F448998

General Info

Members Datasets Scaffolds Average Seq Length
462 283 413 198

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_93227_c1|nmdc:mga00v17_93227_c1_62_712
Length 216
Sequence MQPGPTSGARVQNTRFMESGMSIVVRDVHAHELDSILELNNAAGPSILPLDDARLRQLHDTAEYFRVAERDGAMVGFLIGFGSGSDHASSNYAWFGAHYPDFFYIDRIVIASRRRGGGVGRAFYADVQSYAEVRYPLLTCEVFLEHDNDPVRLFHGSFGFREVGQHVMPGTDIRASMLVKDLCSYPWVRDTYGGTLPDEPWLGRPRAQQPDPGVHG

Samples

Sample ID Description Type Environment
1 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
2 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
3 2643221559 Lysobacter sp. Root559 Isolate Unclassified
4 2643221573 Lysobacter sp. Root604 Isolate Unclassified
5 2643221586 Lysobacter sp. Root667 Isolate Unclassified
6 2643221593 Lysobacter sp. Root690 Isolate Unclassified
7 2643221612 Lysobacter sp. Root76 Isolate Unclassified
8 2643221695 Lysobacter sp. Root494 Isolate Unclassified
9 2643221720 Lysobacter sp. Root916 Isolate Unclassified
10 2643221727 Lysobacter sp. Root96 Isolate Unclassified
11 2643221728 Lysobacter sp. Root983 Isolate Unclassified
12 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
13 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
14 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
15 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
16 2818991457 Xanthomonas translucens 569 Isolate Unclassified
17 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
18 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
19 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
20 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
21 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
22 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
23 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
24 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
25 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
26 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
27 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
28 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
29 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
30 2919513703 Luteimonas sp. 3794 Isolate Unclassified
31 2919675420 Luteimonas terrae 4099 Isolate Unclassified
32 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
33 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
34 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
35 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
36 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
37 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
38 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
39 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
40 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
41 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
42 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
43 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
44 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
45 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
46 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
47 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
48 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
49 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
50 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
51 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
52 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
53 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
54 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
55 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
56 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
57 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
58 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
59 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
60 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
61 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
62 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
63 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
64 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
65 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
66 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
67 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
68 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
69 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
70 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
71 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
72 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
73 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
74 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
75 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
76 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
77 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
78 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
93 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
94 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
95 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
104 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
105 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
106 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
110 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
111 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
157 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
158 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
159 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
160 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
161 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
162 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
163 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
180 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
181 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
182 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
183 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
184 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
185 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
186 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
187 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
188 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
189 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
190 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
191 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
192 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
193 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
194 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
195 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
196 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
197 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
198 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
199 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
200 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
201 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
202 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
203 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
204 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
205 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
206 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
207 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
208 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
209 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
210 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
211 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
212 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
213 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
214 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
215 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
216 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
219 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
220 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
221 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
222 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
223 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
224 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
238 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
239 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
240 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
243 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
244 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
262 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
263 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
264 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
265 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
266 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
267 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
268 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
269 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
270 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
271 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
272 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
273 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
274 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
275 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
278 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
279 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
280 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
281 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
282 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
283 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.31
Metatranscriptomes 1.08
Isolates 10.61

Biome Distribution

Category Percentage (%)
Aerial Root 0.22
Bulb 0
Endosphere 16.88
Nodule 0.22
Rhizoplane 6.71
Rhizosphere 61.47
Stem 0
Stem Tuber 0
Unclassified 14.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000146 3300002773 Bacteria 48401
2 JGI25150J39212_1000120 3300002774 Bacteria 44029
3 JGI25151J46595_10000107 3300003187 Bacteria 113288
4 JGI25151J46595_10000260 3300003187 Bacteria 61845
5 JGI25151J46595_10028710 3300003187 Bacteria 2212
6 JGI25153J46596_10000078 3300003215 Bacteria 113288
7 rootH2_10010511 3300003320 Bacteria 5288
8 Ga0055526_1000564 3300003771 Bacteria 29305
9 Ga0055526_1002454 3300003771 Bacteria 12538
10 Ga0055526_1004014 3300003771 Bacteria 9051
11 Ga0055537_1000251 3300003773 Bacteria 39049
12 Ga0055537_1000954 3300003773 Bacteria 13306
13 Ga0055524_1001496 3300003775 Bacteria 13307
14 Ga0055524_1006561 3300003775 Bacteria 5033
15 Ga0055524_1045172 3300003775 Bacteria 1063
16 Ga0055524_1065254 3300003775 Bacteria 730
17 Ga0055536_1036197 3300003781 Bacteria 1224
18 Ga0055534_1000913 3300003784 Bacteria 13307
19 Ga0055534_1001894 3300003784 Bacteria 7731
20 Ga0055528_1000533 3300003790 Bacteria 29305
21 Ga0055528_1002470 3300003790 Bacteria 9882
22 Ga0055530_10008328 3300003791 Bacteria 4174
23 Ga0055530_10013681 3300003791 Bacteria 2753
24 Ga0055531_10035506 3300003794 Bacteria 1558
25 Ga0058692_1000017 3300003856 Bacteria 274459
26 Ga0058692_1000022 3300003856 Bacteria 237321
27 Ga0065165_1100001 3300005262 Bacteria 727
28 Ga0065714_10031069 3300005288 Bacteria 965
29 Ga0065704_10089252 3300005289 Bacteria 2873
30 Ga0065704_10309477 3300005289 Bacteria 871
31 Ga0065715_10032433 3300005293 Bacteria 1688
32 Ga0065715_10268712 3300005293 Bacteria 1117
33 Ga0070658_10037681 3300005327 Bacteria 3898
34 Ga0070670_100008545 3300005331 Bacteria 8734
35 Ga0070670_100011146 3300005331 Bacteria 7682
36 Ga0070666_10146832 3300005335 Bacteria 1644
37 Ga0070680_100422762 3300005336 Bacteria 1137
38 Ga0070660_100127186 3300005339 Bacteria 2037
39 Ga0070668_100128771 3300005347 Bacteria 2030
40 Ga0070669_100028806 3300005353 Bacteria 4000
41 Ga0070669_100091235 3300005353 Bacteria 2284
42 Ga0070671_100050471 3300005355 Bacteria 3460
43 Ga0070671_100154173 3300005355 Bacteria 1940
44 Ga0070671_100212785 3300005355 Bacteria 1640
45 Ga0070673_100143596 3300005364 Bacteria 2016
46 Ga0070659_100209477 3300005366 Bacteria 1606
47 Ga0070667_100184190 3300005367 Bacteria 1848
48 Ga0070663_100405021 3300005455 Bacteria 1116
49 Ga0070679_100018127 3300005530 Bacteria 6825
50 Ga0070672_100005546 3300005543 Bacteria 8381
51 Ga0070672_100650320 3300005543 Bacteria 921
52 Ga0070665_100389260 3300005548 Bacteria 1402
53 Ga0070665_100390395 3300005548 Bacteria 1399
54 Ga0070664_100501639 3300005564 Bacteria 1118
55 Ga0068864_100023155 3300005618 Bacteria 5215
56 Ga0068862_100067754 3300005844 Bacteria 3078
57 Ga0068862_100068520 3300005844 Bacteria 3061
58 Ga0081539_10207050 3300005985 Bacteria 901
59 Ga0075364_10042346 3300006051 Bacteria 2958
60 Ga0075364_10494976 3300006051 Bacteria 836
61 Ga0075367_10018462 3300006178 Bacteria 3849
62 Ga0075369_10176259 3300006186 Bacteria 983
63 Ga0075431_100819277 3300006847 Bacteria 903
64 Ga0105251_10000259 3300009011 Bacteria 53031
65 Ga0105251_10002216 3300009011 Bacteria 15497
66 Ga0105244_10153998 3300009036 Bacteria 1100
67 Ga0105243_10001498 3300009148 Bacteria 20434
68 Ga0105243_10007322 3300009148 Bacteria 8487
69 Ga0105243_10866722 3300009148 Bacteria 896
70 Ga0105248_10211987 3300009177 Bacteria 2182
71 Ga0105148_100615 3300009978 Bacteria 2931
72 Ga0105032_102796 3300009979 Bacteria 1538
73 Ga0157343_1007310 3300012488 Bacteria 768
74 Ga0157315_1018884 3300012508 Bacteria 709
75 Ga0157373_10042500 3300013100 Bacteria 3248
76 Ga0157373_10441461 3300013100 Bacteria 936
77 Ga0157371_10075571 3300013102 Bacteria 2386
78 Ga0157371_10170105 3300013102 Bacteria 1557
79 Ga0157371_10402828 3300013102 Bacteria 1001
80 Ga0157370_10073786 3300013104 Bacteria 3219
81 Ga0157370_10281890 3300013104 Bacteria 1535
82 Ga0157370_10442856 3300013104 Bacteria 1195
83 Ga0157370_10859485 3300013104 Bacteria 824
84 Ga0157369_10062739 3300013105 Bacteria 4004
85 Ga0157369_10121907 3300013105 Bacteria 2766
86 Ga0163162_11204801 3300013306 Bacteria 859
87 Ga0157372_11289328 3300013307 Bacteria 843
88 Ga0182008_10000880 3300014497 Bacteria 20870
89 Ga0182008_10086914 3300014497 Bacteria 1540
90 Ga0182006_1012610 3300015261 Bacteria 3695
91 Ga0182006_1076868 3300015261 Bacteria 1226
92 Ga0182007_10000099 3300015262 Bacteria 60975
93 Ga0182005_1000495 3300015265 Bacteria 20104
94 Ga0182005_1006713 3300015265 Bacteria 3493
95 Ga0183360_10001 3300015689 Bacteria 3943671
96 Ga0163161_10014174 3300017792 Bacteria 5552
97 Ga0163161_10073257 3300017792 Bacteria 2509
98 Ga0163161_10172953 3300017792 Bacteria 1652
99 Ga0206349_1336891 3300020075 Bacteria 1170
100 Ga0207425_1000028 3300025245 Bacteria 286333
101 Ga0207425_1014047 3300025245 Bacteria 1829
102 Ga0209129_1000065 3300025258 Bacteria 232568
103 Ga0209565_1000005 3300025263 Bacteria 947317
104 Ga0209565_1000031 3300025263 Bacteria 320341
105 Ga0209673_1000011 3300025273 Bacteria 586604
106 Ga0209673_1000484 3300025273 Bacteria 66361
107 Ga0209130_1015005 3300025284 Bacteria 1924
108 Ga0209130_1019819 3300025284 Bacteria 1551
109 Ga0209675_1000004 3300025291 Bacteria 947166
110 Ga0209675_1000015 3300025291 Bacteria 403517
111 Ga0209675_1006730 3300025291 Bacteria 4548
112 Ga0209676_1000225 3300025292 Bacteria 124018
113 Ga0209676_1000892 3300025292 Bacteria 38056
114 Ga0209676_1001193 3300025292 Bacteria 27924
115 Ga0209025_1000002 3300025294 Bacteria 1393142
116 Ga0209025_1000036 3300025294 Bacteria 404113
117 Ga0209025_1008389 3300025294 Bacteria 7447
118 Ga0209025_1025298 3300025294 Bacteria 3027
119 Ga0209564_1000018 3300025295 Bacteria 586913
120 Ga0209564_1000480 3300025295 Bacteria 66421
121 Ga0209564_1004657 3300025295 Bacteria 8241
122 Ga0209758_1000003 3300025297 Bacteria 1398533
123 Ga0209758_1024688 3300025297 Bacteria 2670
124 Ga0209758_1039930 3300025297 Bacteria 1777
125 Ga0209050_1000201 3300025298 Bacteria 134028
126 Ga0209050_1000998 3300025298 Bacteria 35642
127 Ga0209050_1005741 3300025298 Bacteria 7657
128 Ga0209050_1062528 3300025298 Bacteria 872
129 Ga0209256_1000021 3300025299 Bacteria 537097
130 Ga0209256_1005457 3300025299 Bacteria 7315
131 Ga0209256_1010568 3300025299 Bacteria 3841
132 Ga0209256_1026198 3300025299 Bacteria 1684
133 Ga0209051_1001219 3300025303 Bacteria 23138
134 Ga0209051_1007665 3300025303 Bacteria 5865
135 Ga0209257_1000133 3300025304 Bacteria 208808
136 Ga0209257_1000208 3300025304 Bacteria 141393
137 Ga0209257_1000308 3300025304 Bacteria 105012
138 Ga0209257_1002220 3300025304 Bacteria 19971
139 Ga0209257_1004172 3300025304 Bacteria 11472
140 Ga0209257_1013176 3300025304 Bacteria 3713
141 Ga0209257_1013329 3300025304 Bacteria 3671
142 Ga0209257_1063531 3300025304 Bacteria 996
143 Ga0207655_1070830 3300025728 Bacteria 1296
144 Ga0207713_1000282 3300025735 Bacteria 59331
145 Ga0207713_1005483 3300025735 Bacteria 7921
146 Ga0207647_10218664 3300025904 Bacteria 1098
147 Ga0207705_10056588 3300025909 Bacteria 2828
148 Ga0207707_10267551 3300025912 Bacteria 1482
149 Ga0207660_10630629 3300025917 Bacteria 873
150 Ga0207657_10020970 3300025919 Bacteria 6163
151 Ga0207649_10347144 3300025920 Bacteria 1097
152 Ga0207652_10278983 3300025921 Bacteria 1507
153 Ga0207681_10434188 3300025923 Bacteria 1066
154 Ga0207681_10590211 3300025923 Bacteria 917
155 Ga0207650_10005386 3300025925 Bacteria 8727
156 Ga0207650_10130888 3300025925 Bacteria 1963
157 Ga0207659_10208130 3300025926 Bacteria 1566
158 Ga0207659_10398207 3300025926 Bacteria 1151
159 Ga0207644_10005634 3300025931 Bacteria 8154
160 Ga0207644_10330370 3300025931 Bacteria 1234
161 Ga0207690_10198191 3300025932 Bacteria 1523
162 Ga0207709_10001467 3300025935 Bacteria 16381
163 Ga0207709_10002281 3300025935 Bacteria 12175
164 Ga0207691_10000184 3300025940 Bacteria 59044
165 Ga0207651_10045181 3300025960 Bacteria 2953
166 Ga0207668_10019560 3300025972 Bacteria 4284
167 Ga0207668_10347086 3300025972 Bacteria 1240
168 Ga0207658_10159080 3300025986 Bacteria 1850
169 Ga0207658_10240609 3300025986 Bacteria 1533
170 Ga0207648_10136175 3300026089 Bacteria 2163
171 Ga0207683_10490072 3300026121 Bacteria 1135
172 Ga0209371_1000004 3300027312 Bacteria 1098197
173 Ga0209371_1000044 3300027312 Bacteria 327086
174 Ga0209967_1017040 3300027364 Bacteria 1046
175 Ga0209981_1012458 3300027378 Bacteria 1178
176 Ga0209995_1012269 3300027471 Bacteria 1397
177 Ga0209999_1000972 3300027543 Bacteria 4840
178 Ga0209982_1000533 3300027552 Bacteria 4742
179 Ga0209970_1000890 3300027614 Bacteria 5258
180 Ga0209983_1000051 3300027665 Bacteria 17495
181 Ga0209971_1001064 3300027682 Bacteria 6984
182 Ga0209974_10001734 3300027876 Bacteria 7922
183 Ga0209974_10006782 3300027876 Bacteria 3976
184 Ga0268266_10178419 3300028379 Bacteria 1932
185 Ga0268266_10792314 3300028379 Bacteria 915
186 Ga0268265_10109352 3300028380 Bacteria 2253
187 Ga0268265_10372301 3300028380 Bacteria 1311
188 Ga0307515_10285541 3300028794 Bacteria 1352
189 Ga0268256_1000005 3300030500 Bacteria 1082342
190 Ga0268256_1000046 3300030500 Bacteria 327003
191 Ga0316177_1103515 3300030731 Bacteria 3216
192 Ga0314311_1131980 3300030733 Bacteria 1223
193 Ga0316178_1031131 3300030735 Bacteria 2858
194 Ga0316178_1155411 3300030735 Bacteria 701
195 Ga0316183_1147356 3300030742 Bacteria 3524
196 Ga0316182_1298001 3300030745 Bacteria 1241
197 Ga0307513_10235724 3300031456 Bacteria 1639
198 Ga0307408_100367752 3300031548 Bacteria 1225
199 Ga0307408_100490534 3300031548 Bacteria 1073
200 Ga0307408_100613453 3300031548 Bacteria 968
201 Ga0307405_10126431 3300031731 Bacteria 1758
202 Ga0307405_10142733 3300031731 Bacteria 1672
203 Ga0307405_10153141 3300031731 Bacteria 1624
204 Ga0307405_10177471 3300031731 Bacteria 1526
205 Ga0307405_10612367 3300031731 Bacteria 890
206 Ga0307413_10021221 3300031824 Bacteria 3472
207 Ga0307413_10054540 3300031824 Bacteria 2426
208 Ga0307413_10209315 3300031824 Bacteria 1415
209 Ga0307413_10219736 3300031824 Bacteria 1387
210 Ga0307413_10228428 3300031824 Bacteria 1365
211 Ga0307413_10369657 3300031824 Bacteria 1113
212 Ga0307413_11060394 3300031824 Bacteria 698
213 Ga0307406_10012614 3300031901 Bacteria 4820
214 Ga0307406_10068922 3300031901 Bacteria 2311
215 Ga0307406_10184568 3300031901 Bacteria 1522
216 Ga0307407_10243189 3300031903 Bacteria 1229
217 Ga0307412_10375408 3300031911 Bacteria 1149
218 Ga0307409_100191581 3300031995 Bacteria 1820
219 Ga0307416_100226610 3300032002 Bacteria 1798
220 Ga0307414_10000329 3300032004 Bacteria 27035
221 Ga0307414_10012936 3300032004 Bacteria 4955
222 Ga0307414_10015376 3300032004 Bacteria 4617
223 Ga0307414_10060143 3300032004 Bacteria 2685
224 Ga0307414_10457739 3300032004 Bacteria 1120
225 Ga0307414_10570883 3300032004 Bacteria 1011
226 Ga0307414_10608734 3300032004 Bacteria 980
227 Ga0307414_10618304 3300032004 Bacteria 973
228 Ga0307414_11106820 3300032004 Bacteria 731
229 Ga0307411_10128219 3300032005 Bacteria 1849
230 Ga0307411_10156121 3300032005 Bacteria 1702
231 Ga0307411_10163807 3300032005 Bacteria 1669
232 Ga0307411_11183041 3300032005 Bacteria 692
233 Ga0373962_0014753 3300035242 Bacteria 1995
234 Ga0395899_0071582 3300037312 Bacteria 2537
235 Ga0395900_0081524 3300037418 Bacteria 3324
236 Ga0395900_0090493 3300037418 Bacteria 3145
237 Ga0395905_0006744 3300037471 Bacteria 11500
238 Ga0395905_0036234 3300037471 Bacteria 4633
239 Ga0395905_0202029 3300037471 Bacteria 1863
240 Ga0395905_0317843 3300037471 Bacteria 1446
241 Ga0395901_0069735 3300038443 Bacteria 3661
242 Ga0395901_0646771 3300038443 Bacteria 1061
243 Ga0237819_00475 3300038705 Bacteria 13629
244 Ga0237819_05853 3300038705 Bacteria 1893
245 Ga0439436_0003453 3300041404 Bacteria 4803
246 Ga0439436_0005621 3300041404 Bacteria 3844
247 Ga0439436_0023838 3300041404 Bacteria 1809
248 Ga0439436_0052724 3300041404 Bacteria 1147
249 Ga0439439_0004959 3300041406 Bacteria 3022
250 Ga0439439_0006794 3300041406 Bacteria 2654
251 Ga0439439_0018526 3300041406 Bacteria 1721
252 Ga0439447_000418 3300041407 Bacteria 15789
253 Ga0439465_0003036 3300041413 Bacteria 5490
254 Ga0439465_0017941 3300041413 Bacteria 2211
255 Ga0451789_0317850 3300041443 Bacteria 1605
256 Ga0451791_0175559 3300041451 Bacteria 2761
257 Ga0451793_0733973 3300041452 Bacteria 2531
258 Ga0451797_0418770 3300041453 Bacteria 2463
259 Ga0451795_1454739 3300041456 Bacteria 1770
260 Ga0451798_0074155 3300041458 Bacteria 1807
261 Ga0451800_0059364 3300041459 Bacteria 3151
262 Ga0451802_0486033 3300041460 Bacteria 1434
263 Ga0451806_285401 3300041462 Bacteria 3006
264 Ga0451807_0059239 3300041486 Bacteria 1334
265 Ga0451807_0630037 3300041486 Bacteria 4204
266 Ga0451807_0815549 3300041486 Bacteria 837
267 Ga0451837_0345653 3300041494 Bacteria 1662
268 Ga0451837_1594181 3300041494 Bacteria 710
269 Ga0451841_0292612 3300041498 Bacteria 974
270 Ga0451843_1279593 3300041509 Bacteria 1041
271 Ga0451853_2090098 3300041512 Bacteria 755
272 Ga0439431_0005023 3300041997 Bacteria 2915
273 Ga0439445_0007957 3300042004 Bacteria 2473
274 Ga0439445_0016626 3300042004 Bacteria 1812
275 Ga0439449_0003099 3300042007 Bacteria 6478
276 Ga0439449_0005487 3300042007 Bacteria 4858
277 Ga0439449_0018158 3300042007 Bacteria 2639
278 Ga0439449_0025324 3300042007 Bacteria 2218
279 Ga0439449_0034293 3300042007 Bacteria 1890
280 Ga0439449_0040440 3300042007 Bacteria 1733
281 Ga0439449_0088007 3300042007 Bacteria 1146
282 Ga0439452_087391 3300042010 Bacteria 676
283 Ga0439457_046952 3300042014 Bacteria 966
284 Ga0439462_0009075 3300042015 Bacteria 2516
285 Ga0439462_0037208 3300042015 Bacteria 1296
286 Ga0439446_0065328 3300042156 Bacteria 1106
287 Ga0439446_0179223 3300042156 Bacteria 708
288 Ga0439434_0036575 3300042435 Bacteria 1502
289 Ga0451577_0005403 3300042876 Bacteria 13110
290 Ga0453684_0372500 3300044712 Bacteria 1605
291 Ga0495627_023554 3300046453 Bacteria 2015
292 Ga0495627_040933 3300046453 Bacteria 1425
293 Ga0495638_0002252 3300046460 Bacteria 15992
294 Ga0495638_0136540 3300046460 Bacteria 1435
295 Ga0495607_0035742 3300046501 Bacteria 3002
296 Ga0495606_0015919 3300046507 Bacteria 5767
297 Ga0495663_0000749 3300046525 Bacteria 11143
298 Ga0495663_0006791 3300046525 Bacteria 3156
299 Ga0495663_0015621 3300046525 Bacteria 2139
300 Ga0495663_0026885 3300046525 Bacteria 1686
301 Ga0495663_0032960 3300046525 Bacteria 1545
302 Ga0495598_0001238 3300046537 Bacteria 4962
303 Ga0495621_0000225 3300046539 Bacteria 13202
304 Ga0495621_0010504 3300046539 Bacteria 2835
305 Ga0495633_0002789 3300046558 Bacteria 12079
306 Ga0495633_0040492 3300046558 Bacteria 2219
307 Ga0495633_0218778 3300046558 Bacteria 872
308 Ga0495656_0013832 3300046615 Bacteria 3011
309 Ga0495656_0020876 3300046615 Bacteria 2544
310 Ga0495656_0130117 3300046615 Bacteria 1197
311 Ga0495668_0041284 3300046616 Bacteria 2570
312 Ga0495659_0067156 3300046664 Bacteria 1337
313 Ga0495670_0173159 3300046691 Bacteria 1137
314 Ga0495671_0024889 3300046692 Bacteria 3115
315 Ga0495636_0004741 3300047318 Bacteria 5334
316 Ga0495636_0029507 3300047318 Bacteria 2238
317 Ga0495636_0037613 3300047318 Bacteria 1999
318 Ga0495672_0000230 3300047320 Bacteria 79829
319 Ga0495685_071034 3300047447 Bacteria 1166
320 Ga0495686_0013972 3300047472 Bacteria 5551
321 Ga0496101_0094352 3300048904 Bacteria 2230
322 Ga0496102_0493106 3300048905 Bacteria 1147
323 Ga0496103_0089642 3300048906 Bacteria 1940
324 Ga0496107_0076888 3300048910 Bacteria 2431
325 Ga0496108_0345640 3300048911 Bacteria 1298
326 Ga0496109_0043912 3300048912 Bacteria 4053
327 Ga0496109_0077929 3300048912 Bacteria 3050
328 Ga0496109_0298826 3300048912 Bacteria 1518
329 Ga0496109_0468984 3300048912 Bacteria 1189
330 Ga0496109_0514299 3300048912 Bacteria 1130
331 Ga0496110_0207752 3300048913 Bacteria 1779
332 Ga0496110_1011057 3300048913 Bacteria 739
333 Ga0496111_0032428 3300048914 Bacteria 3724
334 Ga0496111_0459501 3300048914 Bacteria 939
335 Ga0496112_0069103 3300048915 Bacteria 3489
336 Ga0496112_0072064 3300048915 Bacteria 3415
337 Ga0496113_0036358 3300048916 Bacteria 3607
338 Ga0496113_0067516 3300048916 Bacteria 2711
339 Ga0496114_0286303 3300048917 Bacteria 1453
340 Ga0496116_0031818 3300048919 Bacteria 3769
341 Ga0496116_0112042 3300048919 Bacteria 1600
342 Ga0496117_0003906 3300048920 Bacteria 16886
343 Ga0496117_0038210 3300048920 Bacteria 3564
344 Ga0496117_0042411 3300048920 Bacteria 3320
345 Ga0496117_0087233 3300048920 Bacteria 2023
346 Ga0496118_0002535 3300048921 Bacteria 24467
347 Ga0496118_0052941 3300048921 Bacteria 3090
348 Ga0496118_0060633 3300048921 Bacteria 2807
349 Ga0496118_0148350 3300048921 Bacteria 1472
350 Ga0496119_0035713 3300048922 Bacteria 3252
351 Ga0496120_0030599 3300048923 Bacteria 3268
352 Ga0496121_0003326 3300048924 Bacteria 23084
353 Ga0496121_0052000 3300048924 Bacteria 3445
354 Ga0496122_0001370 3300048925 Bacteria 39655
355 Ga0496122_0043307 3300048925 Bacteria 3528
356 Ga0496122_0052650 3300048925 Bacteria 3078
357 Ga0496123_0001175 3300048926 Bacteria 38651
358 Ga0496123_0011721 3300048926 Bacteria 7560
359 Ga0496123_0032587 3300048926 Bacteria 3768
360 Ga0496123_0034574 3300048926 Bacteria 3617
361 Ga0496124_0000018 3300048927 Bacteria 442940
362 Ga0496124_0002618 3300048927 Bacteria 23190
363 Ga0496124_0060919 3300048927 Bacteria 3164
364 Ga0496125_0015924 3300048928 Bacteria 7241
365 Ga0496125_0038367 3300048928 Bacteria 4147
366 Ga0496125_0067922 3300048928 Bacteria 2806
367 Ga0496125_0114832 3300048928 Bacteria 1938
368 Ga0496126_0054562 3300048929 Bacteria 3619
369 Ga0501306_011781 3300049127 Bacteria 1119
370 Ga0501307_007509 3300049162 Bacteria 1205
371 Ga0501313_028727 3300049529 Bacteria 714
372 Ga0501325_012146 3300049541 Bacteria 806
373 Ga0501031_0031595 3300049568 Bacteria 3453
374 Ga0501031_0196411 3300049568 Bacteria 1317
375 Ga0501032_0010282 3300049569 Bacteria 6752
376 Ga0501033_0000565 3300049570 Bacteria 34468
377 Ga0501034_0000420 3300049571 Bacteria 71131
378 Ga0501034_0000853 3300049571 Bacteria 45135
379 Ga0501034_0007748 3300049571 Bacteria 11415
380 Ga0501034_0091029 3300049571 Bacteria 3048
381 Ga0501036_0005122 3300049572 Bacteria 10591
382 Ga0501037_0003208 3300049573 Bacteria 11853
383 Ga0501038_0017629 3300049574 Bacteria 6452
384 Ga0501039_0012418 3300049575 Bacteria 6504
385 Ga0501043_0007657 3300049579 Bacteria 8558
386 Ga0501043_0046073 3300049579 Bacteria 3428
387 Ga0501070_0040881 3300049586 Bacteria 3864
388 Ga0501071_0268521 3300049587 Bacteria 1289
389 Ga0501073_0069033 3300049589 Bacteria 2463
390 Ga0501207_027362 3300049654 Bacteria 944
391 Ga0501223_017261 3300049663 Bacteria 1424
392 Ga0501239_003937 3300049672 Bacteria 1436
393 Ga0501240_019241 3300049673 Bacteria 1012
394 Ga0501242_008145 3300049674 Bacteria 1222
395 Ga0501259_006720 3300049688 Bacteria 1834
396 Ga0501221_008309 3300049704 Bacteria 1802
397 Ga0501225_0024690 3300049705 Bacteria 1654
398 Ga0501225_0029833 3300049705 Bacteria 1499
399 Ga0501080_0015225 3300049742 Bacteria 7088
400 Ga0501268_009146 3300049765 Bacteria 1517
401 Ga0501268_026054 3300049765 Bacteria 1031
402 Ga0501275_000854 3300049772 Bacteria 3289
403 Ga0501280_029003 3300049776 Bacteria 857
404 Ga0501035_0022186 3300049822 Bacteria 5832
405 Ga0501044_0085717 3300049823 Bacteria 3182
406 Ga0501045_0210612 3300049824 Bacteria 1448
407 nmdc:mga00v17_111733_c1 3300050491 Bacteria 1734
408 nmdc:mga00v17_38970_c1 3300050491 Bacteria 2844
409 nmdc:mga00v17_623_c1 3300050491 Bacteria 19651
410 nmdc:mga00v17_93227_c1 3300050491 Bacteria 1894
411 nmdc:mga00v17_94661_c1 3300050491 Bacteria 1880
412 Ga0500634_0000128 3300053161 Bacteria 27544
413 Ga0500637_0366131 3300053178 Bacteria 761

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026121 Ga0207683_10490072 Ga0207683_104900722 160
2 3300006051 Ga0075364_10494976 Ga0075364_104949762 176
3 3300013104 Ga0157370_10281890 Ga0157370_102818902 176
4 3300017792 Ga0163161_10172953 Ga0163161_101729532 176
5 3300050491 nmdc:mga00v17_38970_c1 nmdc:mga00v17_38970_c1_2241_2834 178
6 3300041512 Ga0451853_2090098 Ga0451853_2090098_35_628 180
7 3300005355 Ga0070671_100050471 Ga0070671_1000504712 181
8 3300025931 Ga0207644_10005634 Ga0207644_100056347 181
9 3300032005 Ga0307411_10163807 Ga0307411_101638072 181
10 3300046525 Ga0495663_0006791 Ga0495663_0006791_1524_2120 181
11 3300046558 Ga0495633_0002789 Ga0495633_0002789_1025_1621 181
12 3300048904 Ga0496101_0094352 Ga0496101_0094352_1103_1699 181
13 3300048905 Ga0496102_0493106 Ga0496102_0493106_460_1056 181
14 3300048912 Ga0496109_0043912 Ga0496109_0043912_2305_2901 181
15 3300048913 Ga0496110_1011057 Ga0496110_1011057_21_617 181
16 3300048914 Ga0496111_0459501 Ga0496111_0459501_246_842 181
17 3300048915 Ga0496112_0069103 Ga0496112_0069103_527_1123 181
18 3300048916 Ga0496113_0067516 Ga0496113_0067516_263_859 181
19 3300009177 Ga0105248_10211987 Ga0105248_102119872 182
20 3300048928 Ga0496125_0067922 Ga0496125_0067922_1127_1723 184
21 3300006178 Ga0075367_10018462 Ga0075367_100184623 187
22 3300012508 Ga0157315_1018884 Ga0157315_10188841 187
23 3300013100 Ga0157373_10042500 Ga0157373_100425003 187
24 3300048919 Ga0496116_0112042 Ga0496116_0112042_341_937 187
25 3300050491 nmdc:mga00v17_111733_c1 nmdc:mga00v17_111733_c1_20_613 187
26 3300013104 Ga0157370_10073786 Ga0157370_100737864 188
27 3300014497 Ga0182008_10000880 Ga0182008_1000088023 188
28 3300017792 Ga0163161_10014174 Ga0163161_100141743 188
29 3300032004 Ga0307414_10457739 Ga0307414_104577392 188
30 3300041498 Ga0451841_0292612 Ga0451841_0292612_186_782 188
31 3300046453 Ga0495627_023554 Ga0495627_023554_639_1235 188
32 3300046460 Ga0495638_0002252 Ga0495638_0002252_4259_4855 188
33 3300046525 Ga0495663_0015621 Ga0495663_0015621_730_1326 188
34 3300048920 Ga0496117_0003906 Ga0496117_0003906_759_1355 188
35 3300048920 Ga0496117_0038210 Ga0496117_0038210_2956_3552 188
36 3300048921 Ga0496118_0002535 Ga0496118_0002535_17679_18275 188
37 3300048925 Ga0496122_0052650 Ga0496122_0052650_193_789 188
38 3300048926 Ga0496123_0032587 Ga0496123_0032587_2420_3016 188
39 3300048928 Ga0496125_0015924 Ga0496125_0015924_4017_4613 188
40 3300005262 Ga0065165_1100001 Ga0065165_11000011 189
41 3300009011 Ga0105251_10002216 Ga0105251_1000221614 189
42 3300025284 Ga0209130_1015005 Ga0209130_10150052 189
43 3300025292 Ga0209676_1000892 Ga0209676_100089217 189
44 3300025292 Ga0209676_1001193 Ga0209676_100119322 189
45 3300025298 Ga0209050_1000201 Ga0209050_100020172 189
46 3300025299 Ga0209256_1005457 Ga0209256_10054577 189
47 3300025303 Ga0209051_1001219 Ga0209051_100121914 189
48 3300025304 Ga0209257_1000208 Ga0209257_100020875 189
49 3300025304 Ga0209257_1002220 Ga0209257_10022203 189
50 3300025735 Ga0207713_1005483 Ga0207713_10054834 189
51 3300005327 Ga0070658_10037681 Ga0070658_100376814 190
52 3300005339 Ga0070660_100127186 Ga0070660_1001271862 190
53 3300005366 Ga0070659_100209477 Ga0070659_1002094772 190
54 3300005455 Ga0070663_100405021 Ga0070663_1004050211 190
55 3300013102 Ga0157371_10075571 Ga0157371_100755713 190
56 3300013102 Ga0157371_10170105 Ga0157371_101701052 190
57 3300013104 Ga0157370_10442856 Ga0157370_104428562 190
58 3300025904 Ga0207647_10218664 Ga0207647_102186642 190
59 3300025909 Ga0207705_10056588 Ga0207705_100565883 190
60 3300025912 Ga0207707_10267551 Ga0207707_102675511 190
61 3300025919 Ga0207657_10020970 Ga0207657_100209706 190
62 3300025920 Ga0207649_10347144 Ga0207649_103471442 190
63 3300025932 Ga0207690_10198191 Ga0207690_101981912 190
64 3300037471 Ga0395905_0036234 Ga0395905_0036234_205_828 191
65 3300049568 Ga0501031_0196411 Ga0501031_0196411_554_1153 192
66 iso_pu_bacteria 2987605356 2987607572 192
67 iso_pu_bacteria 2571042365 2572256273 193
68 iso_pu_bacteria 2576861471 2578459192 193
69 iso_pu_bacteria 2643221559 2643815672 193
70 iso_pu_bacteria 2643221573 2643878226 193
71 iso_pu_bacteria 2643221586 2643940824 193
72 iso_pu_bacteria 2643221593 2643975676 193
73 iso_pu_bacteria 2643221612 2644080130 193
74 iso_pu_bacteria 2643221695 2644528597 193
75 iso_pu_bacteria 2643221720 2644659530 193
76 iso_pu_bacteria 2643221727 2644695726 193
77 iso_pu_bacteria 2643221728 2644700720 193
78 iso_pu_bacteria 2747842428 2747949594 193
79 iso_pu_bacteria 2747842501 2748017141 193
80 iso_pu_bacteria 2765235840 2765578124 193
81 iso_pu_bacteria 2816332141 2816516186 193
82 iso_pu_bacteria 2818991457 2819660386 193
83 iso_pu_bacteria 2842391507 2842393624 193
84 iso_pu_bacteria 2842757796 2842759343 193
85 iso_pu_bacteria 2852684882 2852689080 193
86 iso_pu_bacteria 2857442823 2857442959 193
87 iso_pu_bacteria 2874220319 2874220780 193
88 iso_pu_bacteria 2894414249 2894417370 193
89 iso_pu_bacteria 2895498888 2895502398 193
90 iso_pu_bacteria 2895511927 2895514271 193
91 iso_pu_bacteria 2895522137 2895524250 193
92 iso_pu_bacteria 2895525241 2895525982 193
93 iso_pu_bacteria 2919089067 2919090810 193
94 iso_pu_bacteria 2919130084 2919130347 193
95 iso_pu_bacteria 2919134579 2919136998 193
96 iso_pu_bacteria 2919513703 2919515905 193
97 iso_pu_bacteria 2919675420 2919677260 193
98 iso_pu_bacteria 2928496128 2928496794 193
99 iso_pu_bacteria 2929195423 2929198648 193
100 iso_pu_bacteria 2931380184 2931381598 193
101 iso_pu_bacteria 2937610967 2937611611 193
102 iso_pu_bacteria 2939589442 2939592193 193
103 iso_pu_bacteria 2939622612 2939625104 193
104 iso_pu_bacteria 2939626828 2939627546 193
105 iso_pu_bacteria 2941489479 2941493908 193
106 iso_pu_bacteria 2961047084 2961047545 193
107 iso_pu_bacteria 2961064222 2961068327 193
108 iso_pu_bacteria 2974307012 2974309630 193
109 iso_pu_bacteria 2977247770 2977250379 193
110 iso_pu_bacteria 2984514374 2984515157 193
111 iso_pu_bacteria 2995948881 2995952590 193
112 iso_pu_bacteria 8003014200 8003016435 193
113 iso_pu_bacteria 8021622325 8021626012 193
114 iso_pu_bacteria 8021648035 8021651743 193
115 3300005288 Ga0065714_10031069 Ga0065714_100310692 194
116 3300005336 Ga0070680_100422762 Ga0070680_1004227621 194
117 3300009978 Ga0105148_100615 Ga0105148_1006151 194
118 3300013104 Ga0157370_10859485 Ga0157370_108594852 194
119 3300030731 Ga0316177_1103515 Ga0316177_11035152 194
120 3300030733 Ga0314311_1131980 Ga0314311_11319801 194
121 3300030735 Ga0316178_1031131 Ga0316178_10311312 194
122 3300031824 Ga0307413_10054540 Ga0307413_100545402 194
123 3300031824 Ga0307413_11060394 Ga0307413_110603941 194
124 3300041404 Ga0439436_0052724 Ga0439436_0052724_298_897 194
125 3300041486 Ga0451807_0815549 Ga0451807_0815549_193_810 194
126 3300041494 Ga0451837_1594181 Ga0451837_1594181_28_615 194
127 3300041509 Ga0451843_1279593 Ga0451843_1279593_152_769 194
128 3300042014 Ga0439457_046952 Ga0439457_046952_203_802 194
129 3300042156 Ga0439446_0179223 Ga0439446_0179223_71_670 194
130 3300042876 Ga0451577_0005403 Ga0451577_0005403_10485_11099 194
131 3300044712 Ga0453684_0372500 Ga0453684_0372500_194_808 194
132 3300049568 Ga0501031_0031595 Ga0501031_0031595_2216_2818 194
133 3300049569 Ga0501032_0010282 Ga0501032_0010282_4624_5226 194
134 3300049571 Ga0501034_0007748 Ga0501034_0007748_208_810 194
135 3300049572 Ga0501036_0005122 Ga0501036_0005122_4684_5286 194
136 3300049573 Ga0501037_0003208 Ga0501037_0003208_3137_3739 194
137 3300049574 Ga0501038_0017629 Ga0501038_0017629_4840_5442 194
138 3300049575 Ga0501039_0012418 Ga0501039_0012418_4131_4733 194
139 3300049579 Ga0501043_0046073 Ga0501043_0046073_1118_1720 194
140 3300049586 Ga0501070_0040881 Ga0501070_0040881_101_703 194
141 3300049587 Ga0501071_0268521 Ga0501071_0268521_109_711 194
142 3300049589 Ga0501073_0069033 Ga0501073_0069033_1104_1706 194
143 3300049742 Ga0501080_0015225 Ga0501080_0015225_1859_2461 194
144 3300049772 Ga0501275_000854 Ga0501275_000854_851_1465 194
145 3300049822 Ga0501035_0022186 Ga0501035_0022186_452_1054 194
146 3300049823 Ga0501044_0085717 Ga0501044_0085717_1968_2570 194
147 3300050491 nmdc:mga00v17_93227_c1 nmdc:mga00v17_93227_c1_62_712 194
148 3300050491 nmdc:mga00v17_94661_c1 nmdc:mga00v17_94661_c1_1244_1834 194
149 3300053178 Ga0500637_0366131 Ga0500637_0366131_41_655 194
150 3300005293 Ga0065715_10032433 Ga0065715_100324332 195
151 3300005293 Ga0065715_10268712 Ga0065715_102687121 195
152 3300025926 Ga0207659_10208130 Ga0207659_102081302 195
153 3300025986 Ga0207658_10159080 Ga0207658_101590801 195
154 3300027364 Ga0209967_1017040 Ga0209967_10170401 195
155 3300027378 Ga0209981_1012458 Ga0209981_10124582 195
156 3300027471 Ga0209995_1012269 Ga0209995_10122692 195
157 3300027543 Ga0209999_1000972 Ga0209999_10009724 195
158 3300027552 Ga0209982_1000533 Ga0209982_10005334 195
159 3300027614 Ga0209970_1000890 Ga0209970_10008904 195
160 3300027665 Ga0209983_1000051 Ga0209983_100005111 195
161 3300027682 Ga0209971_1001064 Ga0209971_10010646 195
162 3300027876 Ga0209974_10001734 Ga0209974_100017349 195
163 3300027876 Ga0209974_10006782 Ga0209974_100067824 195
164 3300031548 Ga0307408_100367752 Ga0307408_1003677522 195
165 3300031548 Ga0307408_100490534 Ga0307408_1004905341 195
166 3300031731 Ga0307405_10142733 Ga0307405_101427331 195
167 3300031731 Ga0307405_10177471 Ga0307405_101774712 195
168 3300031731 Ga0307405_10612367 Ga0307405_106123671 195
169 3300031824 Ga0307413_10228428 Ga0307413_102284281 195
170 3300031901 Ga0307406_10068922 Ga0307406_100689222 195
171 3300031903 Ga0307407_10243189 Ga0307407_102431892 195
172 3300031995 Ga0307409_100191581 Ga0307409_1001915812 195
173 3300032002 Ga0307416_100226610 Ga0307416_1002266102 195
174 3300032004 Ga0307414_10570883 Ga0307414_105708832 195
175 3300032005 Ga0307411_10156121 Ga0307411_101561211 195
176 3300035242 Ga0373962_0014753 Ga0373962_0014753_383_991 195
177 3300037312 Ga0395899_0071582 Ga0395899_0071582_1078_1674 195
178 3300037418 Ga0395900_0090493 Ga0395900_0090493_1176_1772 195
179 3300037471 Ga0395905_0006744 Ga0395905_0006744_728_1324 195
180 3300037471 Ga0395905_0202029 Ga0395905_0202029_985_1581 195
181 3300037471 Ga0395905_0317843 Ga0395905_0317843_730_1326 195
182 3300038443 Ga0395901_0069735 Ga0395901_0069735_2098_2694 195
183 3300038443 Ga0395901_0646771 Ga0395901_0646771_184_780 195
184 3300046615 Ga0495656_0130117 Ga0495656_0130117_314_916 195
185 3300047318 Ga0495636_0037613 Ga0495636_0037613_1131_1733 195
186 3300048912 Ga0496109_0298826 Ga0496109_0298826_764_1366 195
187 3300049673 Ga0501240_019241 Ga0501240_019241_81_686 195
188 3300049674 Ga0501242_008145 Ga0501242_008145_49_654 195
189 3300049688 Ga0501259_006720 Ga0501259_006720_175_780 195
190 3300049704 Ga0501221_008309 Ga0501221_008309_1067_1672 195
191 3300049705 Ga0501225_0029833 Ga0501225_0029833_154_759 195
192 3300049765 Ga0501268_009146 Ga0501268_009146_446_1051 195
193 3300005331 Ga0070670_100011146 Ga0070670_1000111465 196
194 3300005353 Ga0070669_100028806 Ga0070669_1000288061 196
195 3300005355 Ga0070671_100154173 Ga0070671_1001541732 196
196 3300005355 Ga0070671_100212785 Ga0070671_1002127852 196
197 3300005364 Ga0070673_100143596 Ga0070673_1001435962 196
198 3300005530 Ga0070679_100018127 Ga0070679_1000181278 196
199 3300005543 Ga0070672_100005546 Ga0070672_1000055467 196
200 3300005543 Ga0070672_100650320 Ga0070672_1006503201 196
201 3300005564 Ga0070664_100501639 Ga0070664_1005016392 196
202 3300005618 Ga0068864_100023155 Ga0068864_1000231552 196
203 3300005844 Ga0068862_100068520 Ga0068862_1000685204 196
204 3300009148 Ga0105243_10866722 Ga0105243_108667221 196
205 3300012488 Ga0157343_1007310 Ga0157343_10073101 196
206 3300013105 Ga0157369_10121907 Ga0157369_101219071 196
207 3300013306 Ga0163162_11204801 Ga0163162_112048012 196
208 3300025917 Ga0207660_10630629 Ga0207660_106306291 196
209 3300025921 Ga0207652_10278983 Ga0207652_102789832 196
210 3300025923 Ga0207681_10434188 Ga0207681_104341882 196
211 3300025923 Ga0207681_10590211 Ga0207681_105902111 196
212 3300025925 Ga0207650_10130888 Ga0207650_101308882 196
213 3300025926 Ga0207659_10398207 Ga0207659_103982072 196
214 3300025931 Ga0207644_10330370 Ga0207644_103303702 196
215 3300025940 Ga0207691_10000184 Ga0207691_1000018458 196
216 3300025960 Ga0207651_10045181 Ga0207651_100451813 196
217 3300025972 Ga0207668_10347086 Ga0207668_103470862 196
218 3300026089 Ga0207648_10136175 Ga0207648_101361752 196
219 3300028380 Ga0268265_10372301 Ga0268265_103723012 196
220 3300032004 Ga0307414_10618304 Ga0307414_106183042 196
221 3300032004 Ga0307414_11106820 Ga0307414_111068202 196
222 3300032005 Ga0307411_10128219 Ga0307411_101282192 196
223 3300032005 Ga0307411_11183041 Ga0307411_111830411 196
224 3300037418 Ga0395900_0081524 Ga0395900_0081524_977_1594 196
225 3300042007 Ga0439449_0034293 Ga0439449_0034293_657_1280 196
226 3300046537 Ga0495598_0001238 Ga0495598_0001238_2562_3170 196
227 3300046539 Ga0495621_0000225 Ga0495621_0000225_9675_10280 196
228 3300046539 Ga0495621_0010504 Ga0495621_0010504_927_1535 196
229 3300046615 Ga0495656_0020876 Ga0495656_0020876_1575_2189 196
230 3300046664 Ga0495659_0067156 Ga0495659_0067156_682_1287 196
231 3300047472 Ga0495686_0013972 Ga0495686_0013972_4026_4616 196
232 3300048906 Ga0496103_0089642 Ga0496103_0089642_1229_1843 196
233 3300048910 Ga0496107_0076888 Ga0496107_0076888_972_1586 196
234 3300048911 Ga0496108_0345640 Ga0496108_0345640_280_909 196
235 3300048912 Ga0496109_0077929 Ga0496109_0077929_1384_1998 196
236 3300048912 Ga0496109_0468984 Ga0496109_0468984_547_1176 196
237 3300048912 Ga0496109_0514299 Ga0496109_0514299_46_654 196
238 3300048913 Ga0496110_0207752 Ga0496110_0207752_484_1098 196
239 3300048914 Ga0496111_0032428 Ga0496111_0032428_1107_1721 196
240 3300048915 Ga0496112_0072064 Ga0496112_0072064_1284_1898 196
241 3300048916 Ga0496113_0036358 Ga0496113_0036358_1838_2452 196
242 3300048917 Ga0496114_0286303 Ga0496114_0286303_531_1145 196
243 3300048925 Ga0496122_0001370 Ga0496122_0001370_17283_17873 196
244 3300048926 Ga0496123_0001175 Ga0496123_0001175_16277_16867 196
245 3300048928 Ga0496125_0038367 Ga0496125_0038367_1251_1841 196
246 3300049570 Ga0501033_0000565 Ga0501033_0000565_10228_10839 196
247 3300049571 Ga0501034_0091029 Ga0501034_0091029_877_1467 196
248 3300002773 JGI25152J39213_1000146 JGI25152J39213_100014621 197
249 3300002774 JGI25150J39212_1000120 JGI25150J39212_100012025 197
250 3300003187 JGI25151J46595_10000107 JGI25151J46595_1000010721 197
251 3300003187 JGI25151J46595_10000260 JGI25151J46595_1000026029 197
252 3300003187 JGI25151J46595_10028710 JGI25151J46595_100287102 197
253 3300003215 JGI25153J46596_10000078 JGI25153J46596_1000007821 197
254 3300003320 rootH2_10010511 rootH2_100105115 197
255 3300003771 Ga0055526_1000564 Ga0055526_100056421 197
256 3300003771 Ga0055526_1002454 Ga0055526_10024547 197
257 3300003771 Ga0055526_1004014 Ga0055526_10040149 197
258 3300003773 Ga0055537_1000251 Ga0055537_100025117 197
259 3300003773 Ga0055537_1000954 Ga0055537_10009548 197
260 3300003775 Ga0055524_1001496 Ga0055524_10014968 197
261 3300003775 Ga0055524_1006561 Ga0055524_10065613 197
262 3300003775 Ga0055524_1045172 Ga0055524_10451721 197
263 3300003775 Ga0055524_1065254 Ga0055524_10652541 197
264 3300003781 Ga0055536_1036197 Ga0055536_10361972 197
265 3300003784 Ga0055534_1000913 Ga0055534_10009136 197
266 3300003784 Ga0055534_1001894 Ga0055534_10018947 197
267 3300003790 Ga0055528_1000533 Ga0055528_100053321 197
268 3300003790 Ga0055528_1002470 Ga0055528_10024705 197
269 3300003791 Ga0055530_10008328 Ga0055530_100083286 197
270 3300003791 Ga0055530_10013681 Ga0055530_100136811 197
271 3300003794 Ga0055531_10035506 Ga0055531_100355062 197
272 3300003856 Ga0058692_1000017 Ga0058692_1000017115 197
273 3300003856 Ga0058692_1000022 Ga0058692_1000022199 197
274 3300005289 Ga0065704_10089252 Ga0065704_100892522 197
275 3300005289 Ga0065704_10309477 Ga0065704_103094771 197
276 3300005331 Ga0070670_100008545 Ga0070670_1000085456 197
277 3300005335 Ga0070666_10146832 Ga0070666_101468322 197
278 3300005347 Ga0070668_100128771 Ga0070668_1001287712 197
279 3300005353 Ga0070669_100091235 Ga0070669_1000912352 197
280 3300005367 Ga0070667_100184190 Ga0070667_1001841902 197
281 3300005548 Ga0070665_100389260 Ga0070665_1003892602 197
282 3300005548 Ga0070665_100390395 Ga0070665_1003903952 197
283 3300005844 Ga0068862_100067754 Ga0068862_1000677543 197
284 3300005985 Ga0081539_10207050 Ga0081539_102070502 197
285 3300006051 Ga0075364_10042346 Ga0075364_100423462 197
286 3300006186 Ga0075369_10176259 Ga0075369_101762592 197
287 3300006847 Ga0075431_100819277 Ga0075431_1008192772 197
288 3300009011 Ga0105251_10000259 Ga0105251_1000025921 197
289 3300009036 Ga0105244_10153998 Ga0105244_101539981 197
290 3300009148 Ga0105243_10001498 Ga0105243_100014987 197
291 3300009148 Ga0105243_10007322 Ga0105243_100073227 197
292 3300009979 Ga0105032_102796 Ga0105032_1027962 197
293 3300013100 Ga0157373_10441461 Ga0157373_104414612 197
294 3300013102 Ga0157371_10402828 Ga0157371_104028281 197
295 3300013105 Ga0157369_10062739 Ga0157369_100627393 197
296 3300013307 Ga0157372_11289328 Ga0157372_112893282 197
297 3300014497 Ga0182008_10086914 Ga0182008_100869141 197
298 3300015261 Ga0182006_1012610 Ga0182006_10126105 197
299 3300015261 Ga0182006_1076868 Ga0182006_10768681 197
300 3300015262 Ga0182007_10000099 Ga0182007_1000009936 197
301 3300015265 Ga0182005_1000495 Ga0182005_10004957 197
302 3300015265 Ga0182005_1006713 Ga0182005_10067133 197
303 3300015689 Ga0183360_10001 Ga0183360_10001624 197
304 3300017792 Ga0163161_10073257 Ga0163161_100732572 197
305 3300020075 Ga0206349_1336891 Ga0206349_13368911 197
306 3300025245 Ga0207425_1000028 Ga0207425_100002889 197
307 3300025245 Ga0207425_1014047 Ga0207425_10140472 197
308 3300025258 Ga0209129_1000065 Ga0209129_100006537 197
309 3300025263 Ga0209565_1000005 Ga0209565_1000005490 197
310 3300025263 Ga0209565_1000031 Ga0209565_1000031286 197
311 3300025273 Ga0209673_1000011 Ga0209673_1000011145 197
312 3300025273 Ga0209673_1000484 Ga0209673_100048415 197
313 3300025284 Ga0209130_1019819 Ga0209130_10198192 197
314 3300025291 Ga0209675_1000004 Ga0209675_1000004490 197
315 3300025291 Ga0209675_1000015 Ga0209675_1000015385 197
316 3300025291 Ga0209675_1006730 Ga0209675_10067302 197
317 3300025292 Ga0209676_1000225 Ga0209676_100022554 197
318 3300025294 Ga0209025_1000002 Ga0209025_1000002183 197
319 3300025294 Ga0209025_1000036 Ga0209025_1000036298 197
320 3300025294 Ga0209025_1008389 Ga0209025_10083894 197
321 3300025294 Ga0209025_1025298 Ga0209025_10252983 197
322 3300025295 Ga0209564_1000018 Ga0209564_1000018145 197
323 3300025295 Ga0209564_1000480 Ga0209564_100048018 197
324 3300025295 Ga0209564_1004657 Ga0209564_10046575 197
325 3300025297 Ga0209758_1000003 Ga0209758_1000003190 197
326 3300025297 Ga0209758_1024688 Ga0209758_10246884 197
327 3300025297 Ga0209758_1039930 Ga0209758_10399302 197
328 3300025298 Ga0209050_1000998 Ga0209050_100099816 197
329 3300025298 Ga0209050_1005741 Ga0209050_10057414 197
330 3300025298 Ga0209050_1062528 Ga0209050_10625281 197
331 3300025299 Ga0209256_1000021 Ga0209256_100002193 197
332 3300025299 Ga0209256_1010568 Ga0209256_10105682 197
333 3300025299 Ga0209256_1026198 Ga0209256_10261982 197
334 3300025303 Ga0209051_1007665 Ga0209051_10076656 197
335 3300025304 Ga0209257_1000133 Ga0209257_1000133111 197
336 3300025304 Ga0209257_1000308 Ga0209257_100030891 197
337 3300025304 Ga0209257_1004172 Ga0209257_10041722 197
338 3300025304 Ga0209257_1013176 Ga0209257_10131763 197
339 3300025304 Ga0209257_1013329 Ga0209257_10133292 197
340 3300025304 Ga0209257_1063531 Ga0209257_10635311 197
341 3300025728 Ga0207655_1070830 Ga0207655_10708302 197
342 3300025735 Ga0207713_1000282 Ga0207713_100028221 197
343 3300025925 Ga0207650_10005386 Ga0207650_100053866 197
344 3300025935 Ga0207709_10001467 Ga0207709_1000146711 197
345 3300025935 Ga0207709_10002281 Ga0207709_100022817 197
346 3300025972 Ga0207668_10019560 Ga0207668_100195602 197
347 3300025986 Ga0207658_10240609 Ga0207658_102406092 197
348 3300027312 Ga0209371_1000004 Ga0209371_1000004730 197
349 3300027312 Ga0209371_1000044 Ga0209371_1000044172 197
350 3300028379 Ga0268266_10178419 Ga0268266_101784192 197
351 3300028379 Ga0268266_10792314 Ga0268266_107923141 197
352 3300028380 Ga0268265_10109352 Ga0268265_101093523 197
353 3300028794 Ga0307515_10285541 Ga0307515_102855412 197
354 3300030500 Ga0268256_1000005 Ga0268256_1000005317 197
355 3300030500 Ga0268256_1000046 Ga0268256_1000046172 197
356 3300030735 Ga0316178_1155411 Ga0316178_11554111 197
357 3300030742 Ga0316183_1147356 Ga0316183_11473564 197
358 3300030745 Ga0316182_1298001 Ga0316182_12980011 197
359 3300031456 Ga0307513_10235724 Ga0307513_102357242 197
360 3300031548 Ga0307408_100613453 Ga0307408_1006134532 197
361 3300031731 Ga0307405_10126431 Ga0307405_101264312 197
362 3300031731 Ga0307405_10153141 Ga0307405_101531412 197
363 3300031824 Ga0307413_10021221 Ga0307413_100212212 197
364 3300031824 Ga0307413_10209315 Ga0307413_102093152 197
365 3300031824 Ga0307413_10219736 Ga0307413_102197362 197
366 3300031824 Ga0307413_10369657 Ga0307413_103696572 197
367 3300031901 Ga0307406_10012614 Ga0307406_100126142 197
368 3300031901 Ga0307406_10184568 Ga0307406_101845682 197
369 3300031911 Ga0307412_10375408 Ga0307412_103754082 197
370 3300032004 Ga0307414_10000329 Ga0307414_100003294 197
371 3300032004 Ga0307414_10012936 Ga0307414_100129363 197
372 3300032004 Ga0307414_10015376 Ga0307414_100153764 197
373 3300032004 Ga0307414_10060143 Ga0307414_100601432 197
374 3300032004 Ga0307414_10608734 Ga0307414_106087342 197
375 3300038705 Ga0237819_00475 Ga0237819_00475_12950_13543 197
376 3300038705 Ga0237819_05853 Ga0237819_05853_911_1507 197
377 3300041404 Ga0439436_0003453 Ga0439436_0003453_3009_3629 197
378 3300041404 Ga0439436_0005621 Ga0439436_0005621_1421_2026 197
379 3300041404 Ga0439436_0023838 Ga0439436_0023838_949_1563 197
380 3300041406 Ga0439439_0004959 Ga0439439_0004959_988_1602 197
381 3300041406 Ga0439439_0006794 Ga0439439_0006794_1552_2157 197
382 3300041406 Ga0439439_0018526 Ga0439439_0018526_701_1294 197
383 3300041407 Ga0439447_000418 Ga0439447_000418_5456_6070 197
384 3300041413 Ga0439465_0003036 Ga0439465_0003036_2761_3360 197
385 3300041413 Ga0439465_0017941 Ga0439465_0017941_1405_1998 197
386 3300041443 Ga0451789_0317850 Ga0451789_0317850_957_1550 197
387 3300041451 Ga0451791_0175559 Ga0451791_0175559_200_793 197
388 3300041452 Ga0451793_0733973 Ga0451793_0733973_357_950 197
389 3300041453 Ga0451797_0418770 Ga0451797_0418770_1785_2378 197
390 3300041456 Ga0451795_1454739 Ga0451795_1454739_488_1081 197
391 3300041458 Ga0451798_0074155 Ga0451798_0074155_1047_1640 197
392 3300041459 Ga0451800_0059364 Ga0451800_0059364_343_936 197
393 3300041460 Ga0451802_0486033 Ga0451802_0486033_450_1043 197
394 3300041462 Ga0451806_285401 Ga0451806_285401_2171_2764 197
395 3300041486 Ga0451807_0059239 Ga0451807_0059239_29_622 197
396 3300041486 Ga0451807_0630037 Ga0451807_0630037_3383_3976 197
397 3300041494 Ga0451837_0345653 Ga0451837_0345653_570_1163 197
398 3300041997 Ga0439431_0005023 Ga0439431_0005023_1324_1917 197
399 3300042004 Ga0439445_0007957 Ga0439445_0007957_1186_1800 197
400 3300042004 Ga0439445_0016626 Ga0439445_0016626_1159_1752 197
401 3300042007 Ga0439449_0003099 Ga0439449_0003099_1777_2376 197
402 3300042007 Ga0439449_0005487 Ga0439449_0005487_3982_4575 197
403 3300042007 Ga0439449_0018158 Ga0439449_0018158_68_673 197
404 3300042007 Ga0439449_0025324 Ga0439449_0025324_1416_2012 197
405 3300042007 Ga0439449_0040440 Ga0439449_0040440_1029_1643 197
406 3300042007 Ga0439449_0088007 Ga0439449_0088007_190_795 197
407 3300042010 Ga0439452_087391 Ga0439452_087391_63_662 197
408 3300042015 Ga0439462_0009075 Ga0439462_0009075_321_926 197
409 3300042015 Ga0439462_0037208 Ga0439462_0037208_637_1242 197
410 3300042156 Ga0439446_0065328 Ga0439446_0065328_162_767 197
411 3300042435 Ga0439434_0036575 Ga0439434_0036575_41_655 197
412 3300046453 Ga0495627_040933 Ga0495627_040933_241_834 197
413 3300046460 Ga0495638_0136540 Ga0495638_0136540_369_998 197
414 3300046501 Ga0495607_0035742 Ga0495607_0035742_1064_1660 197
415 3300046507 Ga0495606_0015919 Ga0495606_0015919_4433_5029 197
416 3300046525 Ga0495663_0000749 Ga0495663_0000749_412_1005 197
417 3300046525 Ga0495663_0026885 Ga0495663_0026885_345_959 197
418 3300046525 Ga0495663_0032960 Ga0495663_0032960_15_620 197
419 3300046558 Ga0495633_0040492 Ga0495633_0040492_1086_1679 197
420 3300046558 Ga0495633_0218778 Ga0495633_0218778_238_834 197
421 3300046615 Ga0495656_0013832 Ga0495656_0013832_269_874 197
422 3300046616 Ga0495668_0041284 Ga0495668_0041284_368_982 197
423 3300046691 Ga0495670_0173159 Ga0495670_0173159_50_655 197
424 3300046692 Ga0495671_0024889 Ga0495671_0024889_1766_2359 197
425 3300047318 Ga0495636_0004741 Ga0495636_0004741_4043_4648 197
426 3300047318 Ga0495636_0029507 Ga0495636_0029507_1160_1765 197
427 3300047320 Ga0495672_0000230 Ga0495672_0000230_16628_17224 197
428 3300047447 Ga0495685_071034 Ga0495685_071034_293_898 197
429 3300048919 Ga0496116_0031818 Ga0496116_0031818_2232_2828 197
430 3300048920 Ga0496117_0042411 Ga0496117_0042411_1031_1624 197
431 3300048920 Ga0496117_0087233 Ga0496117_0087233_742_1338 197
432 3300048921 Ga0496118_0052941 Ga0496118_0052941_837_1433 197
433 3300048921 Ga0496118_0060633 Ga0496118_0060633_518_1111 197
434 3300048921 Ga0496118_0148350 Ga0496118_0148350_296_889 197
435 3300048922 Ga0496119_0035713 Ga0496119_0035713_958_1551 197
436 3300048923 Ga0496120_0030599 Ga0496120_0030599_1696_2289 197
437 3300048924 Ga0496121_0003326 Ga0496121_0003326_3914_4528 197
438 3300048924 Ga0496121_0052000 Ga0496121_0052000_2233_2829 197
439 3300048925 Ga0496122_0043307 Ga0496122_0043307_1140_1736 197
440 3300048926 Ga0496123_0011721 Ga0496123_0011721_5943_6536 197
441 3300048926 Ga0496123_0034574 Ga0496123_0034574_2483_3079 197
442 3300048927 Ga0496124_0000018 Ga0496124_0000018_70357_70953 197
443 3300048927 Ga0496124_0002618 Ga0496124_0002618_21661_22257 197
444 3300048927 Ga0496124_0060919 Ga0496124_0060919_1672_2265 197
445 3300048928 Ga0496125_0114832 Ga0496125_0114832_816_1412 197
446 3300048929 Ga0496126_0054562 Ga0496126_0054562_1821_2417 197
447 3300049127 Ga0501306_011781 Ga0501306_011781_471_1076 197
448 3300049162 Ga0501307_007509 Ga0501307_007509_127_732 197
449 3300049529 Ga0501313_028727 Ga0501313_028727_21_626 197
450 3300049541 Ga0501325_012146 Ga0501325_012146_43_648 197
451 3300049571 Ga0501034_0000420 Ga0501034_0000420_9230_9838 197
452 3300049571 Ga0501034_0000853 Ga0501034_0000853_43507_44103 197
453 3300049579 Ga0501043_0007657 Ga0501043_0007657_4321_4920 197
454 3300049654 Ga0501207_027362 Ga0501207_027362_231_836 197
455 3300049663 Ga0501223_017261 Ga0501223_017261_121_726 197
456 3300049672 Ga0501239_003937 Ga0501239_003937_301_906 197
457 3300049705 Ga0501225_0024690 Ga0501225_0024690_449_1054 197
458 3300049765 Ga0501268_026054 Ga0501268_026054_285_890 197
459 3300049776 Ga0501280_029003 Ga0501280_029003_149_754 197
460 3300049824 Ga0501045_0210612 Ga0501045_0210612_627_1232 197
461 3300050491 nmdc:mga00v17_623_c1 nmdc:mga00v17_623_c1_362_958 197
462 3300053161 Ga0500634_0000128 Ga0500634_0000128_2677_3270 197

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

33

160

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xpd-assembly1.cif.gz_C crystal structure of yeast n-terminal acetyltransferase nate (ppgpp) in complex with a bisubstrate 0.8168 3 162
2cnt-assembly4.cif.gz_D rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with coenzymea. 0.8158 2 162
5isv-assembly2.cif.gz_B crystal structure of the ribosomal-protein-s18-alanine n-acetyltransferase from escherichia coli 0.8128 2 162
4lua-assembly1.cif.gz_A crystal structure of n-acetyltransferase from staphylococcus aureus mu50 0.8056 1 162
4pv6-assembly8.cif.gz_N crystal structure analysis of ard1 from thermoplasma volcanium 0.8021 1 161
ID Description Score Start End Superfamily
af_Q58925_1_145_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8614 4 161 3.40.630.30
af_Q58925_1_145_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8402 4 161 3.40.630.30
4pv6F00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8373 3 165 3.40.630.30
af_I6YG32_8_156_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8343 4 163 3.40.630.30
af_C7G005_1_156_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.825 3 162 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2R7PZ32-F1-model_v4 deleted 0.9759 1 84
AF-Q8PN46-F1-model_v4 deleted 0.9727 1 197
AF-A0A1S1XQD6-F1-model_v4 deleted 0.9698 1 147
AF-Q8PN46-F1-model_v4 deleted 0.9679 1 197
AF-A0A519HBY0-F1-model_v4 GNAT family N-acetyltransferase 0.964 1 127 GO:0016747

Feature Viewer

pLDDT pTM Quality
89.34 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map