F449010

General Info

Members Datasets Scaffolds Average Seq Length
462 288 404 208

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2675903058|2676477450
Length 251
Sequence TPLRLTVVSAGLSVPSSTRLLADRLTDATRRALAARGREVEVTVVELRDLATDVANNLVTGFPSRRLSDALASVSEADGLIAVTPVFSASYSGLFKSFFDVVDNDALTGTPVLAAATGGTARHSLALEHALRPLFTFLRAVVVPTAVYAAAEDWGGRGDSMTEGLPTRIERAAGELADLLAGRVHGDARAAVDVRADGVRTNGARVDGDARVVDGRPAEETFVPFEQYLAALRPDQPPDLIATDEPSGGLR

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2582580736 Prauserella sp. Am3 Isolate Unclassified
3 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
4 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
5 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
6 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
7 2643221548 Streptomyces sp. Root55 Isolate Unclassified
8 2643221641 Nocardioides sp. Root122 Isolate Unclassified
9 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
10 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
11 2643221714 Streptomyces sp. Root264 Isolate Unclassified
12 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
13 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
14 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
15 2739367898 Nocardioides sp. CF479 Isolate Unclassified
16 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
17 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
18 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
19 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
20 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
21 2808606448 Streptomyces sp. 193411 Isolate Unclassified
22 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
23 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
24 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
25 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
26 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
27 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
28 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
29 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
30 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
31 2867428634 Streptomyces sp. RP5T Isolate Unclassified
32 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
33 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
34 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
35 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
36 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
37 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
38 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
39 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
40 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
41 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
42 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
43 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
44 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
45 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
46 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
47 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
48 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
49 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
50 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
51 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
52 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
99 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
102 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
103 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
104 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
117 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
122 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
123 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
124 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
125 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
126 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
127 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
128 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
129 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
130 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
131 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
134 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
135 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
136 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
137 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
138 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
139 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
140 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
141 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
142 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
143 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
144 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
145 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
146 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
147 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
154 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
173 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
176 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
177 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
178 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
179 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
182 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
183 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
184 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
192 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
205 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
206 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
207 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
211 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
216 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
217 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
218 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
219 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
220 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
223 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
224 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
225 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
226 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
232 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
249 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
252 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
259 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
260 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
263 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
264 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
265 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
266 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
267 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
268 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
269 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
270 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
271 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
272 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
273 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
274 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
275 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
278 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
279 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
280 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
281 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
282 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
283 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
284 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
285 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
286 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
287 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere
288 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.63
Metatranscriptomes 2.81
Isolates 12.55

Biome Distribution

Category Percentage (%)
Aerial Root 0.43
Bulb 0
Endosphere 6.06
Nodule 0.43
Rhizoplane 1.95
Rhizosphere 76.62
Stem 0
Stem Tuber 0
Unclassified 14.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10012060 3300001989 Bacteria 3175
2 rootH1_10007719 3300003316 Bacteria 1635
3 rootH2_10048161 3300003320 Bacteria 11950
4 rootL2_10050146 3300003322 Bacteria 4492
5 rootL2_10136955 3300003322 Bacteria 2299
6 Ga0006562J51391_1063772 3300003578 Bacteria 3950
7 Ga0006562J51391_1063773 3300003578 Bacteria 3974
8 Ga0070680_100228824 3300005336 Bacteria 1570
9 Ga0070668_100001849 3300005347 Bacteria 15433
10 Ga0070668_100778298 3300005347 Bacteria 849
11 Ga0070674_101143635 3300005356 Bacteria 689
12 Ga0070667_100316827 3300005367 Bacteria 1407
13 Ga0070709_10188805 3300005434 Bacteria 1452
14 Ga0070713_100077572 3300005436 Bacteria 2825
15 Ga0068867_100490604 3300005459 Bacteria 1054
16 Ga0070679_100853539 3300005530 Bacteria 854
17 Ga0068853_100117597 3300005539 Bacteria 2368
18 Ga0070665_100349625 3300005548 Bacteria 1484
19 Ga0068856_100147506 3300005614 Bacteria 2360
20 Ga0068861_100776343 3300005719 Bacteria 897
21 Ga0068862_100443865 3300005844 Bacteria 1222
22 Ga0075365_10015400 3300006038 Bacteria 4626
23 Ga0075365_10064952 3300006038 Bacteria 2446
24 Ga0075365_10607021 3300006038 Bacteria 774
25 Ga0075368_10005115 3300006042 Bacteria 4494
26 Ga0075367_10006729 3300006178 Bacteria 5833
27 Ga0075436_100480399 3300006914 Bacteria 907
28 Ga0105243_10265885 3300009148 Bacteria 1538
29 Ga0105238_10515220 3300009551 Bacteria 1198
30 Ga0105246_10000350 3300011119 Bacteria 24717
31 Ga0157372_10568137 3300013307 Bacteria 1322
32 Ga0157377_10279337 3300014745 Bacteria 1094
33 Ga0183367_1002 3300015688 Bacteria 1101531
34 Ga0206353_10590688 3300020082 Bacteria 1881
35 Ga0224712_10012943 3300022467 Bacteria 2643
36 Ga0209051_1059972 3300025303 Bacteria 1204
37 Ga0207688_10022775 3300025901 Bacteria 3430
38 Ga0207647_10043782 3300025904 Bacteria 2799
39 Ga0207647_10175573 3300025904 Bacteria 1246
40 Ga0207699_10159087 3300025906 Bacteria 1502
41 Ga0207660_10898662 3300025917 Bacteria 723
42 Ga0207652_10688174 3300025921 Bacteria 913
43 Ga0207700_10033956 3300025928 Bacteria 3656
44 Ga0207664_10081897 3300025929 Bacteria 2628
45 Ga0207669_10233744 3300025937 Bacteria 1358
46 Ga0207704_10175682 3300025938 Bacteria 1542
47 Ga0207661_10306339 3300025944 Bacteria 1425
48 Ga0207712_10873471 3300025961 Bacteria 793
49 Ga0207668_10050988 3300025972 Bacteria 2855
50 Ga0207658_10235441 3300025986 Bacteria 1548
51 Ga0207639_10076961 3300026041 Bacteria 2628
52 Ga0207674_10699526 3300026116 Bacteria 978
53 Ga0207675_100385193 3300026118 Bacteria 1379
54 Ga0209813_10012589 3300027866 Bacteria 2240
55 Ga0268264_10394158 3300028381 Bacteria 1329
56 Ga0307517_10142039 3300028786 Bacteria 1682
57 Ga0307515_10000258 3300028794 Bacteria 131660
58 Ga0307515_10109991 3300028794 Bacteria 3230
59 Ga0307511_10137285 3300030521 Bacteria 1451
60 Ga0307512_10001966 3300030522 Bacteria 27433
61 Ga0307512_10069595 3300030522 Bacteria 2629
62 Ga0307512_10086145 3300030522 Bacteria 2221
63 Ga0307512_10242643 3300030522 Bacteria 909
64 Ga0307512_10249720 3300030522 Bacteria 885
65 Ga0307513_10017989 3300031456 Bacteria 8462
66 Ga0307509_10007108 3300031507 Bacteria 14762
67 Ga0307509_10173200 3300031507 Bacteria 2034
68 Ga0307508_10004187 3300031616 Bacteria 14188
69 Ga0307508_10027953 3300031616 Bacteria 5103
70 Ga0307508_10049559 3300031616 Bacteria 3740
71 Ga0307508_10228331 3300031616 Bacteria 1460
72 Ga0307514_10175742 3300031649 Bacteria 1389
73 Ga0307516_10001875 3300031730 Bacteria 28758
74 Ga0307405_10018487 3300031731 Bacteria 3846
75 Ga0307405_10625028 3300031731 Bacteria 882
76 Ga0307413_10030182 3300031824 Bacteria 3043
77 Ga0307413_10418380 3300031824 Bacteria 1055
78 Ga0307413_10554971 3300031824 Bacteria 932
79 Ga0307518_10212810 3300031838 Bacteria 1270
80 Ga0307518_10271235 3300031838 Bacteria 1059
81 Ga0307518_10296469 3300031838 Bacteria 987
82 Ga0307410_10143971 3300031852 Bacteria 1767
83 Ga0307406_10083120 3300031901 Bacteria 2134
84 Ga0307406_10176032 3300031901 Bacteria 1553
85 Ga0307407_10016354 3300031903 Bacteria 3693
86 Ga0307412_10138474 3300031911 Bacteria 1779
87 Ga0307412_10180593 3300031911 Bacteria 1587
88 Ga0307409_100101211 3300031995 Bacteria 2390
89 Ga0307409_100196207 3300031995 Bacteria 1802
90 Ga0307409_100222441 3300031995 Bacteria 1705
91 Ga0307409_100223934 3300031995 Bacteria 1700
92 Ga0307409_100529590 3300031995 Bacteria 1153
93 Ga0307409_100536485 3300031995 Bacteria 1146
94 Ga0307409_100754587 3300031995 Bacteria 977
95 Ga0307409_101066226 3300031995 Bacteria 828
96 Ga0307416_100130590 3300032002 Bacteria 2260
97 Ga0307416_100236180 3300032002 Bacteria 1767
98 Ga0307416_100570787 3300032002 Bacteria 1207
99 Ga0307416_101151354 3300032002 Bacteria 881
100 Ga0307411_10214474 3300032005 Bacteria 1489
101 Ga0307411_10665542 3300032005 Bacteria 903
102 Ga0307415_100004523 3300032126 Bacteria 7235
103 Ga0307415_100128178 3300032126 Bacteria 1916
104 Ga0307415_100181716 3300032126 Bacteria 1651
105 Ga0307415_100283584 3300032126 Bacteria 1363
106 Ga0307415_100471192 3300032126 Bacteria 1091
107 Ga0307507_10000240 3300033179 Bacteria 106042
108 Ga0307507_10025553 3300033179 Bacteria 6401
109 Ga0307507_10066141 3300033179 Bacteria 3317
110 Ga0307510_10190566 3300033180 Bacteria 1599
111 Ga0307510_10355450 3300033180 Bacteria 914
112 Ga0373935_0018059 3300035692 Bacteria 4288
113 Ga0395898_0036579 3300037466 Bacteria 4874
114 Ga0395898_0345444 3300037466 Bacteria 1419
115 Ga0395898_0764534 3300037466 Bacteria 907
116 Ga0395901_0021537 3300038443 Bacteria 6606
117 Ga0395901_0057315 3300038443 Bacteria 4052
118 Ga0395901_0259982 3300038443 Bacteria 1807
119 Ga0439438_022771 3300041405 Bacteria 1734
120 Ga0439466_0111644 3300041411 Bacteria 848
121 Ga0451789_0060067 3300041443 Bacteria 1196
122 Ga0451789_0997067 3300041443 Bacteria 923
123 Ga0451791_0077492 3300041451 Bacteria 1473
124 Ga0451791_0381482 3300041451 Bacteria 1817
125 Ga0451793_1768735 3300041452 Bacteria 724
126 Ga0451797_0668506 3300041453 Bacteria 1206
127 Ga0451807_1652371 3300041486 Bacteria 1245
128 Ga0451837_1090609 3300041494 Bacteria 934
129 Ga0451837_1808306 3300041494 Bacteria 577
130 Ga0451839_0692888 3300041496 Bacteria 892
131 Ga0451841_0387088 3300041498 Bacteria 1164
132 Ga0451843_0744411 3300041509 Bacteria 804
133 Ga0451853_1127399 3300041512 Bacteria 1842
134 Ga0439455_0006712 3300042012 Bacteria 2402
135 Ga0439457_046037 3300042014 Bacteria 976
136 Ga0450894_000149 3300042131 Bacteria 12354
137 Ga0450896_002049 3300042133 Bacteria 2565
138 Ga0450898_027737 3300042134 Bacteria 1026
139 Ga0450899_000455 3300042135 Bacteria 4591
140 Ga0450900_008934 3300042136 Bacteria 1262
141 Ga0450902_010444 3300042137 Bacteria 1468
142 Ga0450903_000008 3300042138 Bacteria 36921
143 Ga0450906_000591 3300042145 Bacteria 7708
144 Ga0439458_0000093 3300042157 Bacteria 17233
145 Ga0439458_0045392 3300042157 Bacteria 1074
146 Ga0450901_009529 3300042533 Bacteria 1003
147 Ga0466969_0017911 3300044656 Bacteria 3695
148 Ga0466972_0019896 3300044658 Bacteria 3355
149 Ga0466972_0020895 3300044658 Bacteria 3268
150 Ga0466972_0024669 3300044658 Bacteria 2984
151 Ga0466972_0040971 3300044658 Bacteria 2255
152 Ga0466965_0068832 3300044683 Bacteria 1777
153 Ga0466965_0128170 3300044683 Bacteria 1314
154 Ga0466965_0379200 3300044683 Bacteria 778
155 Ga0466966_0023774 3300044684 Bacteria 4010
156 Ga0466966_0029411 3300044684 Bacteria 3574
157 Ga0466961_0010395 3300044693 Bacteria 5939
158 Ga0466961_0019484 3300044693 Bacteria 4364
159 Ga0466961_0039844 3300044693 Bacteria 3011
160 Ga0466963_0002412 3300044694 Bacteria 10454
161 Ga0466963_0026360 3300044694 Bacteria 3717
162 Ga0466963_0091845 3300044694 Bacteria 2068
163 Ga0466964_0016623 3300044706 Bacteria 2811
164 Ga0466964_0093536 3300044706 Bacteria 1312
165 Ga0466971_0003866 3300044719 Bacteria 6423
166 Ga0466971_0038227 3300044719 Bacteria 2153
167 Ga0466971_0038444 3300044719 Bacteria 2147
168 Ga0466971_0087184 3300044719 Bacteria 1427
169 Ga0466968_0005347 3300044735 Bacteria 4804
170 Ga0466968_0116871 3300044735 Bacteria 1204
171 Ga0466970_0033502 3300044765 Bacteria 2715
172 Ga0466970_0055248 3300044765 Bacteria 2120
173 Ga0466970_0139847 3300044765 Bacteria 1333
174 Ga0466970_0264623 3300044765 Bacteria 965
175 Ga0466970_0266521 3300044765 Bacteria 961
176 Ga0466957_0001811 3300044842 Bacteria 11262
177 Ga0466957_0393771 3300044842 Bacteria 946
178 Ga0466960_0073673 3300044901 Bacteria 1704
179 Ga0466960_0101376 3300044901 Bacteria 1483
180 Ga0466959_0173070 3300045049 Bacteria 1513
181 Ga0466958_0006367 3300045836 Bacteria 6420
182 Ga0466958_0094291 3300045836 Bacteria 1854
183 Ga0466958_0493477 3300045836 Bacteria 794
184 Ga0466967_0001656 3300045976 Bacteria 13197
185 Ga0466967_0004873 3300045976 Bacteria 9164
186 Ga0466967_0012352 3300045976 Bacteria 6529
187 Ga0466967_0058691 3300045976 Bacteria 3402
188 Ga0466967_0086551 3300045976 Bacteria 2839
189 Ga0466967_0149194 3300045976 Bacteria 2184
190 Ga0495592_0080621 3300046454 Bacteria 2354
191 Ga0495603_0004220 3300046455 Bacteria 8556
192 Ga0495603_0014053 3300046455 Bacteria 4840
193 Ga0495603_0014817 3300046455 Bacteria 4715
194 Ga0495603_0023736 3300046455 Bacteria 3710
195 Ga0495629_0002208 3300046459 Bacteria 15016
196 Ga0495629_0038569 3300046459 Bacteria 3364
197 Ga0495629_0126088 3300046459 Bacteria 1783
198 Ga0495629_0180190 3300046459 Bacteria 1464
199 Ga0495638_0152867 3300046460 Bacteria 1337
200 Ga0495651_0011388 3300046462 Bacteria 6834
201 Ga0495651_0044210 3300046462 Bacteria 3452
202 Ga0495651_0179225 3300046462 Bacteria 1501
203 Ga0495651_0198530 3300046462 Bacteria 1406
204 Ga0495653_0009606 3300046463 Bacteria 7911
205 Ga0495580_0065657 3300046472 Bacteria 2541
206 Ga0495605_0039502 3300046474 Bacteria 2363
207 Ga0495662_0007088 3300046476 Bacteria 5564
208 Ga0495662_0035761 3300046476 Bacteria 2397
209 Ga0495662_0049576 3300046476 Bacteria 2026
210 Ga0495662_0095121 3300046476 Bacteria 1455
211 Ga0495664_0028284 3300046477 Bacteria 3274
212 Ga0495585_0015711 3300046492 Bacteria 4396
213 Ga0495594_0001139 3300046499 Bacteria 13860
214 Ga0495594_0006795 3300046499 Bacteria 5878
215 Ga0495594_0145571 3300046499 Bacteria 1344
216 Ga0495596_0040519 3300046500 Bacteria 1839
217 Ga0495583_0008560 3300046506 Bacteria 6234
218 Ga0495583_0035892 3300046506 Bacteria 2361
219 Ga0495583_0158978 3300046506 Bacteria 933
220 Ga0495606_0013058 3300046507 Bacteria 6598
221 Ga0495608_0001061 3300046511 Bacteria 19348
222 Ga0495608_0114150 3300046511 Bacteria 1735
223 Ga0495610_0007038 3300046512 Bacteria 7599
224 Ga0495616_0021961 3300046513 Bacteria 3449
225 Ga0495618_0002300 3300046514 Bacteria 12388
226 Ga0495618_0084611 3300046514 Bacteria 2026
227 Ga0495618_0288135 3300046514 Bacteria 1022
228 Ga0495620_0121844 3300046515 Bacteria 1027
229 Ga0495628_0004626 3300046516 Bacteria 12158
230 Ga0495628_0132296 3300046516 Bacteria 1907
231 Ga0495628_0179750 3300046516 Bacteria 1601
232 Ga0495631_0067455 3300046518 Bacteria 1547
233 Ga0495632_0040811 3300046519 Bacteria 2335
234 Ga0495637_0020890 3300046520 Bacteria 3005
235 Ga0495666_0001304 3300046526 Bacteria 12056
236 Ga0495666_0165276 3300046526 Bacteria 1025
237 Ga0495652_0015292 3300046529 Bacteria 6867
238 Ga0495652_0033557 3300046529 Bacteria 4481
239 Ga0495652_0077589 3300046529 Bacteria 2753
240 Ga0495654_0022316 3300046530 Bacteria 3288
241 Ga0495665_0002501 3300046531 Bacteria 9927
242 Ga0495640_0000167 3300046533 Bacteria 42901
243 Ga0495640_0019352 3300046533 Bacteria 5026
244 Ga0495640_0123285 3300046533 Bacteria 1682
245 Ga0495640_0145859 3300046533 Bacteria 1522
246 Ga0495587_0005512 3300046536 Bacteria 8256
247 Ga0495645_0003929 3300046543 Bacteria 10135
248 Ga0495645_0039484 3300046543 Bacteria 3442
249 Ga0495622_0002733 3300046557 Bacteria 8441
250 Ga0495633_0013816 3300046558 Bacteria 4238
251 Ga0495667_0120345 3300046559 Bacteria 1695
252 Ga0495667_0141217 3300046559 Bacteria 1552
253 Ga0495667_0164447 3300046559 Bacteria 1427
254 Ga0495634_0024343 3300046642 Bacteria 4247
255 Ga0495634_0077672 3300046642 Bacteria 2176
256 Ga0495611_0012798 3300046648 Bacteria 3565
257 Ga0495611_0023155 3300046648 Bacteria 2693
258 Ga0495611_0042736 3300046648 Bacteria 2024
259 Ga0495611_0102376 3300046648 Bacteria 1330
260 Ga0495625_0003109 3300046660 Bacteria 16960
261 Ga0495625_0014028 3300046660 Bacteria 6415
262 Ga0495625_0108840 3300046660 Bacteria 1896
263 Ga0495635_0007091 3300046663 Bacteria 7835
264 Ga0495661_0008634 3300046665 Bacteria 7042
265 Ga0495657_0002270 3300046675 Bacteria 16239
266 Ga0495657_0006398 3300046675 Bacteria 9221
267 Ga0495657_0018901 3300046675 Bacteria 4980
268 Ga0495657_0168969 3300046675 Bacteria 1348
269 Ga0495623_0031067 3300046679 Bacteria 3435
270 Ga0495623_0185817 3300046679 Bacteria 1204
271 Ga0495646_0000979 3300046680 Bacteria 16386
272 Ga0495646_0128842 3300046680 Bacteria 1426
273 Ga0495646_0228529 3300046680 Bacteria 1003
274 Ga0495613_0008163 3300046689 Bacteria 7785
275 Ga0495613_0016279 3300046689 Bacteria 5541
276 Ga0495613_0083299 3300046689 Bacteria 2322
277 Ga0495613_0117986 3300046689 Bacteria 1907
278 Ga0495613_0364455 3300046689 Bacteria 990
279 Ga0495624_0030296 3300046690 Bacteria 3525
280 Ga0495624_0044684 3300046690 Bacteria 2823
281 Ga0495624_0257919 3300046690 Bacteria 1054
282 Ga0495670_0000953 3300046691 Bacteria 14001
283 Ga0495671_0074402 3300046692 Bacteria 1666
284 Ga0495649_0032461 3300046694 Bacteria 2875
285 Ga0495589_0011643 3300046794 Bacteria 4566
286 Ga0495589_0011969 3300046794 Bacteria 4498
287 Ga0495589_0017947 3300046794 Bacteria 3629
288 Ga0495589_0219611 3300046794 Bacteria 893
289 Ga0495600_0020767 3300046809 Bacteria 4202
290 Ga0495581_0000894 3300047315 Bacteria 15962
291 Ga0495581_0014115 3300047315 Bacteria 4629
292 Ga0495581_0042327 3300047315 Bacteria 2636
293 Ga0495581_0185087 3300047315 Bacteria 1218
294 Ga0495604_0004680 3300047317 Bacteria 10851
295 Ga0495604_0092208 3300047317 Bacteria 2244
296 Ga0495604_0104853 3300047317 Bacteria 2070
297 Ga0495636_0006254 3300047318 Bacteria 4678
298 Ga0495636_0016155 3300047318 Bacteria 2979
299 Ga0495636_0113996 3300047318 Bacteria 1191
300 Ga0495636_0219917 3300047318 Bacteria 872
301 Ga0495636_0356043 3300047318 Bacteria 691
302 Ga0495674_0296400 3300047319 Bacteria 1321
303 Ga0495674_0480570 3300047319 Bacteria 995
304 Ga0495672_0181111 3300047320 Bacteria 1067
305 Ga0495676_0003750 3300047321 Bacteria 13806
306 Ga0495676_0006687 3300047321 Bacteria 10623
307 Ga0495676_0011527 3300047321 Bacteria 7972
308 Ga0495676_0019227 3300047321 Bacteria 6009
309 Ga0495676_0025690 3300047321 Bacteria 5081
310 Ga0495683_0020995 3300047323 Bacteria 3366
311 Ga0495687_001818 3300047443 Bacteria 18758
312 Ga0495687_006121 3300047443 Bacteria 7460
313 Ga0495687_020730 3300047443 Bacteria 3199
314 Ga0495687_028816 3300047443 Bacteria 2577
315 Ga0495687_077566 3300047443 Bacteria 1311
316 Ga0495675_0031331 3300047444 Bacteria 3394
317 Ga0495675_0039569 3300047444 Bacteria 3002
318 Ga0495677_0025565 3300047445 Bacteria 2142
319 Ga0495685_003754 3300047447 Bacteria 4863
320 Ga0495685_090420 3300047447 Bacteria 1015
321 Ga0495685_184281 3300047447 Bacteria 672
322 Ga0495681_0015828 3300047470 Bacteria 4256
323 Ga0495684_0350959 3300047471 Bacteria 1047
324 Ga0495686_0061902 3300047472 Bacteria 2322
325 Ga0495593_0001606 3300047673 Bacteria 13352
326 Ga0495593_0053006 3300047673 Bacteria 2141
327 Ga0495593_0062245 3300047673 Bacteria 1950
328 Ga0495602_0136305 3300048088 Bacteria 1949
329 Ga0495602_0311515 3300048088 Bacteria 1148
330 Ga0495614_0031833 3300048089 Bacteria 2270
331 Ga0495626_0010921 3300048091 Bacteria 4823
332 Ga0496107_0846577 3300048910 Bacteria 668
333 Ga0496114_0122120 3300048917 Bacteria 2241
334 Ga0496117_0000235 3300048920 Bacteria 104830
335 Ga0496118_0281534 3300048921 Bacteria 925
336 Ga0496123_0018745 3300048926 Bacteria 5485
337 Ga0496124_0114751 3300048927 Bacteria 2163
338 Ga0496126_0715351 3300048929 Bacteria 777
339 Ga0501309_017118 3300049129 Bacteria 993
340 Ga0501307_002331 3300049162 Bacteria 1756
341 Ga0501307_021983 3300049162 Bacteria 836
342 Ga0501311_003066 3300049527 Bacteria 1670
343 Ga0501317_000671 3300049533 Bacteria 2549
344 Ga0501318_000540 3300049534 Bacteria 2472
345 Ga0501318_023186 3300049534 Bacteria 800
346 Ga0501318_032933 3300049534 Bacteria 712
347 Ga0501321_016235 3300049537 Bacteria 884
348 Ga0501031_0079699 3300049568 Bacteria 2134
349 Ga0501031_0101322 3300049568 Bacteria 1879
350 Ga0501032_0107449 3300049569 Bacteria 1848
351 Ga0501032_0329208 3300049569 Bacteria 985
352 Ga0501034_0075751 3300049571 Bacteria 3371
353 Ga0501036_0212734 3300049572 Bacteria 1624
354 Ga0501038_0001543 3300049574 Bacteria 21259
355 Ga0501038_0119456 3300049574 Bacteria 2176
356 Ga0501039_0112348 3300049575 Bacteria 2130
357 Ga0501039_0566570 3300049575 Bacteria 891
358 Ga0501043_0087837 3300049579 Bacteria 2443
359 Ga0501048_0247273 3300049582 Bacteria 1266
360 Ga0501067_0044783 3300049583 Bacteria 2458
361 Ga0501069_0201377 3300049585 Bacteria 1154
362 Ga0501069_0309377 3300049585 Bacteria 927
363 Ga0501070_0085159 3300049586 Bacteria 2617
364 Ga0501070_0184544 3300049586 Bacteria 1716
365 Ga0501070_0385130 3300049586 Bacteria 1136
366 Ga0501071_0325981 3300049587 Bacteria 1167
367 Ga0501075_0166703 3300049591 Bacteria 1681
368 Ga0501076_0093977 3300049592 Bacteria 2414
369 Ga0501080_0381291 3300049742 Bacteria 1270
370 Ga0501035_0223198 3300049822 Bacteria 1608
371 Ga0501044_0142418 3300049823 Bacteria 2385
372 Ga0501045_0609360 3300049824 Bacteria 808
373 nmdc:mga0yw44_1576_c1 3300050492 Bacteria 9147
374 nmdc:mga0yw44_163727_c1 3300050492 Bacteria 1457
375 nmdc:mga0yw44_389862_c1 3300050492 Bacteria 941
376 nmdc:mga0yw44_41392_c1 3300050492 Bacteria 2743
377 nmdc:mga0yw44_518811_c1 3300050492 Bacteria 809
378 nmdc:mga06z11_169269_c1 3300050494 Bacteria 1253
379 nmdc:mga06z11_1861_c1 3300050494 Bacteria 7951
380 nmdc:mga04h51_3474_c1 3300050495 Bacteria 3833
381 Ga0495601_0022746 3300053077 Bacteria 3852
382 Ga0495601_0044991 3300053077 Bacteria 2775
383 Ga0495601_0381113 3300053077 Bacteria 915
384 Ga0495612_0022288 3300053078 Bacteria 2539
385 Ga0495655_0052630 3300053083 Bacteria 1083
386 Ga0495619_0018524 3300053085 Bacteria 4417
387 Ga0500651_0101452 3300053093 Bacteria 1764
388 Ga0500641_0077812 3300053096 Bacteria 1404
389 Ga0500650_0191090 3300053098 Bacteria 935
390 Ga0500660_082493 3300053100 Bacteria 1466
391 Ga0500553_030021 3300053101 Bacteria 2721
392 Ga0500556_0000971 3300053104 Bacteria 15299
393 Ga0500560_000528 3300053107 Bacteria 5409
394 Ga0500560_031365 3300053107 Bacteria 1608
395 Ga0500593_000263 3300053117 Bacteria 21458
396 Ga0500594_0003181 3300053118 Bacteria 3596
397 Ga0500573_0000842 3300053140 Bacteria 13888
398 Ga0500573_0065301 3300053140 Bacteria 2081
399 Ga0500616_0000088 3300053153 Bacteria 191662
400 Ga0501082_0725073 3300060353 Bacteria 870
401 Ga0466962_0008126 3300061719 Bacteria 5031
402 Ga0466962_0011048 3300061719 Bacteria 4347
403 Ga0466962_0012797 3300061719 Bacteria 4036
404 Ga0530510_0242875 3300061734 Bacteria 1341

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041443 Ga0451789_0060067 Ga0451789_0060067_36_548 155
2 3300044658 Ga0466972_0019896 Ga0466972_0019896_23_520 157
3 3300041494 Ga0451837_1808306 Ga0451837_1808306_23_562 158
4 3300041486 Ga0451807_1652371 Ga0451807_1652371_145_714 169
5 3300044765 Ga0466970_0264623 Ga0466970_0264623_64_741 175
6 3300048917 Ga0496114_0122120 Ga0496114_0122120_772_1404 175
7 3300049534 Ga0501318_000540 Ga0501318_000540_1507_2127 175
8 3300047447 Ga0495685_090420 Ga0495685_090420_14_661 176
9 3300049537 Ga0501321_016235 Ga0501321_016235_61_624 176
10 3300045976 Ga0466967_0004873 Ga0466967_0004873_7454_8083 178
11 iso_pu_bacteria 2582580736 2583152655 179
12 iso_pu_bacteria 2984576629 2984580204 180
13 iso_pu_bacteria 2990256926 2990259054 180
14 3300046543 Ga0495645_0003929 Ga0495645_0003929_3907_4557 181
15 3300047444 Ga0495675_0039569 Ga0495675_0039569_868_1518 181
16 3300044658 Ga0466972_0024669 Ga0466972_0024669_1314_1931 182
17 3300044693 Ga0466961_0039844 Ga0466961_0039844_1034_1651 182
18 3300044694 Ga0466963_0091845 Ga0466963_0091845_504_1121 182
19 3300044719 Ga0466971_0038227 Ga0466971_0038227_1338_1955 182
20 3300044735 Ga0466968_0116871 Ga0466968_0116871_185_802 182
21 3300044765 Ga0466970_0033502 Ga0466970_0033502_1012_1629 182
22 3300045836 Ga0466958_0094291 Ga0466958_0094291_78_695 182
23 3300045976 Ga0466967_0058691 Ga0466967_0058691_1268_1885 182
24 3300045976 Ga0466967_0149194 Ga0466967_0149194_741_1358 182
25 3300049568 Ga0501031_0079699 Ga0501031_0079699_1458_2063 182
26 3300049586 Ga0501070_0385130 Ga0501070_0385130_188_805 182
27 3300049824 Ga0501045_0609360 Ga0501045_0609360_182_787 182
28 3300061719 Ga0466962_0012797 Ga0466962_0012797_2033_2650 182
29 3300005530 Ga0070679_100853539 Ga0070679_1008535391 183
30 3300006038 Ga0075365_10015400 Ga0075365_100154004 183
31 3300013307 Ga0157372_10568137 Ga0157372_105681372 183
32 3300025921 Ga0207652_10688174 Ga0207652_106881741 183
33 3300030522 Ga0307512_10069595 Ga0307512_100695951 183
34 3300031731 Ga0307405_10018487 Ga0307405_100184873 183
35 3300031995 Ga0307409_100754587 Ga0307409_1007545872 183
36 3300048910 Ga0496107_0846577 Ga0496107_0846577_19_633 183
37 3300048929 Ga0496126_0715351 Ga0496126_0715351_75_695 183
38 3300049534 Ga0501318_032933 Ga0501318_032933_24_638 183
39 3300049586 Ga0501070_0085159 Ga0501070_0085159_301_936 183
40 3300050492 nmdc:mga0yw44_1576_c1 nmdc:mga0yw44_1576_c1_65_679 183
41 iso_pu_bacteria 8057568493 8057569749 183
42 3300005347 Ga0070668_100001849 Ga0070668_1000018493 184
43 3300005459 Ga0068867_100490604 Ga0068867_1004906042 184
44 3300005719 Ga0068861_100776343 Ga0068861_1007763432 184
45 3300005844 Ga0068862_100443865 Ga0068862_1004438652 184
46 3300006038 Ga0075365_10607021 Ga0075365_106070212 184
47 3300025944 Ga0207661_10306339 Ga0207661_103063391 184
48 3300025972 Ga0207668_10050988 Ga0207668_100509883 184
49 3300026118 Ga0207675_100385193 Ga0207675_1003851932 184
50 3300028381 Ga0268264_10394158 Ga0268264_103941582 184
51 3300030522 Ga0307512_10249720 Ga0307512_102497202 184
52 3300031616 Ga0307508_10004187 Ga0307508_100041871 184
53 3300031824 Ga0307413_10030182 Ga0307413_100301822 184
54 3300031901 Ga0307406_10083120 Ga0307406_100831202 184
55 3300031903 Ga0307407_10016354 Ga0307407_100163543 184
56 3300031911 Ga0307412_10138474 Ga0307412_101384742 184
57 3300031995 Ga0307409_100101211 Ga0307409_1001012112 184
58 3300031995 Ga0307409_100529590 Ga0307409_1005295902 184
59 3300032002 Ga0307416_100130590 Ga0307416_1001305902 184
60 3300032126 Ga0307415_100004523 Ga0307415_1000045232 184
61 3300044683 Ga0466965_0379200 Ga0466965_0379200_128_742 184
62 3300048927 Ga0496124_0114751 Ga0496124_0114751_220_837 184
63 3300049533 Ga0501317_000671 Ga0501317_000671_1481_2134 184
64 3300049575 Ga0501039_0566570 Ga0501039_0566570_140_763 184
65 3300049583 Ga0501067_0044783 Ga0501067_0044783_1227_1844 184
66 3300050492 nmdc:mga0yw44_389862_c1 nmdc:mga0yw44_389862_c1_17_634 184
67 3300050494 nmdc:mga06z11_169269_c1 nmdc:mga06z11_169269_c1_205_822 184
68 3300053104 Ga0500556_0000971 Ga0500556_0000971_7384_8001 184
69 3300053117 Ga0500593_000263 Ga0500593_000263_10869_11486 184
70 3300061734 Ga0530510_0242875 Ga0530510_0242875_59_676 184
71 iso_pu_bacteria 2622736605 2623499838 184
72 iso_pu_bacteria 2866552031 2866555028 184
73 iso_pu_bacteria 2895442618 2895452492 184
74 iso_pu_bacteria 8055172936 8055180893 184
75 3300005336 Ga0070680_100228824 Ga0070680_1002288242 185
76 3300005347 Ga0070668_100778298 Ga0070668_1007782982 185
77 3300005356 Ga0070674_101143635 Ga0070674_1011436351 185
78 3300005367 Ga0070667_100316827 Ga0070667_1003168272 185
79 3300006914 Ga0075436_100480399 Ga0075436_1004803992 185
80 3300014745 Ga0157377_10279337 Ga0157377_102793372 185
81 3300025901 Ga0207688_10022775 Ga0207688_100227752 185
82 3300025917 Ga0207660_10898662 Ga0207660_108986622 185
83 3300025937 Ga0207669_10233744 Ga0207669_102337442 185
84 3300025938 Ga0207704_10175682 Ga0207704_101756822 185
85 3300025961 Ga0207712_10873471 Ga0207712_108734712 185
86 3300025986 Ga0207658_10235441 Ga0207658_102354412 185
87 3300026116 Ga0207674_10699526 Ga0207674_106995261 185
88 3300030522 Ga0307512_10242643 Ga0307512_102426432 185
89 3300031616 Ga0307508_10049559 Ga0307508_100495592 185
90 3300031730 Ga0307516_10001875 Ga0307516_1000187512 185
91 3300031824 Ga0307413_10554971 Ga0307413_105549711 185
92 3300031901 Ga0307406_10176032 Ga0307406_101760322 185
93 3300031911 Ga0307412_10180593 Ga0307412_101805932 185
94 3300031995 Ga0307409_100196207 Ga0307409_1001962072 185
95 3300031995 Ga0307409_100222441 Ga0307409_1002224412 185
96 3300031995 Ga0307409_100536485 Ga0307409_1005364851 185
97 3300031995 Ga0307409_101066226 Ga0307409_1010662261 185
98 3300032002 Ga0307416_100236180 Ga0307416_1002361802 185
99 3300032002 Ga0307416_101151354 Ga0307416_1011513541 185
100 3300032005 Ga0307411_10665542 Ga0307411_106655421 185
101 3300032126 Ga0307415_100128178 Ga0307415_1001281783 185
102 3300032126 Ga0307415_100181716 Ga0307415_1001817162 185
103 3300032126 Ga0307415_100283584 Ga0307415_1002835842 185
104 3300035692 Ga0373935_0018059 Ga0373935_0018059_641_1255 185
105 3300037466 Ga0395898_0764534 Ga0395898_0764534_130_747 185
106 3300038443 Ga0395901_0057315 Ga0395901_0057315_2487_3104 185
107 3300044683 Ga0466965_0128170 Ga0466965_0128170_75_701 185
108 3300044901 Ga0466960_0101376 Ga0466960_0101376_810_1454 185
109 3300045976 Ga0466967_0012352 Ga0466967_0012352_4054_4698 185
110 3300047318 Ga0495636_0219917 Ga0495636_0219917_220_858 185
111 3300049129 Ga0501309_017118 Ga0501309_017118_275_892 185
112 3300049162 Ga0501307_002331 Ga0501307_002331_437_1054 185
113 3300049527 Ga0501311_003066 Ga0501311_003066_285_902 185
114 3300049534 Ga0501318_023186 Ga0501318_023186_147_764 185
115 3300053093 Ga0500651_0101452 Ga0500651_0101452_26_640 185
116 3300053096 Ga0500641_0077812 Ga0500641_0077812_17_631 185
117 3300053118 Ga0500594_0003181 Ga0500594_0003181_1930_2544 185
118 iso_pu_bacteria 2582581314 2585321522 185
119 iso_pu_bacteria 2808606448 2809233173 185
120 iso_pu_bacteria 2990088156 2990089298 185
121 3300041451 Ga0451791_0381482 Ga0451791_0381482_169_795 186
122 3300041452 Ga0451793_1768735 Ga0451793_1768735_24_650 186
123 3300041453 Ga0451797_0668506 Ga0451797_0668506_48_674 186
124 3300041494 Ga0451837_1090609 Ga0451837_1090609_173_799 186
125 3300041496 Ga0451839_0692888 Ga0451839_0692888_30_647 186
126 3300041498 Ga0451841_0387088 Ga0451841_0387088_49_675 186
127 3300041509 Ga0451843_0744411 Ga0451843_0744411_140_766 186
128 3300044842 Ga0466957_0393771 Ga0466957_0393771_206_826 186
129 3300045836 Ga0466958_0493477 Ga0466958_0493477_10_630 186
130 3300046515 Ga0495620_0121844 Ga0495620_0121844_135_746 186
131 3300047318 Ga0495636_0016155 Ga0495636_0016155_818_1429 186
132 3300047443 Ga0495687_006121 Ga0495687_006121_3674_4285 186
133 3300048921 Ga0496118_0281534 Ga0496118_0281534_172_813 186
134 3300050492 nmdc:mga0yw44_41392_c1 nmdc:mga0yw44_41392_c1_1584_2213 186
135 3300053077 Ga0495601_0381113 Ga0495601_0381113_34_645 186
136 3300053083 Ga0495655_0052630 Ga0495655_0052630_328_951 186
137 iso_pu_bacteria 2919468124 2919475807 186
138 iso_pu_bacteria 2954002825 2954002876 186
139 iso_pu_bacteria 3006486233 3006488950 186
140 iso_pu_bacteria 3006493962 3006499759 186
141 iso_pu_bacteria 8056829672 8056833792 186
142 3300003322 rootL2_10136955 rootL2_101369552 187
143 3300046455 Ga0495603_0023736 Ga0495603_0023736_2974_3588 187
144 3300046459 Ga0495629_0126088 Ga0495629_0126088_190_804 187
145 3300046462 Ga0495651_0179225 Ga0495651_0179225_595_1209 187
146 3300046477 Ga0495664_0028284 Ga0495664_0028284_1737_2351 187
147 3300046499 Ga0495594_0006795 Ga0495594_0006795_4804_5418 187
148 3300046511 Ga0495608_0114150 Ga0495608_0114150_357_974 187
149 3300046514 Ga0495618_0288135 Ga0495618_0288135_202_816 187
150 3300046516 Ga0495628_0132296 Ga0495628_0132296_1037_1651 187
151 3300046529 Ga0495652_0015292 Ga0495652_0015292_2639_3253 187
152 3300046533 Ga0495640_0000167 Ga0495640_0000167_10421_11035 187
153 3300046559 Ga0495667_0164447 Ga0495667_0164447_788_1402 187
154 3300046648 Ga0495611_0012798 Ga0495611_0012798_2683_3297 187
155 3300046675 Ga0495657_0006398 Ga0495657_0006398_7296_7910 187
156 3300046675 Ga0495657_0168969 Ga0495657_0168969_636_1253 187
157 3300046690 Ga0495624_0030296 Ga0495624_0030296_753_1367 187
158 3300046794 Ga0495589_0219611 Ga0495589_0219611_59_673 187
159 3300047315 Ga0495581_0042327 Ga0495581_0042327_341_955 187
160 3300047317 Ga0495604_0004680 Ga0495604_0004680_5740_6354 187
161 3300047321 Ga0495676_0011527 Ga0495676_0011527_5018_5632 187
162 3300047321 Ga0495676_0025690 Ga0495676_0025690_202_816 187
163 3300048920 Ga0496117_0000235 Ga0496117_0000235_19907_20554 187
164 3300048926 Ga0496123_0018745 Ga0496123_0018745_3233_3895 187
165 3300053107 Ga0500560_000528 Ga0500560_000528_1866_2480 187
166 3300053140 Ga0500573_0000842 Ga0500573_0000842_2022_2717 187
167 3300053153 Ga0500616_0000088 Ga0500616_0000088_32673_33347 187
168 iso_pu_bacteria 2616644814 2616703239 187
169 iso_pu_bacteria 2842888712 2842891828 187
170 iso_pu_bacteria 2857729791 2857733516 187
171 iso_pu_bacteria 2863404153 2863411750 187
172 iso_pu_bacteria 2912723979 2912729299 187
173 iso_pu_bacteria 8008558824 8008566329 187
174 iso_pu_bacteria 8057345674 8057348913 187
175 3300030521 Ga0307511_10137285 Ga0307511_101372852 188
176 3300030522 Ga0307512_10086145 Ga0307512_100861452 188
177 3300031731 Ga0307405_10625028 Ga0307405_106250282 188
178 3300044765 Ga0466970_0266521 Ga0466970_0266521_153_782 188
179 3300046455 Ga0495603_0004220 Ga0495603_0004220_3090_3680 188
180 3300046462 Ga0495651_0044210 Ga0495651_0044210_152_802 188
181 3300046463 Ga0495653_0009606 Ga0495653_0009606_1274_1924 188
182 3300046472 Ga0495580_0065657 Ga0495580_0065657_469_1119 188
183 3300046492 Ga0495585_0015711 Ga0495585_0015711_2171_2761 188
184 3300046511 Ga0495608_0001061 Ga0495608_0001061_14658_15308 188
185 3300046516 Ga0495628_0004626 Ga0495628_0004626_703_1353 188
186 3300046526 Ga0495666_0001304 Ga0495666_0001304_10715_11365 188
187 3300046531 Ga0495665_0002501 Ga0495665_0002501_5992_6642 188
188 3300046533 Ga0495640_0019352 Ga0495640_0019352_4114_4764 188
189 3300046533 Ga0495640_0145859 Ga0495640_0145859_142_774 188
190 3300046543 Ga0495645_0039484 Ga0495645_0039484_2661_3311 188
191 3300046648 Ga0495611_0042736 Ga0495611_0042736_171_761 188
192 3300046679 Ga0495623_0031067 Ga0495623_0031067_135_785 188
193 3300046680 Ga0495646_0228529 Ga0495646_0228529_195_845 188
194 3300046689 Ga0495613_0008163 Ga0495613_0008163_2861_3511 188
195 3300046690 Ga0495624_0257919 Ga0495624_0257919_283_1014 188
196 3300046691 Ga0495670_0000953 Ga0495670_0000953_2113_2703 188
197 3300046794 Ga0495589_0017947 Ga0495589_0017947_26_616 188
198 3300046809 Ga0495600_0020767 Ga0495600_0020767_703_1353 188
199 3300047315 Ga0495581_0014115 Ga0495581_0014115_905_1555 188
200 3300047317 Ga0495604_0104853 Ga0495604_0104853_1312_1944 188
201 3300047319 Ga0495674_0296400 Ga0495674_0296400_82_732 188
202 3300047319 Ga0495674_0480570 Ga0495674_0480570_262_912 188
203 3300047321 Ga0495676_0003750 Ga0495676_0003750_5465_6061 188
204 3300047321 Ga0495676_0006687 Ga0495676_0006687_2359_2949 188
205 3300047444 Ga0495675_0031331 Ga0495675_0031331_1796_2446 188
206 3300048088 Ga0495602_0136305 Ga0495602_0136305_949_1599 188
207 3300053077 Ga0495601_0044991 Ga0495601_0044991_1551_2201 188
208 3300053085 Ga0495619_0018524 Ga0495619_0018524_2841_3491 188
209 3300053140 Ga0500573_0065301 Ga0500573_0065301_533_1183 188
210 iso_pu_bacteria 2643221678 2644439144 188
211 iso_pu_bacteria 2643221714 2644632385 188
212 iso_pu_bacteria 2784132148 2784589510 188
213 iso_pu_bacteria 2808606359 2808843147 188
214 iso_pu_bacteria 2862178590 2862181494 188
215 iso_pu_bacteria 2912715099 2912718620 188
216 iso_pu_bacteria 8008574985 8008577970 188
217 iso_pu_bacteria 8048127548 8048132664 188
218 3300005434 Ga0070709_10188805 Ga0070709_101888052 189
219 3300005436 Ga0070713_100077572 Ga0070713_1000775724 189
220 3300006038 Ga0075365_10064952 Ga0075365_100649522 189
221 3300022467 Ga0224712_10012943 Ga0224712_100129432 189
222 3300025906 Ga0207699_10159087 Ga0207699_101590872 189
223 3300025928 Ga0207700_10033956 Ga0207700_100339565 189
224 3300025929 Ga0207664_10081897 Ga0207664_100818973 189
225 3300037466 Ga0395898_0345444 Ga0395898_0345444_657_1313 189
226 3300042014 Ga0439457_046037 Ga0439457_046037_362_961 189
227 3300042131 Ga0450894_000149 Ga0450894_000149_5058_5657 189
228 3300042133 Ga0450896_002049 Ga0450896_002049_30_629 189
229 3300042134 Ga0450898_027737 Ga0450898_027737_191_790 189
230 3300042135 Ga0450899_000455 Ga0450899_000455_3104_3688 189
231 3300042145 Ga0450906_000591 Ga0450906_000591_1361_1960 189
232 3300044719 Ga0466971_0003866 Ga0466971_0003866_3463_4101 189
233 3300046476 Ga0495662_0035761 Ga0495662_0035761_944_1630 189
234 3300046476 Ga0495662_0095121 Ga0495662_0095121_404_1102 189
235 3300046499 Ga0495594_0145571 Ga0495594_0145571_623_1270 189
236 3300046506 Ga0495583_0008560 Ga0495583_0008560_2746_3465 189
237 3300046506 Ga0495583_0158978 Ga0495583_0158978_180_827 189
238 3300046648 Ga0495611_0023155 Ga0495611_0023155_1263_1910 189
239 3300046660 Ga0495625_0014028 Ga0495625_0014028_360_1007 189
240 3300046660 Ga0495625_0108840 Ga0495625_0108840_502_1149 189
241 3300046675 Ga0495657_0002270 Ga0495657_0002270_9878_10564 189
242 3300046689 Ga0495613_0364455 Ga0495613_0364455_52_750 189
243 3300046794 Ga0495589_0011643 Ga0495589_0011643_2758_3363 189
244 3300046794 Ga0495589_0011969 Ga0495589_0011969_740_1459 189
245 3300047318 Ga0495636_0006254 Ga0495636_0006254_1238_1957 189
246 3300047318 Ga0495636_0356043 Ga0495636_0356043_41_646 189
247 3300047443 Ga0495687_028816 Ga0495687_028816_551_1198 189
248 3300047445 Ga0495677_0025565 Ga0495677_0025565_960_1679 189
249 3300047447 Ga0495685_184281 Ga0495685_184281_44_661 189
250 3300049585 Ga0501069_0309377 Ga0501069_0309377_52_696 189
251 3300050492 nmdc:mga0yw44_163727_c1 nmdc:mga0yw44_163727_c1_140_787 189
252 3300053100 Ga0500660_082493 Ga0500660_082493_254_901 189
253 3300061719 Ga0466962_0008126 Ga0466962_0008126_516_1154 189
254 iso_pu_bacteria 2547132111 2547410176 189
255 iso_pu_bacteria 2582581313 2585308290 189
256 iso_pu_bacteria 2582581314 2585312212 189
257 iso_pu_bacteria 2643221548 2643763272 189
258 iso_pu_bacteria 2643221682 2644463858 189
259 iso_pu_bacteria 2738541272 2738697249 189
260 iso_pu_bacteria 2738543027 2739326851 189
261 iso_pu_bacteria 2786546132 2786671751 189
262 iso_pu_bacteria 2808606375 2808921507 189
263 iso_pu_bacteria 2811994917 2812479631 189
264 iso_pu_bacteria 2818991463 2819698492 189
265 iso_pu_bacteria 2862281513 2862283565 189
266 iso_pu_bacteria 2867428634 2867436836 189
267 iso_pu_bacteria 2875391855 2875395038 189
268 iso_pu_bacteria 2946045630 2946049343 189
269 iso_pu_bacteria 2954673503 2954678036 189
270 iso_pu_bacteria 2954682443 2954686122 189
271 iso_pu_bacteria 2966598605 2966602235 189
272 iso_pu_bacteria 3006493962 3006494357 189
273 iso_pu_bacteria 8023623736 8023630016 189
274 3300003578 Ga0006562J51391_1063772 Ga0006562J51391_10637722 190
275 3300003578 Ga0006562J51391_1063773 Ga0006562J51391_10637733 190
276 3300028786 Ga0307517_10142039 Ga0307517_101420392 190
277 3300031838 Ga0307518_10212810 Ga0307518_102128102 190
278 3300033179 Ga0307507_10000240 Ga0307507_1000024022 190
279 3300033179 Ga0307507_10025553 Ga0307507_100255538 190
280 3300046454 Ga0495592_0080621 Ga0495592_0080621_1666_2265 190
281 3300046462 Ga0495651_0011388 Ga0495651_0011388_3927_4526 190
282 3300046476 Ga0495662_0007088 Ga0495662_0007088_2227_2826 190
283 3300046514 Ga0495618_0002300 Ga0495618_0002300_5990_6589 190
284 3300046516 Ga0495628_0179750 Ga0495628_0179750_908_1507 190
285 3300046526 Ga0495666_0165276 Ga0495666_0165276_51_650 190
286 3300046529 Ga0495652_0033557 Ga0495652_0033557_2965_3564 190
287 3300046536 Ga0495587_0005512 Ga0495587_0005512_3698_4297 190
288 3300046559 Ga0495667_0141217 Ga0495667_0141217_12_611 190
289 3300046642 Ga0495634_0024343 Ga0495634_0024343_3100_3699 190
290 3300046663 Ga0495635_0007091 Ga0495635_0007091_3657_4256 190
291 3300046680 Ga0495646_0000979 Ga0495646_0000979_9900_10499 190
292 3300046689 Ga0495613_0016279 Ga0495613_0016279_2370_2969 190
293 3300047315 Ga0495581_0000894 Ga0495581_0000894_7828_8427 190
294 3300047471 Ga0495684_0350959 Ga0495684_0350959_41_640 190
295 3300047673 Ga0495593_0001606 Ga0495593_0001606_2417_3016 190
296 3300048088 Ga0495602_0311515 Ga0495602_0311515_312_911 190
297 3300053101 Ga0500553_030021 Ga0500553_030021_480_1079 190
298 iso_pu_bacteria 2643221641 2644228034 190
299 iso_pu_bacteria 2739367898 2740165545 190
300 iso_pu_bacteria 8054609563 8054611943 190
301 3300015688 Ga0183367_1002 Ga0183367_10021009 191
302 3300020082 Ga0206353_10590688 Ga0206353_105906882 191
303 3300025303 Ga0209051_1059972 Ga0209051_10599722 191
304 3300028794 Ga0307515_10000258 Ga0307515_1000025863 191
305 3300031456 Ga0307513_10017989 Ga0307513_100179893 191
306 3300031507 Ga0307509_10007108 Ga0307509_1000710811 191
307 3300031507 Ga0307509_10173200 Ga0307509_101732002 191
308 3300031616 Ga0307508_10228331 Ga0307508_102283312 191
309 3300031838 Ga0307518_10296469 Ga0307518_102964692 191
310 3300033179 Ga0307507_10066141 Ga0307507_100661412 191
311 3300033180 Ga0307510_10190566 Ga0307510_101905662 191
312 3300033180 Ga0307510_10355450 Ga0307510_103554502 191
313 3300044656 Ga0466969_0017911 Ga0466969_0017911_164_769 191
314 3300044658 Ga0466972_0020895 Ga0466972_0020895_2287_2991 191
315 3300044658 Ga0466972_0040971 Ga0466972_0040971_40_645 191
316 3300044683 Ga0466965_0068832 Ga0466965_0068832_823_1428 191
317 3300044684 Ga0466966_0023774 Ga0466966_0023774_1061_1765 191
318 3300044684 Ga0466966_0029411 Ga0466966_0029411_325_930 191
319 3300044693 Ga0466961_0010395 Ga0466961_0010395_146_850 191
320 3300044693 Ga0466961_0019484 Ga0466961_0019484_3448_4053 191
321 3300044694 Ga0466963_0002412 Ga0466963_0002412_6883_7488 191
322 3300044706 Ga0466964_0093536 Ga0466964_0093536_481_1086 191
323 3300044719 Ga0466971_0038444 Ga0466971_0038444_1236_1841 191
324 3300044719 Ga0466971_0087184 Ga0466971_0087184_44_748 191
325 3300044735 Ga0466968_0005347 Ga0466968_0005347_3872_4576 191
326 3300044765 Ga0466970_0055248 Ga0466970_0055248_1249_1854 191
327 3300044842 Ga0466957_0001811 Ga0466957_0001811_10569_11174 191
328 3300045049 Ga0466959_0173070 Ga0466959_0173070_329_934 191
329 3300045836 Ga0466958_0006367 Ga0466958_0006367_46_651 191
330 3300045976 Ga0466967_0086551 Ga0466967_0086551_1891_2496 191
331 3300046455 Ga0495603_0014053 Ga0495603_0014053_2440_3120 191
332 3300046455 Ga0495603_0014817 Ga0495603_0014817_431_1177 191
333 3300046459 Ga0495629_0002208 Ga0495629_0002208_2209_2889 191
334 3300046459 Ga0495629_0038569 Ga0495629_0038569_1442_2188 191
335 3300046459 Ga0495629_0180190 Ga0495629_0180190_91_717 191
336 3300046460 Ga0495638_0152867 Ga0495638_0152867_310_990 191
337 3300046474 Ga0495605_0039502 Ga0495605_0039502_794_1474 191
338 3300046476 Ga0495662_0049576 Ga0495662_0049576_127_834 191
339 3300046499 Ga0495594_0001139 Ga0495594_0001139_9488_10168 191
340 3300046500 Ga0495596_0040519 Ga0495596_0040519_384_1064 191
341 3300046506 Ga0495583_0035892 Ga0495583_0035892_1577_2257 191
342 3300046507 Ga0495606_0013058 Ga0495606_0013058_3324_4004 191
343 3300046512 Ga0495610_0007038 Ga0495610_0007038_1524_2204 191
344 3300046513 Ga0495616_0021961 Ga0495616_0021961_1344_2024 191
345 3300046514 Ga0495618_0084611 Ga0495618_0084611_701_1408 191
346 3300046518 Ga0495631_0067455 Ga0495631_0067455_481_1161 191
347 3300046519 Ga0495632_0040811 Ga0495632_0040811_263_943 191
348 3300046520 Ga0495637_0020890 Ga0495637_0020890_2032_2712 191
349 3300046530 Ga0495654_0022316 Ga0495654_0022316_1138_1818 191
350 3300046533 Ga0495640_0123285 Ga0495640_0123285_930_1637 191
351 3300046557 Ga0495622_0002733 Ga0495622_0002733_6921_7601 191
352 3300046558 Ga0495633_0013816 Ga0495633_0013816_1744_2424 191
353 3300046559 Ga0495667_0120345 Ga0495667_0120345_300_1007 191
354 3300046642 Ga0495634_0077672 Ga0495634_0077672_1054_1761 191
355 3300046648 Ga0495611_0102376 Ga0495611_0102376_629_1309 191
356 3300046660 Ga0495625_0003109 Ga0495625_0003109_14497_15123 191
357 3300046665 Ga0495661_0008634 Ga0495661_0008634_2550_3230 191
358 3300046675 Ga0495657_0018901 Ga0495657_0018901_18_725 191
359 3300046680 Ga0495646_0128842 Ga0495646_0128842_233_940 191
360 3300046689 Ga0495613_0083299 Ga0495613_0083299_1505_2212 191
361 3300046689 Ga0495613_0117986 Ga0495613_0117986_102_854 191
362 3300046690 Ga0495624_0044684 Ga0495624_0044684_314_1021 191
363 3300046692 Ga0495671_0074402 Ga0495671_0074402_937_1563 191
364 3300046694 Ga0495649_0032461 Ga0495649_0032461_1384_2064 191
365 3300047315 Ga0495581_0185087 Ga0495581_0185087_143_823 191
366 3300047317 Ga0495604_0092208 Ga0495604_0092208_1493_2200 191
367 3300047318 Ga0495636_0113996 Ga0495636_0113996_484_1164 191
368 3300047320 Ga0495672_0181111 Ga0495672_0181111_276_956 191
369 3300047321 Ga0495676_0019227 Ga0495676_0019227_2505_3185 191
370 3300047323 Ga0495683_0020995 Ga0495683_0020995_2377_3057 191
371 3300047443 Ga0495687_001818 Ga0495687_001818_13745_14344 191
372 3300047443 Ga0495687_020730 Ga0495687_020730_414_1118 191
373 3300047443 Ga0495687_077566 Ga0495687_077566_348_1028 191
374 3300047447 Ga0495685_003754 Ga0495685_003754_2453_3133 191
375 3300047470 Ga0495681_0015828 Ga0495681_0015828_941_1567 191
376 3300047472 Ga0495686_0061902 Ga0495686_0061902_1528_2208 191
377 3300047673 Ga0495593_0053006 Ga0495593_0053006_146_853 191
378 3300047673 Ga0495593_0062245 Ga0495593_0062245_146_853 191
379 3300048089 Ga0495614_0031833 Ga0495614_0031833_532_1212 191
380 3300048091 Ga0495626_0010921 Ga0495626_0010921_2497_3177 191
381 3300049568 Ga0501031_0101322 Ga0501031_0101322_1033_1692 191
382 3300049569 Ga0501032_0107449 Ga0501032_0107449_794_1453 191
383 3300049574 Ga0501038_0119456 Ga0501038_0119456_768_1427 191
384 3300049575 Ga0501039_0112348 Ga0501039_0112348_185_844 191
385 3300049587 Ga0501071_0325981 Ga0501071_0325981_69_728 191
386 3300049591 Ga0501075_0166703 Ga0501075_0166703_955_1614 191
387 3300049592 Ga0501076_0093977 Ga0501076_0093977_838_1497 191
388 3300053098 Ga0500650_0191090 Ga0500650_0191090_175_774 191
389 3300053107 Ga0500560_031365 Ga0500560_031365_919_1545 191
390 3300061719 Ga0466962_0011048 Ga0466962_0011048_2190_2894 191
391 iso_pu_bacteria 2675903058 2676477450 191
392 iso_pu_bacteria 2802429296 2804845748 191
393 iso_pu_bacteria 2827628540 2827634707 191
394 iso_pu_bacteria 8025413630 8025416912 191
395 3300005539 Ga0068853_100117597 Ga0068853_1001175971 192
396 3300006042 Ga0075368_10005115 Ga0075368_100051156 192
397 3300006178 Ga0075367_10006729 Ga0075367_100067296 192
398 3300009148 Ga0105243_10265885 Ga0105243_102658852 192
399 3300009551 Ga0105238_10515220 Ga0105238_105152201 192
400 3300026041 Ga0207639_10076961 Ga0207639_100769613 192
401 3300027866 Ga0209813_10012589 Ga0209813_100125892 192
402 3300028794 Ga0307515_10109991 Ga0307515_101099911 192
403 3300031649 Ga0307514_10175742 Ga0307514_101757421 192
404 3300031824 Ga0307413_10418380 Ga0307413_104183801 192
405 3300031852 Ga0307410_10143971 Ga0307410_101439712 192
406 3300031995 Ga0307409_100223934 Ga0307409_1002239342 192
407 3300032002 Ga0307416_100570787 Ga0307416_1005707872 192
408 3300032005 Ga0307411_10214474 Ga0307411_102144742 192
409 3300032126 Ga0307415_100471192 Ga0307415_1004711922 192
410 3300038443 Ga0395901_0259982 Ga0395901_0259982_150_806 192
411 3300041405 Ga0439438_022771 Ga0439438_022771_538_1200 192
412 3300041411 Ga0439466_0111644 Ga0439466_0111644_37_699 192
413 3300041443 Ga0451789_0997067 Ga0451789_0997067_31_693 192
414 3300041451 Ga0451791_0077492 Ga0451791_0077492_533_1195 192
415 3300046462 Ga0495651_0198530 Ga0495651_0198530_116_742 192
416 3300046529 Ga0495652_0077589 Ga0495652_0077589_915_1541 192
417 3300046679 Ga0495623_0185817 Ga0495623_0185817_549_1175 192
418 3300049162 Ga0501307_021983 Ga0501307_021983_45_707 192
419 3300049572 Ga0501036_0212734 Ga0501036_0212734_356_1018 192
420 3300049582 Ga0501048_0247273 Ga0501048_0247273_565_1227 192
421 3300049585 Ga0501069_0201377 Ga0501069_0201377_185_847 192
422 3300050492 nmdc:mga0yw44_518811_c1 nmdc:mga0yw44_518811_c1_74_736 192
423 3300050494 nmdc:mga06z11_1861_c1 nmdc:mga06z11_1861_c1_7183_7845 192
424 3300050495 nmdc:mga04h51_3474_c1 nmdc:mga04h51_3474_c1_3122_3784 192
425 3300053077 Ga0495601_0022746 Ga0495601_0022746_2902_3528 192
426 3300053078 Ga0495612_0022288 Ga0495612_0022288_1796_2422 192
427 3300060353 Ga0501082_0725073 Ga0501082_0725073_35_697 192
428 3300001989 JGI24739J22299_10012060 JGI24739J22299_100120603 193
429 3300003316 rootH1_10007719 rootH1_100077193 193
430 3300003320 rootH2_10048161 rootH2_1004816112 193
431 3300003322 rootL2_10050146 rootL2_100501465 193
432 3300005548 Ga0070665_100349625 Ga0070665_1003496252 193
433 3300005614 Ga0068856_100147506 Ga0068856_1001475063 193
434 3300011119 Ga0105246_10000350 Ga0105246_100003503 193
435 3300025904 Ga0207647_10043782 Ga0207647_100437822 193
436 3300025904 Ga0207647_10175573 Ga0207647_101755732 193
437 3300030522 Ga0307512_10001966 Ga0307512_100019663 193
438 3300031616 Ga0307508_10027953 Ga0307508_100279532 193
439 3300031838 Ga0307518_10271235 Ga0307518_102712352 193
440 3300037466 Ga0395898_0036579 Ga0395898_0036579_3975_4622 193
441 3300038443 Ga0395901_0021537 Ga0395901_0021537_2896_3543 193
442 3300041512 Ga0451853_1127399 Ga0451853_1127399_615_1214 193
443 3300042012 Ga0439455_0006712 Ga0439455_0006712_439_1050 193
444 3300042136 Ga0450900_008934 Ga0450900_008934_289_900 193
445 3300042137 Ga0450902_010444 Ga0450902_010444_823_1434 193
446 3300042138 Ga0450903_000008 Ga0450903_000008_15243_15854 193
447 3300042157 Ga0439458_0000093 Ga0439458_0000093_11698_12309 193
448 3300042157 Ga0439458_0045392 Ga0439458_0045392_433_1014 193
449 3300042533 Ga0450901_009529 Ga0450901_009529_109_720 193
450 3300044694 Ga0466963_0026360 Ga0466963_0026360_2388_3026 193
451 3300044706 Ga0466964_0016623 Ga0466964_0016623_1990_2628 193
452 3300044765 Ga0466970_0139847 Ga0466970_0139847_553_1158 193
453 3300044901 Ga0466960_0073673 Ga0466960_0073673_841_1446 193
454 3300045976 Ga0466967_0001656 Ga0466967_0001656_7103_7741 193
455 3300049569 Ga0501032_0329208 Ga0501032_0329208_321_932 193
456 3300049571 Ga0501034_0075751 Ga0501034_0075751_687_1298 193
457 3300049574 Ga0501038_0001543 Ga0501038_0001543_7049_7660 193
458 3300049579 Ga0501043_0087837 Ga0501043_0087837_288_899 193
459 3300049586 Ga0501070_0184544 Ga0501070_0184544_240_914 193
460 3300049742 Ga0501080_0381291 Ga0501080_0381291_18_629 193
461 3300049822 Ga0501035_0223198 Ga0501035_0223198_603_1214 193
462 3300049823 Ga0501044_0142418 Ga0501044_0142418_618_1229 193

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

3

155

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k1y-assembly1.cif.gz_A x-ray structure of oxidoreductase from corynebacterium diphtheriae. orthorombic crystal form, northeast structural genomics consortium target cdr100d 0.9599 2 169
7qw4-assembly6.cif.gz_F pden_5119 protein 0.8983 2 165
3k1y-assembly1.cif.gz_A x-ray structure of oxidoreductase from corynebacterium diphtheriae. orthorombic crystal form, northeast structural genomics consortium target cdr100d 0.883 2 169
7qw4-assembly2.cif.gz_B pden_5119 protein 0.881 3 168
4pty-assembly1.cif.gz_D crystal structure of the escherichia coli alkanesulfonate fmn reductase ssue in apo form 0.88 1 167
ID Description Score Start End Superfamily
3k1yA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9238 2 169 3.40.50.360
3k1yA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8781 2 169 3.40.50.360
af_Q2G0L7_1_184_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8592 1 168 3.40.50.360
6dqpA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8426 1 167 3.40.50.360
4c76B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8351 1 179 3.40.50.360
ID Description Score Start End GO Terms
AF-B5I6V5-F1-model_v4 FMN reductase 0.9906 1 149 GO:0016491
AF-A0A660LDX6-F1-model_v4 FMN reductase 0.9893 2 169 GO:0016491
AF-A0A7X6HBX7-F1-model_v4 deleted 0.9873 2 143
AF-B5I6V5-F1-model_v4 FMN reductase 0.984 1 149 GO:0016491
AF-A0A0G3GY14-F1-model_v4 LLM-partnered FMN reductase, CE1759 family (EC 1.5.1.38) 0.979 2 167 GO:0052873

Feature Viewer

pLDDT pTM Quality
92.68 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map