300031238 Ga0265332_10000271 Ga0265332_1000027111 486
105 3300031344 Ga0265316_10088600 Ga0265316_100886002 486
106 3300046455 Ga0495603_0065943 Ga0495603_0065943_218_1684 486
107 3300046457 Ga0495590_0006273 Ga0495590_0006273_55_1521 486
108 3300046459 Ga0495629_0011785 Ga0495629_0011785_1659_3125 486
109 3300046471 Ga0495650_0025886 Ga0495650_0025886_20_1486 486
110 3300046472 Ga0495580_0029451 Ga0495580_0029451_1177_2643 486
111 3300046472 Ga0495580_0047558 Ga0495580_0047558_636_2102 486
112 3300046474 Ga0495605_0018453 Ga0495605_0018453_2073_3539 486
113 3300046491 Ga0495584_0031394 Ga0495584_0031394_953_2419 486
114 3300046506 Ga0495583_0020034 Ga0495583_0020034_1773_3239 486
115 3300046507 Ga0495606_0028649 Ga0495606_0028649_251_1717 486
116 3300046524 Ga0495648_0018519 Ga0495648_0018519_3196_4662 486
117 3300046531 Ga0495665_0005073 Ga0495665_0005073_2468_3934 486
118 3300046543 Ga0495645_0089485 Ga0495645_0089485_572_2038 486
119 3300046690 Ga0495624_0026667 Ga0495624_0026667_1646_3112 486
120 3300047315 Ga0495581_0009300 Ga0495581_0009300_1303_2769 486
121 3300047317 Ga0495604_0062867 Ga0495604_0062867_532_1998 486
122 3300047319 Ga0495674_0038141 Ga0495674_0038141_372_1838 486
123 3300047469 Ga0495673_0013849 Ga0495673_0013849_1980_3446 486
124 3300048904 Ga0496101_0007637 Ga0496101_0007637_696_2162 486
125 3300048905 Ga0496102_0007263 Ga0496102_0007263_3241_4707 486
126 3300048908 Ga0496105_0145191 Ga0496105_0145191_288_1754 486
127 3300048910 Ga0496107_0044809 Ga0496107_0044809_1067_2533 486
128 3300048921 Ga0496118_0027188 Ga0496118_0027188_2226_3692 486
129 3300048924 Ga0496121_0033848 Ga0496121_0033848_1979_3445 486
130 3300048924 Ga0496121_0071072 Ga0496121_0071072_409_1875 486
131 3300048925 Ga0496122_0011903 Ga0496122_0011903_3691_5157 486
132 3300048928 Ga0496125_0008960 Ga0496125_0008960_5754_7220 486
133 3300050490 nmdc:mga03n38_11784_c1 nmdc:mga03n38_11784_c1_1650_3116 486
134 3300050492 nmdc:mga0yw44_9362_c1 nmdc:mga0yw44_9362_c1_195_1661 486
135 3300050493 nmdc:mga0k408_15688_c1 nmdc:mga0k408_15688_c1_1610_3076 486
136 3300050494 nmdc:mga06z11_3842_c1 nmdc:mga06z11_3842_c1_3267_4733 486
137 3300050496 nmdc:mga07m45_38148_c1 nmdc:mga07m45_38148_c1_639_2105 486
138 3300031251 Ga0265327_10001687 Ga0265327_1000168717 487
139 3300002704 JGI25155J39150_1000022 JGI25155J39150_1000022146 488
140 3300002705 JGI25156J39149_1000005 JGI25156J39149_1000005137 488
141 3300002738 JGI25154J39366_1000017 JGI25154J39366_1000017129 488
142 3300002741 JGI25157J39369_1000003 JGI25157J39369_1000003145 488
143 3300003354 JGI25160J50197_1000691 JGI25160J50197_100069124 488
144 3300003374 JGI25161J50226_1000341 JGI25161J50226_10003411 488
145 3300003759 Ga0055525_1000004 Ga0055525_1000004168 488
146 3300003771 Ga0055526_1001565 Ga0055526_10015657 488
147 3300003773 Ga0055537_1000205 Ga0055537_100020548 488
148 3300003775 Ga0055524_1000073 Ga0055524_100007326 488
149 3300003775 Ga0055524_1001048 Ga0055524_10010482 488
150 3300003775 Ga0055524_1002553 Ga0055524_10025532 488
151 3300003781 Ga0055536_1007193 Ga0055536_10071932 488
152 3300003790 Ga0055528_1004238 Ga0055528_10042388 488
153 3300003792 Ga0055540_1000037 Ga0055540_100003738 488
154 3300003794 Ga0055531_10000108 Ga0055531_1000010826 488
155 3300003794 Ga0055531_10001826 Ga0055531_100018262 488
156 3300003794 Ga0055531_10003190 Ga0055531_100031904 488
157 3300003794 Ga0055531_10009569 Ga0055531_100095692 488
158 3300004625 Ga0055543_1001154 Ga0055543_10011541 488
159 3300004625 Ga0055543_1006077 Ga0055543_10060772 488
160 3300005262 Ga0065165_1000290 Ga0065165_100029031 488
161 3300005262 Ga0065165_1000684 Ga0065165_10006842 488
162 3300005338 Ga0068868_100019190 Ga0068868_1000191901 488
163 3300005445 Ga0070708_100161699 Ga0070708_1001616992 488
164 3300005618 Ga0068864_100127027 Ga0068864_1001270272 488
165 3300005841 Ga0068863_100150337 Ga0068863_1001503372 488
166 3300006195 Ga0075366_10051256 Ga0075366_100512562 488
167 3300006944 Ga0099823_1000016 Ga0099823_100001653 488
168 3300012497 Ga0157319_1000005 Ga0157319_1000005311 488
169 3300012513 Ga0157326_1000719 Ga0157326_10007194 488
170 3300014969 Ga0157376_10041299 Ga0157376_100412991 488
171 3300021361 Ga0213872_10000067 Ga0213872_1000006744 488
172 3300021361 Ga0213872_10000104 Ga0213872_100001046 488
173 3300021361 Ga0213872_10000131 Ga0213872_1000013139 488
174 3300021361 Ga0213872_10020215 Ga0213872_100202153 488
175 3300025206 Ga0209435_100002 Ga0209435_100002253 488
176 3300025208 Ga0209436_109593 Ga0209436_1095931 488
177 3300025230 Ga0209563_100013 Ga0209563_100013168 488
178 3300025245 Ga0207425_1000513 Ga0207425_10005138 488
179 3300025245 Ga0207425_1002914 Ga0207425_10029142 488
180 3300025246 Ga0209646_1000001 Ga0209646_10000012396 488
181 3300025250 Ga0209026_1000001 Ga0209026_10000011053 488
182 3300025256 Ga0209759_1000001 Ga0209759_10000012027 488
183 3300025263 Ga0209565_1000128 Ga0209565_100012836 488
184 3300025263 Ga0209565_1006771 Ga0209565_10067711 488
185 3300025273 Ga0209673_1000008 Ga0209673_100000859 488
186 3300025284 Ga0209130_1000072 Ga0209130_100007219 488
187 3300025284 Ga0209130_1000338 Ga0209130_100033834 488
188 3300025291 Ga0209675_1000099 Ga0209675_100009937 488
189 3300025291 Ga0209675_1009712 Ga0209675_10097121 488
190 3300025292 Ga0209676_1000023 Ga0209676_1000023375 488
191 3300025292 Ga0209676_1002528 Ga0209676_10025288 488
192 3300025294 Ga0209025_1003424 Ga0209025_10034245 488
193 3300025294 Ga0209025_1006683 Ga0209025_10066832 488
194 3300025295 Ga0209564_1000008 Ga0209564_1000008257 488
195 3300025295 Ga0209564_1000543 Ga0209564_100054347 488
196 3300025295 Ga0209564_1001126 Ga0209564_10011264 488
197 3300025295 Ga0209564_1003454 Ga0209564_100345413 488
198 3300025297 Ga0209758_1008785 Ga0209758_10087856 488
199 3300025298 Ga0209050_1000022 Ga0209050_1000022357 488
200 3300025298 Ga0209050_1005250 Ga0209050_10052502 488
201 3300025299 Ga0209256_1000001 Ga0209256_10000011843 488
202 3300025299 Ga0209256_1000410 Ga0209256_100041018 488
203 3300025299 Ga0209256_1000820 Ga0209256_10008206 488
204 3300025302 Ga0207426_1000319 Ga0207426_100031913 488
205 3300025303 Ga0209051_1000013 Ga0209051_1000013357 488
206 3300025303 Ga0209051_1000196 Ga0209051_1000196101 488
207 3300025303 Ga0209051_1000726 Ga0209051_100072628 488
208 3300025303 Ga0209051_1003464 Ga0209051_10034642 488
209 3300025304 Ga0209257_1000033 Ga0209257_100003327 488
210 3300025304 Ga0209257_1000042 Ga0209257_1000042130 488
211 3300025304 Ga0209257_1000305 Ga0209257_100030518 488
212 3300025304 Ga0209257_1000774 Ga0209257_100077427 488
213 3300025304 Ga0209257_1029362 Ga0209257_10293622 488
214 3300025933 Ga0207706_10001906 Ga0207706_100019062 488
215 3300026023 Ga0207677_10100440 Ga0207677_101004402 488
216 3300026095 Ga0207676_10106296 Ga0207676_101062962 488
217 3300027296 Ga0209389_1005959 Ga0209389_10059592 488
218 3300027395 Ga0209996_1000374 Ga0209996_10003742 488
219 3300027471 Ga0209995_1000276 Ga0209995_10002769 488
220 3300027526 Ga0209968_1000055 Ga0209968_100005513 488
221 3300027614 Ga0209970_1001251 Ga0209970_10012512 488
222 3300027695 Ga0209966_1000136 Ga0209966_100013627 488
223 3300028381 Ga0268264_10068446 Ga0268264_100684462 488
224 3300028794 Ga0307515_10000281 Ga0307515_1000028194 488
225 3300028794 Ga0307515_10010956 Ga0307515_1001095617 488
226 3300028794 Ga0307515_10109937 Ga0307515_101099372 488
227 3300028794 Ga0307515_10180559 Ga0307515_101805591 488
228 3300031238 Ga0265332_10000027 Ga0265332_10000027135 488
229 3300031239 Ga0265328_10009718 Ga0265328_100097182 488
230 3300031250 Ga0265331_10012169 Ga0265331_100121692 488
231 3300031251 Ga0265327_10000035 Ga0265327_10000035190 488
232 3300031456 Ga0307513_10000029 Ga0307513_10000029157 488
233 3300031456 Ga0307513_10000038 Ga0307513_10000038112 488
234 3300031456 Ga0307513_10045776 Ga0307513_100457763 488
235 3300031548 Ga0307408_100000023 Ga0307408_100000023226 488
236 3300031548 Ga0307408_100007014 Ga0307408_1000070142 488
237 3300031649 Ga0307514_10001392 Ga0307514_100013923 488
238 3300031711 Ga0265314_10002853 Ga0265314_1000285311 488
239 3300031730 Ga0307516_10000476 Ga0307516_1000047615 488
240 3300031730 Ga0307516_10005411 Ga0307516_100054116 488
241 3300031901 Ga0307406_10117794 Ga0307406_101177942 488
242 3300031911 Ga0307412_10045165 Ga0307412_100451652 488
243 3300032005 Ga0307411_10003949 Ga0307411_100039492 488
244 3300034817 Ga0373948_0006547 Ga0373948_0006547_411_1886 488
245 3300035121 Ga0373960_0002964 Ga0373960_0002964_752_2227 488
246 3300035242 Ga0373962_0013959 Ga0373962_0013959_131_1606 488
247 3300035691 Ga0373931_0000092 Ga0373931_0000092_18170_19645 488
248 3300036401 Ga0373937_0013987 Ga0373937_0013987_5313_6779 488
249 3300037312 Ga0395899_0009672 Ga0395899_0009672_3542_5008 488
250 3300037312 Ga0395899_0026974 Ga0395899_0026974_1259_2725 488
251 3300037418 Ga0395900_0002678 Ga0395900_0002678_14858_16324 488
252 3300037418 Ga0395900_0162329 Ga0395900_0162329_658_2124 488
253 3300037418 Ga0395900_0191311 Ga0395900_0191311_90_1556 488
254 3300037466 Ga0395898_0010303 Ga0395898_0010303_1941_3407 488
255 3300037466 Ga0395898_0013391 Ga0395898_0013391_3179_4645 488
256 3300037466 Ga0395898_0021023 Ga0395898_0021023_1736_3202 488
257 3300037466 Ga0395898_0103773 Ga0395898_0103773_985_2451 488
258 3300037471 Ga0395905_0000027 Ga0395905_0000027_114722_116188 488
259 3300037471 Ga0395905_0000544 Ga0395905_0000544_1242_2708 488
260 3300037471 Ga0395905_0001411 Ga0395905_0001411_15434_16900 488
261 3300037471 Ga0395905_0002682 Ga0395905_0002682_6135_7601 488
262 3300037471 Ga0395905_0055256 Ga0395905_0055256_852_2318 488
263 3300037471 Ga0395905_0182292 Ga0395905_0182292_346_1812 488
264 3300038443 Ga0395901_0007060 Ga0395901_0007060_7463_8929 488
265 3300038443 Ga0395901_0052658 Ga0395901_0052658_785_2251 488
266 3300039447 Ga0436361_0070738 Ga0436361_0070738_24537_26003 488
267 3300039447 Ga0436361_0128279 Ga0436361_0128279_3747_5225 488
268 3300039447 Ga0436361_0378401 Ga0436361_0378401_23764_25242 488
269 3300039447 Ga0436361_0745691 Ga0436361_0745691_50604_52082 488
270 3300039447 Ga0436361_0750298 Ga0436361_0750298_5243_6718 488
271 3300042115 Ga0450911_000507 Ga0450911_000507_2014_3480 488
272 3300042130 Ga0450892_000709 Ga0450892_000709_2038_3513 488
273 3300042876 Ga0451577_0000270 Ga0451577_0000270_44296_45777 488
274 3300042876 Ga0451577_0005435 Ga0451577_0005435_10334_11800 488
275 3300042876 Ga0451577_0011781 Ga0451577_0011781_1863_3329 488
276 3300042876 Ga0451577_0026573 Ga0451577_0026573_3339_4805 488
277 3300044656 Ga0466969_0000020 Ga0466969_0000020_1424_2890 488
278 3300044656 Ga0466969_0011619 Ga0466969_0011619_2042_3508 488
279 3300044658 Ga0466972_0027751 Ga0466972_0027751_324_1790 488
280 3300044673 Ga0453683_0003884 Ga0453683_0003884_4456_5922 488
281 3300044684 Ga0466966_0035306 Ga0466966_0035306_1720_3186 488
282 3300044693 Ga0466961_0009114 Ga0466961_0009114_1189_2655 488
283 3300044694 Ga0466963_0105812 Ga0466963_0105812_386_1861 488
284 3300044712 Ga0453684_0000868 Ga0453684_0000868_55731_57212 488
285 3300044712 Ga0453684_0067993 Ga0453684_0067993_1079_2545 488
286 3300045049 Ga0466959_0015424 Ga0466959_0015424_1447_2913 488
287 3300045051 Ga0451576_0004667 Ga0451576_0004667_1797_3263 488
288 3300045051 Ga0451576_0004748 Ga0451576_0004748_15201_16682 488
289 3300045051 Ga0451576_0017824 Ga0451576_0017824_3091_4557 488
290 3300046528 Ga0495642_0048379 Ga0495642_0048379_254_1720 488
291 3300047445 Ga0495677_0010772 Ga0495677_0010772_1364_2830 488
292 3300048928 Ga0496125_0009524 Ga0496125_0009524_1294_2760 488
293 3300049581 Ga0501047_0012729 Ga0501047_0012729_2497_3963 488
294 3300049742 Ga0501080_0085594 Ga0501080_0085594_1163_2629 488
295 3300050493 nmdc:mga0k408_5563_c1 nmdc:mga0k408_5563_c1_2193_3659 488
296 3300050496 nmdc:mga07m45_4284_c1 nmdc:mga07m45_4284_c1_1473_2948 488
297 3300053156 Ga0500622_0011846 Ga0500622_0011846_40_1515 488
298 3300053730 Ga0500645_001112 Ga0500645_001112_13192_14658 488
299 3300059421 Ga0590071_000469 Ga0590071_000469_5828_7294 488
300 iso_pu_bacteria 2585428057 2587725252 488
301 iso_pu_bacteria 2585428058 2587731392 488
302 iso_pu_bacteria 2585428062 2587759514 488
303 iso_pu_bacteria 2588253510 2588295794 488
304 iso_pu_bacteria 2643221592 2643972866 488
305 iso_pu_bacteria 2643221625 2644143287 488
306 iso_pu_bacteria 2643221644 2644243459 488
307 iso_pu_bacteria 2643221648 2644276276 488
308 iso_pu_bacteria 2643221654 2644301233 488
309 3300005530 Ga0070679_100012650 Ga0070679_1000126502 490
310 3300005563 Ga0068855_100046126 Ga0068855_1000461262 490
311 3300009093 Ga0105240_10006365 Ga0105240_100063652 490
312 3300025921 Ga0207652_10026392 Ga0207652_100263924 490
313 3300025949 Ga0207667_10131525 Ga0207667_101315252 490
314 3300026095 Ga0207676_10198170 Ga0207676_101981701 490
315 3300048915 Ga0496112_0049466 Ga0496112_0049466_2116_3588 490
316 3300048916 Ga0496113_0036117 Ga0496113_0036117_469_1941 490
317 3300001979 JGI24740J21852_10003711 JGI24740J21852_100037112 492
318 3300002773 JGI25152J39213_1000662 JGI25152J39213_10006622 492
319 3300002773 JGI25152J39213_1000883 JGI25152J39213_10008833 492
320 3300002774 JGI25150J39212_1009308 JGI25150J39212_10093081 492
321 3300003215 JGI25153J46596_10002020 JGI25153J46596_100020202 492
322 3300003215 JGI25153J46596_10002816 JGI25153J46596_100028162 492
323 3300003771 Ga0055526_1001607 Ga0055526_100160711 492
324 3300003775 Ga0055524_1000052 Ga0055524_10000523 492
325 3300003791 Ga0055530_10001844 Ga0055530_100018442 492
326 3300003791 Ga0055530_10014402 Ga0055530_100144022 492
327 3300003792 Ga0055540_1000123 Ga0055540_10001232 492
328 3300003794 Ga0055531_10007545 Ga0055531_100075452 492
329 3300005262 Ga0065165_1001212 Ga0065165_100121213 492
330 3300005328 Ga0070676_10003787 Ga0070676_100037872 492
331 3300005344 Ga0070661_100002687 Ga0070661_1000026872 492
332 3300005354 Ga0070675_100005061 Ga0070675_1000050614 492
333 3300005355 Ga0070671_100033006 Ga0070671_1000330062 492
334 3300005355 Ga0070671_100064618 Ga0070671_1000646183 492
335 3300005356 Ga0070674_100007278 Ga0070674_1000072782 492
336 3300005367 Ga0070667_100012357 Ga0070667_1000123572 492
337 3300005455 Ga0070663_100032401 Ga0070663_1000324013 492
338 3300005456 Ga0070678_100038037 Ga0070678_1000380372 492
339 3300005459 Ga0068867_100000039 Ga0068867_10000003951 492
340 3300005459 Ga0068867_100005426 Ga0068867_1000054269 492
341 3300005459 Ga0068867_100043161 Ga0068867_1000431612 492
342 3300005467 Ga0070706_100001854 Ga0070706_10000185419 492
343 3300005543 Ga0070672_100004285 Ga0070672_1000042855 492
344 3300005577 Ga0068857_100020031 Ga0068857_1000200311 492
345 3300005614 Ga0068856_100151763 Ga0068856_1001517632 492
346 3300005616 Ga0068852_100128212 Ga0068852_1001282122 492
347 3300006042 Ga0075368_10015805 Ga0075368_100158051 492
348 3300006178 Ga0075367_10051207 Ga0075367_100512072 492
349 3300006195 Ga0075366_10030163 Ga0075366_100301632 492
350 3300006353 Ga0075370_10014328 Ga0075370_100143282 492
351 3300006846 Ga0075430_100104660 Ga0075430_1001046602 492
352 3300006946 Ga0079104_1000073 Ga0079104_1000073101 492
353 3300009148 Ga0105243_10004160 Ga0105243_100041602 492
354 3300013297 Ga0157378_10009948 Ga0157378_100099484 492
355 3300013306 Ga0163162_10152837 Ga0163162_101528371 492
356 3300013308 Ga0157375_10223883 Ga0157375_102238831 492
357 3300013308 Ga0157375_10261979 Ga0157375_102619792 492
358 3300014745 Ga0157377_10000044 Ga0157377_1000004423 492
359 3300017792 Ga0163161_10072049 Ga0163161_100720492 492
360 3300025245 Ga0207425_1000700 Ga0207425_10007002 492
361 3300025258 Ga0209129_1000012 Ga0209129_1000012252 492
362 3300025273 Ga0209673_1026045 Ga0209673_10260451 492
363 3300025295 Ga0209564_1000022 Ga0209564_1000022262 492
364 3300025297 Ga0209758_1000124 Ga0209758_100012414 492
365 3300025297 Ga0209758_1000234 Ga0209758_100023497 492
366 3300025298 Ga0209050_1000691 Ga0209050_100069122 492
367 3300025298 Ga0209050_1000718 Ga0209050_100071813 492
368 3300025299 Ga0209256_1000036 Ga0209256_1000036134 492
369 3300025303 Ga0209051_1000068 Ga0209051_100006876 492
370 3300025304 Ga0209257_1000146 Ga0209257_100014650 492
371 3300025893 Ga0207682_10012836 Ga0207682_100128362 492
372 3300025907 Ga0207645_10012827 Ga0207645_100128273 492
373 3300025910 Ga0207684_10003264 Ga0207684_100032646 492
374 3300025914 Ga0207671_10026445 Ga0207671_100264452 492
375 3300025921 Ga0207652_10029190 Ga0207652_100291905 492
376 3300025923 Ga0207681_10003514 Ga0207681_100035142 492
377 3300025925 Ga0207650_10001276 Ga0207650_100012765 492
378 3300025931 Ga0207644_10000523 Ga0207644_1000052320 492
379 3300025933 Ga0207706_10064645 Ga0207706_100646452 492
380 3300025935 Ga0207709_10001856 Ga0207709_100018569 492
381 3300025940 Ga0207691_10003381 Ga0207691_100033816 492
382 3300025945 Ga0207679_10000586 Ga0207679_1000058617 492
383 3300025945 Ga0207679_10045027 Ga0207679_100450272 492
384 3300025986 Ga0207658_10027073 Ga0207658_100270732 492
385 3300026023 Ga0207677_10109322 Ga0207677_101093222 492
386 3300026089 Ga0207648_10000109 Ga0207648_1000010951 492
387 3300026089 Ga0207648_10004239 Ga0207648_100042399 492
388 3300026089 Ga0207648_10010311 Ga0207648_100103112 492
389 3300026121 Ga0207683_10057106 Ga0207683_100571062 492
390 3300027111 Ga0209281_1000736 Ga0209281_100073624 492
391 3300027876 Ga0209974_10002020 Ga0209974_100020201 492
392 3300028786 Ga0307517_10001980 Ga0307517_1000198010 492
393 3300028794 Ga0307515_10000011 Ga0307515_10000011105 492
394 3300028794 Ga0307515_10000138 Ga0307515_1000013835 492
395 3300028794 Ga0307515_10001206 Ga0307515_1000120633 492
396 3300028794 Ga0307515_10028743 Ga0307515_1002874310 492
397 3300028794 Ga0307515_10143574 Ga0307515_101435742 492
398 3300028794 Ga0307515_10162215 Ga0307515_101622152 492
399 3300030522 Ga0307512_10043659 Ga0307512_100436592 492
400 3300030522 Ga0307512_10091582 Ga0307512_100915822 492
401 3300031456 Ga0307513_10017125 Ga0307513_100171252 492
402 3300031507 Ga0307509_10000249 Ga0307509_1000024958 492
403 3300031507 Ga0307509_10003703 Ga0307509_100037032 492
404 3300031507 Ga0307509_10073474 Ga0307509_100734742 492
405 3300031548 Ga0307408_100019582 Ga0307408_1000195822 492
406 3300031548 Ga0307408_100029368 Ga0307408_1000293681 492
407 3300031616 Ga0307508_10000143 Ga0307508_1000014368 492
408 3300031616 Ga0307508_10000216 Ga0307508_1000021646 492
409 3300031616 Ga0307508_10004816 Ga0307508_100048162 492
410 3300031616 Ga0307508_10095785 Ga0307508_100957852 492
411 3300031649 Ga0307514_10002699 Ga0307514_100026994 492
412 3300031730 Ga0307516_10000237 Ga0307516_1000023750 492
413 3300031730 Ga0307516_10002212 Ga0307516_1000221212 492
414 3300031852 Ga0307410_10044731 Ga0307410_100447312 492
415 3300031901 Ga0307406_10020368 Ga0307406_100203682 492
416 3300031911 Ga0307412_10020834 Ga0307412_100208343 492
417 3300031995 Ga0307409_100001504 Ga0307409_1000015042 492
418 3300032126 Ga0307415_100034756 Ga0307415_1000347562 492
419 3300033180 Ga0307510_10003506 Ga0307510_100035069 492
420 3300033180 Ga0307510_10111528 Ga0307510_101115282 492
421 3300037471 Ga0395905_0014823 Ga0395905_0014823_4497_5975 492
422 3300042531 Ga0450918_000297 Ga0450918_000297_6374_7852 492
423 3300042876 Ga0451577_0026356 Ga0451577_0026356_2570_4048 492
424 3300044712 Ga0453684_0116644 Ga0453684_0116644_320_1981 492
425 3300046454 Ga0495592_0001883 Ga0495592_0001883_11838_13316 492
426 3300046512 Ga0495610_0036260 Ga0495610_0036260_200_1678 492
427 3300046519 Ga0495632_0001731 Ga0495632_0001731_1328_2806 492
428 3300046519 Ga0495632_0013288 Ga0495632_0013288_2162_3640 492
429 3300046542 Ga0495597_0004826 Ga0495597_0004826_648_2126 492
430 3300047443 Ga0495687_001868 Ga0495687_001868_15437_16915 492
431 3300048905 Ga0496102_0002898 Ga0496102_0002898_11919_13397 492
432 3300048905 Ga0496102_0059794 Ga0496102_0059794_1517_2995 492
433 3300049579 Ga0501043_0000002 Ga0501043_0000002_242020_243543 492
434 3300049580 Ga0501046_0000008 Ga0501046_0000008_242103_243626 492
435 3300049581 Ga0501047_0000003 Ga0501047_0000003_265285_266808 492
436 3300049582 Ga0501048_0003054 Ga0501048_0003054_1667_3190 492
437 3300049649 Ga0501198_000024 Ga0501198_000024_48763_50259 492
438 3300049662 Ga0501222_000020 Ga0501222_000020_16931_18427 492
439 3300050493 nmdc:mga0k408_100985_c1 nmdc:mga0k408_100985_c1_137_1615 492
440 3300050493 nmdc:mga0k408_1135_c1 nmdc:mga0k408_1135_c1_2494_3972 492
441 3300050493 nmdc:mga0k408_1527_c1 nmdc:mga0k408_1527_c1_361_1839 492
442 3300050493 nmdc:mga0k408_1574_c1 nmdc:mga0k408_1574_c1_9657_11135 492
443 3300050493 nmdc:mga0k408_2262_c1 nmdc:mga0k408_2262_c1_7395_8873 492
444 3300050493 nmdc:mga0k408_24154_c1 nmdc:mga0k408_24154_c1_1715_3193 492
445 3300050493 nmdc:mga0k408_3365_c1 nmdc:mga0k408_3365_c1_984_2462 492
446 3300050493 nmdc:mga0k408_669_c1 nmdc:mga0k408_669_c1_5047_6525 492
447 3300050496 nmdc:mga07m45_16841_c1 nmdc:mga07m45_16841_c1_1355_2833 492
448 3300050496 nmdc:mga07m45_23028_c1 nmdc:mga07m45_23028_c1_1789_3267 492
449 3300050496 nmdc:mga07m45_4955_c1 nmdc:mga07m45_4955_c1_4621_6099 492
450 3300050496 nmdc:mga07m45_6153_c1 nmdc:mga07m45_6153_c1_255_1733 492
451 3300050508 nmdc:mga09592_115584_c1 nmdc:mga09592_115584_c1_686_2164 492
452 3300050509 nmdc:mga0qj67_71171_c1 nmdc:mga0qj67_71171_c1_13_1491 492
453 3300053086 Ga0500578_0001754 Ga0500578_0001754_18918_20396 492
454 3300053086 Ga0500578_0020238 Ga0500578_0020238_2232_3710 492
455 3300053093 Ga0500651_0002891 Ga0500651_0002891_7574_9052 492
456 3300053118 Ga0500594_0007316 Ga0500594_0007316_520_1998 492
457 3300053131 Ga0500652_000522 Ga0500652_000522_10491_11969 492
458 3300053136 Ga0500559_0000032 Ga0500559_0000032_38272_39750 492
459 3300053139 Ga0500568_0023028 Ga0500568_0023028_846_2324 492
460 3300053154 Ga0500619_000006 Ga0500619_000006_23383_24861 492
461 3300053156 Ga0500622_0000872 Ga0500622_0000872_13000_14478 492
462 3300053156 Ga0500622_0001884 Ga0500622_0001884_1400_2878 492

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14691

Fer4_20

Dihydroprymidine dehydrogenase domain II, 4Fe-4S cluster

23

132

0.96

PF01266

DAO

FAD dependent oxidoreductase

145

182

0.96

PF01593

Amino_oxidase

Flavin containing amine oxidoreductase

153

186

0.95

PF00890

FAD_binding_2

FAD binding domain

145

185

0.93

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

148

204

0.92

PF01134

GIDA

Glucose inhibited division protein A

145

185

0.9

PF01494

FAD_binding_3

FAD binding domain

144

219

0.9

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

144

461

0.83

PF12831

FAD_oxidored

FAD dependent oxidoreductase

145

235

0.83

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

145

229

0.79

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

107

233

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
7e7h-assembly2.cif.gz_B crystal structure of a pseudooxynicotine amine oxidase pnao from pseudomonas putida s16 0.9683 145 180
4rep-assembly1.cif.gz_A crystal structure of gamma-carotenoid desaturase 0.9672 144 182
1sez-assembly1.cif.gz_A crystal structure of protoporphyrinogen ix oxidase 0.9649 143 180
7eme-assembly1.cif.gz_B putative leptospira interrogans recombinant l-amino acid oxidase 0.9631 144 180
6j38-assembly1.cif.gz_B-2 crystal structure of cmis2 0.9568 145 175
ID Description Score Start End Superfamily
af_Q2FVW3_2_361_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9893 146 178 3.50.50.60
af_A0A1D6E7M3_47_537_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9765 146 179 3.50.50.60
af_Q54US8_49_419_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9749 146 175 3.50.50.60
af_Q2FZ31_2_179_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.974 144 174 3.50.50.60
af_Q8H191_31_475_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.968 147 182 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A5C7PT19-F1-model_v4 Glutamate synthase (EC 1.4.1.13) 0.9559 262 492 GO:0004355
AF-A0A6J4Q838-F1-model_v4 Glutamate synthase [NADPH] small chain (EC 1.4.1.13) 0.9489 266 492 GO:0004355
AF-A0A5C7PT19-F1-model_v4 Glutamate synthase (EC 1.4.1.13) 0.9478 262 492 GO:0004355
AF-A0A6J4Q838-F1-model_v4 Glutamate synthase [NADPH] small chain (EC 1.4.1.13) 0.9448 266 492 GO:0004355
AF-A0A6G3V796-F1-model_v4 deleted 0.9386 250 418

Feature Viewer

pLDDT pTM Quality
76.49 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map