F449017

General Info

Members Datasets Scaffolds Average Seq Length
462 249 924 359

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2929212328|2929216090
Length 396
Sequence ESQQIDPRLLASFGANRTSRRRFIGGSAAAAAALALGSSVLAACGGSDSGSASSASPTDDGGPVSGNLRISNWPLYMADGFIAAFQTATGLTVDYKEDYNDNEEWFAKVKEPLSRGQDIGADLVVPTQFMAARLNGLGWLNEIGDARWTNKKNMLPELMASPVDDGRKFSAPYMSYMVGLAYNRAATGRDITKVDDLWDPAFKGKVSLFSDPQDGLGMIMQSQGNSPQNPSTQTVQQAVDLIREQKDRGQIRRFTGNDYSDDLAAGNLIVAQAYSGDVVQLQKDNPDLKFVIPESGGLTSIDTMVIPKTTQNRAAAEEWINYVYDRANYAKLIAFTQYVPVLSDMDAELSKIDPNLAKNPLINPPQATRDKLTTWPSLTDEQTQEYNAAYAAVTGA

Samples

Sample ID Description Type Environment
1 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
137 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
138 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
139 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
140 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
141 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
142 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
143 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
144 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
145 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
146 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
147 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
163 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
186 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
189 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
217 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
218 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
219 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
220 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
221 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
222 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
231 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
232 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
233 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
234 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
235 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
238 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
239 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
240 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
241 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
242 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
243 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
244 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
245 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
246 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
247 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
248 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
249 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.62
Metatranscriptomes 0
Isolates 2.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.77
Nodule 0.22
Rhizoplane 11.04
Rhizosphere 66.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10004752 3300002077 Bacteria 2807
2 JGI24744J21845_10011463 3300002077 Bacteria 1813
3 JGI24034J26672_10003032 3300002239 Bacteria 2328
4 JGI25407J50210_10002788 3300003373 Bacteria 4152
5 Ga0055540_1001265 3300003792 Bacteria 15402
6 Ga0055540_1003233 3300003792 Bacteria 7989
7 Ga0055540_1012911 3300003792 Bacteria 2589
8 Ga0070676_10060482 3300005328 Bacteria 2250
9 Ga0070670_100126733 3300005331 Bacteria 2204
10 Ga0068869_100072600 3300005334 Bacteria 2550
11 Ga0068869_100251438 3300005334 Bacteria 1412
12 Ga0070666_10029480 3300005335 Bacteria 3608
13 Ga0070666_10173459 3300005335 Bacteria 1511
14 Ga0070682_100001675 3300005337 Bacteria 12333
15 Ga0068868_100108112 3300005338 Bacteria 2257
16 Ga0070668_100000276 3300005347 Bacteria 33981
17 Ga0070668_100002744 3300005347 Bacteria 12961
18 Ga0070668_100015363 3300005347 Bacteria 5722
19 Ga0070668_100143123 3300005347 Bacteria 1928
20 Ga0070669_100001256 3300005353 Bacteria 18407
21 Ga0070675_100209365 3300005354 Bacteria 1694
22 Ga0070671_100000377 3300005355 Bacteria 30681
23 Ga0070674_100013812 3300005356 Bacteria 5002
24 Ga0070674_100047463 3300005356 Bacteria 2943
25 Ga0070659_100139310 3300005366 Bacteria 1975
26 Ga0070659_100195972 3300005366 Bacteria 1661
27 Ga0070667_100000877 3300005367 Bacteria 27795
28 Ga0070667_100000920 3300005367 Bacteria 27197
29 Ga0070667_100011510 3300005367 Bacteria 7317
30 Ga0070709_10005837 3300005434 Bacteria 6674
31 Ga0070710_10001503 3300005437 Bacteria 10991
32 Ga0070701_10000925 3300005438 Bacteria 10625
33 Ga0070711_100000402 3300005439 Bacteria 22353
34 Ga0070711_100002219 3300005439 Bacteria 11011
35 Ga0070700_100003324 3300005441 Bacteria 8289
36 Ga0070700_100055620 3300005441 Bacteria 2477
37 Ga0070694_100118456 3300005444 Bacteria 1897
38 Ga0070694_100124841 3300005444 Bacteria 1851
39 Ga0070663_100006109 3300005455 Bacteria 7207
40 Ga0070678_100001104 3300005456 Bacteria 14151
41 Ga0068867_100000667 3300005459 Bacteria 22759
42 Ga0070685_10039180 3300005466 Bacteria 2691
43 Ga0068853_100002662 3300005539 Bacteria 13458
44 Ga0068853_100103393 3300005539 Bacteria 2521
45 Ga0070672_100223731 3300005543 Bacteria 1579
46 Ga0070686_100176251 3300005544 Bacteria 1516
47 Ga0070695_100023206 3300005545 Bacteria 3810
48 Ga0070695_100205862 3300005545 Bacteria 1409
49 Ga0070696_100001988 3300005546 Bacteria 13423
50 Ga0070696_100012698 3300005546 Bacteria 5656
51 Ga0070665_100006012 3300005548 Bacteria 12411
52 Ga0070665_100018650 3300005548 Bacteria 6954
53 Ga0070665_100051243 3300005548 Bacteria 4140
54 Ga0070704_100001144 3300005549 Bacteria 13849
55 Ga0070704_100009350 3300005549 Bacteria 5917
56 Ga0068855_100131684 3300005563 Bacteria 2856
57 Ga0068854_100002798 3300005578 Bacteria 10838
58 Ga0070702_100004350 3300005615 Bacteria 6459
59 Ga0070702_100039809 3300005615 Bacteria 2625
60 Ga0068852_100093019 3300005616 Bacteria 2701
61 Ga0068859_100000115 3300005617 Bacteria 75584
62 Ga0068859_100087688 3300005617 Bacteria 3160
63 Ga0068859_100196147 3300005617 Bacteria 2103
64 Ga0068864_100019318 3300005618 Bacteria 5697
65 Ga0068864_100185920 3300005618 Bacteria 1902
66 Ga0068866_10000674 3300005718 Bacteria 15478
67 Ga0068861_100082816 3300005719 Bacteria 2515
68 Ga0068861_100101634 3300005719 Bacteria 2287
69 Ga0068863_100000277 3300005841 Bacteria 53361
70 Ga0068863_100006312 3300005841 Bacteria 11635
71 Ga0068858_100001285 3300005842 Bacteria 25947
72 Ga0068858_100017982 3300005842 Bacteria 6621
73 Ga0068858_100053553 3300005842 Bacteria 3732
74 Ga0068860_100000044 3300005843 Bacteria 225595
75 Ga0068860_100000775 3300005843 Bacteria 35961
76 Ga0068860_100131473 3300005843 Bacteria 2402
77 Ga0068862_100000003 3300005844 Bacteria 369793
78 Ga0068862_100099281 3300005844 Bacteria 2544
79 Ga0068862_100201076 3300005844 Bacteria 1796
80 Ga0081455_10004404 3300005937 Bacteria 15825
81 Ga0081455_10009266 3300005937 Bacteria 10140
82 Ga0081455_10038577 3300005937 Bacteria 4229
83 Ga0081538_10001047 3300005981 Bacteria 29464
84 Ga0081538_10019363 3300005981 Bacteria 5061
85 Ga0081538_10021223 3300005981 Bacteria 4751
86 Ga0075365_10010242 3300006038 Bacteria 5448
87 Ga0075363_100007925 3300006048 Bacteria 4919
88 Ga0075363_100022652 3300006048 Bacteria 3177
89 Ga0075364_10006302 3300006051 Bacteria 6967
90 Ga0075364_10013146 3300006051 Bacteria 5079
91 Ga0075364_10016079 3300006051 Bacteria 4650
92 Ga0075364_10024376 3300006051 Bacteria 3841
93 Ga0075364_10043538 3300006051 Bacteria 2919
94 Ga0075364_10055520 3300006051 Bacteria 2591
95 Ga0075364_10089066 3300006051 Bacteria 2046
96 Ga0070716_100041275 3300006173 Bacteria 2570
97 Ga0070716_100111921 3300006173 Bacteria 1693
98 Ga0070712_100001056 3300006175 Bacteria 16636
99 Ga0070712_100050151 3300006175 Bacteria 2902
100 Ga0075362_10030225 3300006177 Bacteria 2339
101 Ga0075367_10008353 3300006178 Bacteria 5363
102 Ga0075369_10002033 3300006186 Bacteria 7127
103 Ga0075369_10011745 3300006186 Bacteria 3449
104 Ga0075369_10012186 3300006186 Bacteria 3395
105 Ga0075370_10000913 3300006353 Bacteria 12127
106 Ga0075370_10013556 3300006353 Bacteria 4338
107 Ga0075370_10031116 3300006353 Bacteria 2979
108 Ga0075428_100020199 3300006844 Bacteria 7377
109 Ga0075430_100097238 3300006846 Bacteria 2460
110 Ga0075431_100156257 3300006847 Bacteria 2346
111 Ga0075431_100160727 3300006847 Bacteria 2310
112 Ga0075429_100150572 3300006880 Bacteria 2037
113 Ga0097620_100000115 3300006931 Bacteria 75584
114 Ga0097620_100087689 3300006931 Bacteria 3160
115 Ga0097620_100196148 3300006931 Bacteria 2103
116 Ga0099795_10002078 3300007788 Bacteria 4600
117 Ga0111539_10511270 3300009094 Bacteria 1399
118 Ga0105245_10097767 3300009098 Bacteria 2711
119 Ga0105245_10172418 3300009098 Bacteria 2061
120 Ga0105245_10210537 3300009098 Bacteria 1871
121 Ga0105247_10000006 3300009101 Bacteria 416061
122 Ga0105247_10000963 3300009101 Bacteria 21722
123 Ga0105247_10056515 3300009101 Bacteria 2424
124 Ga0105247_10074229 3300009101 Bacteria 2132
125 Ga0105243_10002663 3300009148 Bacteria 14835
126 Ga0105243_10117866 3300009148 Bacteria 2233
127 Ga0105242_10000459 3300009176 Bacteria 32413
128 Ga0105248_10000062 3300009177 Bacteria 124366
129 Ga0105248_10003658 3300009177 Bacteria 17060
130 Ga0105237_10044500 3300009545 Bacteria 4470
131 Ga0105237_10072017 3300009545 Bacteria 3450
132 Ga0105237_10171561 3300009545 Bacteria 2169
133 Ga0105249_10000008 3300009553 Bacteria 341271
134 Ga0105249_10030325 3300009553 Bacteria 4889
135 Ga0105249_10152555 3300009553 Bacteria 2225
136 Ga0099796_10004588 3300010159 Bacteria 3361
137 Ga0105239_10004121 3300010375 Bacteria 17467
138 Ga0105239_10032818 3300010375 Bacteria 5705
139 Ga0105239_10045701 3300010375 Bacteria 4799
140 Ga0105239_10228305 3300010375 Bacteria 2088
141 Ga0157369_10231903 3300013105 Bacteria 1930
142 Ga0157374_10023822 3300013296 Bacteria 5481
143 Ga0157378_10205593 3300013297 Bacteria 1864
144 Ga0163162_10011983 3300013306 Bacteria 8456
145 Ga0163162_10050133 3300013306 Bacteria 4186
146 Ga0163162_10107612 3300013306 Bacteria 2884
147 Ga0163162_10158412 3300013306 Bacteria 2385
148 Ga0163162_10325563 3300013306 Bacteria 1669
149 Ga0163162_10355268 3300013306 Bacteria 1598
150 Ga0157372_10170385 3300013307 Bacteria 2519
151 Ga0157372_10313520 3300013307 Bacteria 1826
152 Ga0157375_10138870 3300013308 Bacteria 2555
153 Ga0163163_10205560 3300014325 Bacteria 2017
154 Ga0157380_10028427 3300014326 Bacteria 4263
155 Ga0157377_10104505 3300014745 Bacteria 1693
156 Ga0157379_10040857 3300014968 Bacteria 4140
157 Ga0157376_10027668 3300014969 Bacteria 4497
158 Ga0163161_10002277 3300017792 Bacteria 13770
159 Ga0163161_10137697 3300017792 Bacteria 1846
160 Ga0209025_1043406 3300025294 Bacteria 1895
161 Ga0209051_1000652 3300025303 Bacteria 39235
162 Ga0209051_1001152 3300025303 Bacteria 24033
163 Ga0209051_1011577 3300025303 Bacteria 4343
164 Ga0209051_1030967 3300025303 Bacteria 2067
165 Ga0207692_10005872 3300025898 Bacteria 4948
166 Ga0207642_10109967 3300025899 Bacteria 1401
167 Ga0207710_10000025 3300025900 Bacteria 314658
168 Ga0207710_10007952 3300025900 Bacteria 4484
169 Ga0207688_10015470 3300025901 Bacteria 4138
170 Ga0207680_10018650 3300025903 Bacteria 3694
171 Ga0207680_10051817 3300025903 Bacteria 2456
172 Ga0207699_10036449 3300025906 Bacteria 2804
173 Ga0207645_10016970 3300025907 Bacteria 4810
174 Ga0207671_10003210 3300025914 Bacteria 16463
175 Ga0207671_10032798 3300025914 Bacteria 3865
176 Ga0207671_10082433 3300025914 Bacteria 2413
177 Ga0207671_10195469 3300025914 Bacteria 1578
178 Ga0207693_10000381 3300025915 Bacteria 40785
179 Ga0207657_10078799 3300025919 Bacteria 2773
180 Ga0207681_10002490 3300025923 Bacteria 11697
181 Ga0207681_10099761 3300025923 Bacteria 2092
182 Ga0207659_10073055 3300025926 Bacteria 2510
183 Ga0207687_10094512 3300025927 Bacteria 2188
184 Ga0207687_10163486 3300025927 Bacteria 1711
185 Ga0207644_10022743 3300025931 Bacteria 4286
186 Ga0207644_10235720 3300025931 Bacteria 1455
187 Ga0207706_10003648 3300025933 Bacteria 14710
188 Ga0207706_10006665 3300025933 Bacteria 10677
189 Ga0207686_10058273 3300025934 Bacteria 2434
190 Ga0207709_10008188 3300025935 Bacteria 5789
191 Ga0207709_10076069 3300025935 Bacteria 2148
192 Ga0207670_10003336 3300025936 Bacteria 8515
193 Ga0207665_10006892 3300025939 Bacteria 7521
194 Ga0207665_10032771 3300025939 Bacteria 3440
195 Ga0207691_10049194 3300025940 Bacteria 3863
196 Ga0207691_10223061 3300025940 Bacteria 1634
197 Ga0207711_10000674 3300025941 Bacteria 33924
198 Ga0207711_10222421 3300025941 Bacteria 1727
199 Ga0207689_10150914 3300025942 Bacteria 1915
200 Ga0207667_10282101 3300025949 Bacteria 1697
201 Ga0207651_10037822 3300025960 Bacteria 3165
202 Ga0207712_10000011 3300025961 Bacteria 412321
203 Ga0207712_10008012 3300025961 Bacteria 6681
204 Ga0207712_10014006 3300025961 Bacteria 5146
205 Ga0207668_10000126 3300025972 Bacteria 54346
206 Ga0207668_10008233 3300025972 Bacteria 6213
207 Ga0207640_10002814 3300025981 Bacteria 9328
208 Ga0207658_10000659 3300025986 Bacteria 30114
209 Ga0207658_10003144 3300025986 Bacteria 11814
210 Ga0207658_10010623 3300025986 Bacteria 6257
211 Ga0207658_10015777 3300025986 Bacteria 5186
212 Ga0207658_10114538 3300025986 Bacteria 2138
213 Ga0207677_10008156 3300026023 Bacteria 5832
214 Ga0207677_10045234 3300026023 Bacteria 2938
215 Ga0207703_10002416 3300026035 Bacteria 16220
216 Ga0207703_10026816 3300026035 Bacteria 4538
217 Ga0207703_10052071 3300026035 Bacteria 3322
218 Ga0207639_10192529 3300026041 Bacteria 1743
219 Ga0207678_10012289 3300026067 Bacteria 7518
220 Ga0207678_10222373 3300026067 Bacteria 1616
221 Ga0207708_10015436 3300026075 Bacteria 5729
222 Ga0207708_10040365 3300026075 Bacteria 3558
223 Ga0207641_10003526 3300026088 Bacteria 13849
224 Ga0207648_10000462 3300026089 Bacteria 45206
225 Ga0207648_10099604 3300026089 Bacteria 2545
226 Ga0207676_10269135 3300026095 Bacteria 1542
227 Ga0207675_100029687 3300026118 Bacteria 5092
228 Ga0207675_100142963 3300026118 Bacteria 2274
229 Ga0207683_10000575 3300026121 Bacteria 33996
230 Ga0207683_10023444 3300026121 Bacteria 5310
231 Ga0207698_10073782 3300026142 Bacteria 2718
232 Ga0207698_10246198 3300026142 Bacteria 1633
233 Ga0209179_1007326 3300027512 Bacteria 1818
234 Ga0268266_10045198 3300028379 Bacteria 3767
235 Ga0268266_10116346 3300028379 Bacteria 2374
236 Ga0268265_10000010 3300028380 Bacteria 370129
237 Ga0268265_10045778 3300028380 Bacteria 3267
238 Ga0268265_10313047 3300028380 Bacteria 1418
239 Ga0268264_10000007 3300028381 Bacteria 815790
240 Ga0268264_10039666 3300028381 Bacteria 3891
241 Ga0307413_10158615 3300031824 Bacteria 1586
242 Ga0307409_100007704 3300031995 Bacteria 6469
243 Ga0307409_100017833 3300031995 Bacteria 4747
244 Ga0307409_100137114 3300031995 Bacteria 2102
245 Ga0307416_100064392 3300032002 Bacteria 3007
246 Ga0373937_0127004 3300036401 Bacteria 2380
247 Ga0436365_0543858 3300039437 Bacteria 4274
248 Ga0439466_0003285 3300041411 Bacteria 6299
249 Ga0439465_0000467 3300041413 Bacteria 11943
250 Ga0439465_0002850 3300041413 Bacteria 5661
251 Ga0439465_0008235 3300041413 Bacteria 3292
252 Ga0439465_0053152 3300041413 Bacteria 1330
253 Ga0439431_0008052 3300041997 Bacteria 2362
254 Ga0439445_0005576 3300042004 Bacteria 2872
255 Ga0439448_0009298 3300042005 Bacteria 2895
256 Ga0439450_005041 3300042008 Bacteria 2296
257 Ga0439454_002964 3300042011 Bacteria 1848
258 Ga0439463_005691 3300042016 Bacteria 3096
259 Ga0439435_0016082 3300042436 Bacteria 1871
260 Ga0439464_0006797 3300042439 Bacteria 2983
261 Ga0466972_0012281 3300044658 Bacteria 4304
262 Ga0466972_0025283 3300044658 Bacteria 2944
263 Ga0466965_0004661 3300044683 Bacteria 6112
264 Ga0466965_0005902 3300044683 Bacteria 5529
265 Ga0466965_0187017 3300044683 Bacteria 1094
266 Ga0466966_0028007 3300044684 Bacteria 3671
267 Ga0466968_0004521 3300044735 Bacteria 5203
268 Ga0466968_0018019 3300044735 Bacteria 2830
269 Ga0466968_0041728 3300044735 Bacteria 1938
270 Ga0466970_0021866 3300044765 Bacteria 3337
271 Ga0466960_0001475 3300044901 Bacteria 8577
272 Ga0466960_0042266 3300044901 Bacteria 2163
273 Ga0466960_0211580 3300044901 Bacteria 1063
274 Ga0466959_0003572 3300045049 Bacteria 10233
275 Ga0466958_0017501 3300045836 Bacteria 4145
276 Ga0466967_0046255 3300045976 Bacteria 3788
277 Ga0466967_0137361 3300045976 Bacteria 2274
278 Ga0466967_0169875 3300045976 Bacteria 2051
279 Ga0495629_0060681 3300046459 Bacteria 2643
280 Ga0495638_0004021 3300046460 Bacteria 11283
281 Ga0495638_0004986 3300046460 Bacteria 9958
282 Ga0495648_0000871 3300046524 Bacteria 31818
283 Ga0495640_0012804 3300046533 Bacteria 6401
284 Ga0495668_0021101 3300046616 Bacteria 3740
285 Ga0495647_0043022 3300046681 Bacteria 1727
286 Ga0495658_0090324 3300046683 Bacteria 1813
287 Ga0495624_0030662 3300046690 Bacteria 3501
288 Ga0495649_0090334 3300046694 Bacteria 1633
289 Ga0495672_0009613 3300047320 Bacteria 6980
290 Ga0495672_0022101 3300047320 Bacteria 4140
291 Ga0495672_0090532 3300047320 Bacteria 1681
292 Ga0495672_0115009 3300047320 Bacteria 1438
293 Ga0495676_0030568 3300047321 Bacteria 4568
294 Ga0495686_0003859 3300047472 Bacteria 12667
295 Ga0495593_0025789 3300047673 Bacteria 3253
296 Ga0495626_0053565 3300048091 Bacteria 1856
297 Ga0496100_0000898 3300048903 Bacteria 14185
298 Ga0496100_0002625 3300048903 Bacteria 9165
299 Ga0496100_0006818 3300048903 Bacteria 6259
300 Ga0496100_0038522 3300048903 Bacteria 3030
301 Ga0496100_0060497 3300048903 Bacteria 2493
302 Ga0496101_0000002 3300048904 Bacteria 410971
303 Ga0496101_0000019 3300048904 Bacteria 220382
304 Ga0496101_0000065 3300048904 Bacteria 123942
305 Ga0496101_0002758 3300048904 Bacteria 10786
306 Ga0496101_0016599 3300048904 Bacteria 4980
307 Ga0496101_0068869 3300048904 Bacteria 2588
308 Ga0496102_0000007 3300048905 Bacteria 417224
309 Ga0496102_0000009 3300048905 Bacteria 344149
310 Ga0496102_0000402 3300048905 Bacteria 50427
311 Ga0496102_0003421 3300048905 Bacteria 13464
312 Ga0496102_0009359 3300048905 Bacteria 8416
313 Ga0496102_0028865 3300048905 Bacteria 4959
314 Ga0496102_0099047 3300048905 Bacteria 2705
315 Ga0496102_0223594 3300048905 Bacteria 1775
316 Ga0496103_0000005 3300048906 Bacteria 505416
317 Ga0496103_0000013 3300048906 Bacteria 297928
318 Ga0496103_0000651 3300048906 Bacteria 26280
319 Ga0496103_0002747 3300048906 Bacteria 10980
320 Ga0496103_0040337 3300048906 Bacteria 2868
321 Ga0496104_0005592 3300048907 Bacteria 11005
322 Ga0496105_0025929 3300048908 Bacteria 4776
323 Ga0496106_0001784 3300048909 Bacteria 16068
324 Ga0496106_0015872 3300048909 Bacteria 5571
325 Ga0496107_0001314 3300048910 Bacteria 15237
326 Ga0496107_0022512 3300048910 Bacteria 4453
327 Ga0496107_0049991 3300048910 Bacteria 3013
328 Ga0496107_0056392 3300048910 Bacteria 2839
329 Ga0496108_0001002 3300048911 Bacteria 22036
330 Ga0496108_0001176 3300048911 Bacteria 20414
331 Ga0496108_0044525 3300048911 Bacteria 3704
332 Ga0496109_0000256 3300048912 Bacteria 51465
333 Ga0496109_0028009 3300048912 Bacteria 5036
334 Ga0496109_0034599 3300048912 Bacteria 4552
335 Ga0496110_0003864 3300048913 Bacteria 11545
336 Ga0496110_0024788 3300048913 Bacteria 5118
337 Ga0496110_0270078 3300048913 Bacteria 1548
338 Ga0496110_0358263 3300048913 Bacteria 1329
339 Ga0496111_0108566 3300048914 Bacteria 2043
340 Ga0496112_0013299 3300048915 Bacteria 7599
341 Ga0496112_0027883 3300048915 Bacteria 5448
342 Ga0496112_0165141 3300048915 Bacteria 2180
343 Ga0496112_0190588 3300048915 Bacteria 2012
344 Ga0496113_0087524 3300048916 Bacteria 2395
345 Ga0496114_0000163 3300048917 Bacteria 47096
346 Ga0496115_0032238 3300048918 Bacteria 4133
347 Ga0496115_0073565 3300048918 Bacteria 2774
348 Ga0496116_0000033 3300048919 Bacteria 418191
349 Ga0496116_0000104 3300048919 Bacteria 193416
350 Ga0496116_0004723 3300048919 Bacteria 12867
351 Ga0496116_0007641 3300048919 Bacteria 9537
352 Ga0496117_0000019 3300048920 Bacteria 469256
353 Ga0496117_0000025 3300048920 Bacteria 418106
354 Ga0496117_0000190 3300048920 Bacteria 125026
355 Ga0496117_0071622 3300048920 Bacteria 2321
356 Ga0496118_0000020 3300048921 Bacteria 470521
357 Ga0496118_0000023 3300048921 Bacteria 418106
358 Ga0496118_0002690 3300048921 Bacteria 23417
359 Ga0496119_0001596 3300048922 Bacteria 26957
360 Ga0496119_0002576 3300048922 Bacteria 19713
361 Ga0496119_0005617 3300048922 Bacteria 11926
362 Ga0496119_0006869 3300048922 Bacteria 10398
363 Ga0496120_0000382 3300048923 Bacteria 71535
364 Ga0496120_0010739 3300048923 Bacteria 6352
365 Ga0496120_0034981 3300048923 Bacteria 3005
366 Ga0496120_0086211 3300048923 Bacteria 1689
367 Ga0496121_0000027 3300048924 Bacteria 444747
368 Ga0496121_0000039 3300048924 Bacteria 351444
369 Ga0496121_0000064 3300048924 Bacteria 272488
370 Ga0496121_0001772 3300048924 Bacteria 35094
371 Ga0496122_0000295 3300048925 Bacteria 110220
372 Ga0496124_0000016 3300048927 Bacteria 444747
373 Ga0496124_0006919 3300048927 Bacteria 12188
374 Ga0496125_0000008 3300048928 Bacteria 704677
375 Ga0496125_0008540 3300048928 Bacteria 10705
376 Ga0496126_0000025 3300048929 Bacteria 444747
377 Ga0496126_0000162 3300048929 Bacteria 153331
378 Ga0496126_0002244 3300048929 Bacteria 26663
379 Ga0496126_0007370 3300048929 Bacteria 12070
380 Ga0496126_0017449 3300048929 Bacteria 7151
381 Ga0501032_0009544 3300049569 Bacteria 7035
382 Ga0501033_0026722 3300049570 Bacteria 4342
383 Ga0501034_0015192 3300049571 Bacteria 7914
384 Ga0501034_0141403 3300049571 Bacteria 2386
385 Ga0501036_0003817 3300049572 Bacteria 12090
386 Ga0501036_0035685 3300049572 Bacteria 4207
387 Ga0501037_0000060 3300049573 Bacteria 100831
388 Ga0501037_0119670 3300049573 Bacteria 1894
389 Ga0501039_0001407 3300049575 Bacteria 17702
390 Ga0501039_0006999 3300049575 Bacteria 8587
391 Ga0501042_0024393 3300049578 Bacteria 4242
392 Ga0501042_0148183 3300049578 Bacteria 1692
393 Ga0501043_0002866 3300049579 Bacteria 14399
394 Ga0501046_0003011 3300049580 Bacteria 15578
395 Ga0501048_0027386 3300049582 Bacteria 4142
396 Ga0501070_0028628 3300049586 Bacteria 4672
397 Ga0501071_0098713 3300049587 Bacteria 2151
398 Ga0501072_0002649 3300049588 Bacteria 13413
399 Ga0501074_0126640 3300049590 Bacteria 1827
400 Ga0501075_0004226 3300049591 Bacteria 9704
401 Ga0501076_0006986 3300049592 Bacteria 8204
402 Ga0501076_0099395 3300049592 Bacteria 2344
403 Ga0501077_0019573 3300049593 Bacteria 4280
404 Ga0501079_0008238 3300049741 Bacteria 7899
405 Ga0501083_0111228 3300049744 Bacteria 1801
406 Ga0501044_0089035 3300049823 Bacteria 3116
407 Ga0501045_0004970 3300049824 Bacteria 9215
408 nmdc:mga03683_108445_c1 3300050489 Bacteria 1225
409 nmdc:mga03n38_16367_c1 3300050490 Bacteria 2883
410 nmdc:mga03n38_29335_c1 3300050490 Bacteria 2302
411 nmdc:mga03n38_31571_c1 3300050490 Bacteria 2236
412 nmdc:mga03n38_4652_c1 3300050490 Bacteria 4577
413 nmdc:mga00v17_11676_c1 3300050491 Bacteria 4831
414 nmdc:mga00v17_118233_c1 3300050491 Bacteria 1686
415 nmdc:mga00v17_13434_c1 3300050491 Bacteria 4546
416 nmdc:mga00v17_17329_c1 3300050491 Bacteria 4076
417 nmdc:mga00v17_291274_c1 3300050491 Bacteria 1060
418 nmdc:mga00v17_3626_c1 3300050491 Bacteria 7978
419 nmdc:mga00v17_936_c1 3300050491 Bacteria 11145
420 nmdc:mga0yw44_1249_c1 3300050492 Bacteria 9989
421 nmdc:mga0yw44_15689_c1 3300050492 Bacteria 4067
422 nmdc:mga0yw44_43728_c1 3300050492 Bacteria 2676
423 nmdc:mga0k408_83810_c1 3300050493 Bacteria 1869
424 nmdc:mga06z11_125218_c1 3300050494 Bacteria 1437
425 nmdc:mga06z11_151949_c1 3300050494 Bacteria 1317
426 nmdc:mga06z11_18762_c1 3300050494 Bacteria 3166
427 nmdc:mga07m45_10187_c1 3300050496 Bacteria 4901
428 nmdc:mga07m45_3696_c1 3300050496 Bacteria 7402
429 nmdc:mga05p37_156344_c1 3300050507 Bacteria 2786
430 nmdc:mga09592_113039_c1 3300050508 Bacteria 2330
431 nmdc:mga0qj67_88574_c1 3300050509 Bacteria 2485
432 nmdc:mga06r32_297184_c1 3300050510 Bacteria 1601
433 nmdc:mga0sz30_1185_c1 3300050516 Bacteria 9340
434 nmdc:mga0sz30_1263_c1 3300050516 Bacteria 9028
435 nmdc:mga0sz30_13518_c1 3300050516 Bacteria 3198
436 nmdc:mga0sz30_46014_c1 3300050516 Bacteria 1841
437 nmdc:mga0sz30_69864_c1 3300050516 Bacteria 1510
438 Ga0495601_0237962 3300053077 Bacteria 1189
439 Ga0495619_0059562 3300053085 Bacteria 2537
440 Ga0500643_008929 3300053087 Bacteria 3880
441 Ga0500642_0134271 3300053130 Bacteria 1160
442 Ga0500652_000547 3300053131 Bacteria 13106
443 Ga0500616_0025453 3300053153 Bacteria 3282
444 Ga0500627_0004430 3300053158 Bacteria 4513
445 Ga0500645_000035 3300053730 Bacteria 113679
446 Ga0500645_010693 3300053730 Bacteria 3022
447 Ga0501084_0017440 3300054114 Bacteria 5970
448 Ga0501084_0078040 3300054114 Bacteria 2776
449 Ga0466962_0032730 3300061719 Bacteria 2488
450 Ga0530510_0003778 3300061734 Bacteria 10427
451 Ga0530510_0006827 3300061734 Bacteria 7953
452 2929216090 2929212328 Bacteria 7708288
453 2644485812 2643221687 Bacteria 6500351
454 2644633928 2643221715 Bacteria 6671032
455 2738704114 2738541274 Bacteria 6909446
456 2739334491 2738543028 Bacteria 6917070
457 2842137846 2842134933 Bacteria 5847019
458 2902797739 2902792274 Bacteria 7270173
459 2902800919 2902799365 Bacteria 5419524
460 2902810834 2902810491 Bacteria 6794147
461 2902843604 2902837492 Bacteria 6697721
462 2939585768 2939582691 Bacteria 7088898
463 JGI24744J21845_10004752
464 JGI24744J21845_10011463
465 JGI24034J26672_10003032
466 JGI25407J50210_10002788
467 Ga0055540_1001265
468 Ga0055540_1003233
469 Ga0055540_1012911
470 Ga0070676_10060482
471 Ga0070670_100126733
472 Ga0068869_100072600
473 Ga0068869_100251438
474 Ga0070666_10029480
475 Ga0070666_10173459
476 Ga0070682_100001675
477 Ga0068868_100108112
478 Ga0070668_100000276
479 Ga0070668_100002744
480 Ga0070668_100015363
481 Ga0070668_100143123
482 Ga0070669_100001256
483 Ga0070675_100209365
484 Ga0070671_100000377
485 Ga0070674_100013812
486 Ga0070674_100047463
487 Ga0070659_100139310
488 Ga0070659_100195972
489 Ga0070667_100000877
490 Ga0070667_100000920
491 Ga0070667_100011510
492 Ga0070709_10005837
493 Ga0070710_10001503
494 Ga0070701_10000925
495 Ga0070711_100000402
496 Ga0070711_100002219
497 Ga0070700_100003324
498 Ga0070700_100055620
499 Ga0070694_100118456
500 Ga0070694_100124841
501 Ga0070663_100006109
502 Ga0070678_100001104
503 Ga0068867_100000667
504 Ga0070685_10039180
505 Ga0068853_100002662
506 Ga0068853_100103393
507 Ga0070672_100223731
508 Ga0070686_100176251
509 Ga0070695_100023206
510 Ga0070695_100205862
511 Ga0070696_100001988
512 Ga0070696_100012698
513 Ga0070665_100006012
514 Ga0070665_100018650
515 Ga0070665_100051243
516 Ga0070704_100001144
517 Ga0070704_100009350
518 Ga0068855_100131684
519 Ga0068854_100002798
520 Ga0070702_100004350
521 Ga0070702_100039809
522 Ga0068852_100093019
523 Ga0068859_100000115
524 Ga0068859_100087688
525 Ga0068859_100196147
526 Ga0068864_100019318
527 Ga0068864_100185920
528 Ga0068866_10000674
529 Ga0068861_100082816
530 Ga0068861_100101634
531 Ga0068863_100000277
532 Ga0068863_100006312
533 Ga0068858_100001285
534 Ga0068858_100017982
535 Ga0068858_100053553
536 Ga0068860_100000044
537 Ga0068860_100000775
538 Ga0068860_100131473
539 Ga0068862_100000003
540 Ga0068862_100099281
541 Ga0068862_100201076
542 Ga0081455_10004404
543 Ga0081455_10009266
544 Ga0081455_10038577
545 Ga0081538_10001047
546 Ga0081538_10019363
547 Ga0081538_10021223
548 Ga0075365_10010242
549 Ga0075363_100007925
550 Ga0075363_100022652
551 Ga0075364_10006302
552 Ga0075364_10013146
553 Ga0075364_10016079
554 Ga0075364_10024376
555 Ga0075364_10043538
556 Ga0075364_10055520
557 Ga0075364_10089066
558 Ga0070716_100041275
559 Ga0070716_100111921
560 Ga0070712_100001056
561 Ga0070712_100050151
562 Ga0075362_10030225
563 Ga0075367_10008353
564 Ga0075369_10002033
565 Ga0075369_10011745
566 Ga0075369_10012186
567 Ga0075370_10000913
568 Ga0075370_10013556
569 Ga0075370_10031116
570 Ga0075428_100020199
571 Ga0075430_100097238
572 Ga0075431_100156257
573 Ga0075431_100160727
574 Ga0075429_100150572
575 Ga0097620_100000115
576 Ga0097620_100087689
577 Ga0097620_100196148
578 Ga0099795_10002078
579 Ga0111539_10511270
580 Ga0105245_10097767
581 Ga0105245_10172418
582 Ga0105245_10210537
583 Ga0105247_10000006
584 Ga0105247_10000963
585 Ga0105247_10056515
586 Ga0105247_10074229
587 Ga0105243_10002663
588 Ga0105243_10117866
589 Ga0105242_10000459
590 Ga0105248_10000062
591 Ga0105248_10003658
592 Ga0105237_10044500
593 Ga0105237_10072017
594 Ga0105237_10171561
595 Ga0105249_10000008
596 Ga0105249_10030325
597 Ga0105249_10152555
598 Ga0099796_10004588
599 Ga0105239_10004121
600 Ga0105239_10032818
601 Ga0105239_10045701
602 Ga0105239_10228305
603 Ga0157369_10231903
604 Ga0157374_10023822
605 Ga0157378_10205593
606 Ga0163162_10011983
607 Ga0163162_10050133
608 Ga0163162_10107612
609 Ga0163162_10158412
610 Ga0163162_10325563
611 Ga0163162_10355268
612 Ga0157372_10170385
613 Ga0157372_10313520
614 Ga0157375_10138870
615 Ga0163163_10205560
616 Ga0157380_10028427
617 Ga0157377_10104505
618 Ga0157379_10040857
619 Ga0157376_10027668
620 Ga0163161_10002277
621 Ga0163161_10137697
622 Ga0209025_1043406
623 Ga0209051_1000652
624 Ga0209051_1001152
625 Ga0209051_1011577
626 Ga0209051_1030967
627 Ga0207692_10005872
628 Ga0207642_10109967
629 Ga0207710_10000025
630 Ga0207710_10007952
631 Ga0207688_10015470
632 Ga0207680_10018650
633 Ga0207680_10051817
634 Ga0207699_10036449
635 Ga0207645_10016970
636 Ga0207671_10003210
637 Ga0207671_10032798
638 Ga0207671_10082433
639 Ga0207671_10195469
640 Ga0207693_10000381
641 Ga0207657_10078799
642 Ga0207681_10002490
643 Ga0207681_10099761
644 Ga0207659_10073055
645 Ga0207687_10094512
646 Ga0207687_10163486
647 Ga0207644_10022743
648 Ga0207644_10235720
649 Ga0207706_10003648
650 Ga0207706_10006665
651 Ga0207686_10058273
652 Ga0207709_10008188
653 Ga0207709_10076069
654 Ga0207670_10003336
655 Ga0207665_10006892
656 Ga0207665_10032771
657 Ga0207691_10049194
658 Ga0207691_10223061
659 Ga0207711_10000674
660 Ga0207711_10222421
661 Ga0207689_10150914
662 Ga0207667_10282101
663 Ga0207651_10037822
664 Ga0207712_10000011
665 Ga0207712_10008012
666 Ga0207712_10014006
667 Ga0207668_10000126
668 Ga0207668_10008233
669 Ga0207640_10002814
670 Ga0207658_10000659
671 Ga0207658_10003144
672 Ga0207658_10010623
673 Ga0207658_10015777
674 Ga0207658_10114538
675 Ga0207677_10008156
676 Ga0207677_10045234
677 Ga0207703_10002416
678 Ga0207703_10026816
679 Ga0207703_10052071
680 Ga0207639_10192529
681 Ga0207678_10012289
682 Ga0207678_10222373
683 Ga0207708_10015436
684 Ga0207708_10040365
685 Ga0207641_10003526
686 Ga0207648_10000462
687 Ga0207648_10099604
688 Ga0207676_10269135
689 Ga0207675_100029687
690 Ga0207675_100142963
691 Ga0207683_10000575
692 Ga0207683_10023444
693 Ga0207698_10073782
694 Ga0207698_10246198
695 Ga0209179_1007326
696 Ga0268266_10045198
697 Ga0268266_10116346
698 Ga0268265_10000010
699 Ga0268265_10045778
700 Ga0268265_10313047
701 Ga0268264_10000007
702 Ga0268264_10039666
703 Ga0307413_10158615
704 Ga0307409_100007704
705 Ga0307409_100017833
706 Ga0307409_100137114
707 Ga0307416_100064392
708 Ga0373937_0127004
709 Ga0436365_0543858
710 Ga0439466_0003285
711 Ga0439465_0000467
712 Ga0439465_0002850
713 Ga0439465_0008235
714 Ga0439465_0053152
715 Ga0439431_0008052
716 Ga0439445_0005576
717 Ga0439448_0009298
718 Ga0439450_005041
719 Ga0439454_002964
720 Ga0439463_005691
721 Ga0439435_0016082
722 Ga0439464_0006797
723 Ga0466972_0012281
724 Ga0466972_0025283
725 Ga0466965_0004661
726 Ga0466965_0005902
727 Ga0466965_0187017
728 Ga0466966_0028007
729 Ga0466968_0004521
730 Ga0466968_0018019
731 Ga0466968_0041728
732 Ga0466970_0021866
733 Ga0466960_0001475
734 Ga0466960_0042266
735 Ga0466960_0211580
736 Ga0466959_0003572
737 Ga0466958_0017501
738 Ga0466967_0046255
739 Ga0466967_0137361
740 Ga0466967_0169875
741 Ga0495629_0060681
742 Ga0495638_0004021
743 Ga0495638_0004986
744 Ga0495648_0000871
745 Ga0495640_0012804
746 Ga0495668_0021101
747 Ga0495647_0043022
748 Ga0495658_0090324
749 Ga0495624_0030662
750 Ga0495649_0090334
751 Ga0495672_0009613
752 Ga0495672_0022101
753 Ga0495672_0090532
754 Ga0495672_0115009
755 Ga0495676_0030568
756 Ga0495686_0003859
757 Ga0495593_0025789
758 Ga0495626_0053565
759 Ga0496100_0000898
760 Ga0496100_0002625
761 Ga0496100_0006818
762 Ga0496100_0038522
763 Ga0496100_0060497
764 Ga0496101_0000002
765 Ga0496101_0000019
766 Ga0496101_0000065
767 Ga0496101_0002758
768 Ga0496101_0016599
769 Ga0496101_0068869
770 Ga0496102_0000007
771 Ga0496102_0000009
772 Ga0496102_0000402
773 Ga0496102_0003421
774 Ga0496102_0009359
775 Ga0496102_0028865
776 Ga0496102_0099047
777 Ga0496102_0223594
778 Ga0496103_0000005
779 Ga0496103_0000013
780 Ga0496103_0000651
781 Ga0496103_0002747
782 Ga0496103_0040337
783 Ga0496104_0005592
784 Ga0496105_0025929
785 Ga0496106_0001784
786 Ga0496106_0015872
787 Ga0496107_0001314
788 Ga0496107_0022512
789 Ga0496107_0049991
790 Ga0496107_0056392
791 Ga0496108_0001002
792 Ga0496108_0001176
793 Ga0496108_0044525
794 Ga0496109_0000256
795 Ga0496109_0028009
796 Ga0496109_0034599
797 Ga0496110_0003864
798 Ga0496110_0024788
799 Ga0496110_0270078
800 Ga0496110_0358263
801 Ga0496111_0108566
802 Ga0496112_0013299
803 Ga0496112_0027883
804 Ga0496112_0165141
805 Ga0496112_0190588
806 Ga0496113_0087524
807 Ga0496114_0000163
808 Ga0496115_0032238
809 Ga0496115_0073565
810 Ga0496116_0000033
811 Ga0496116_0000104
812 Ga0496116_0004723
813 Ga0496116_0007641
814 Ga0496117_0000019
815 Ga0496117_0000025
816 Ga0496117_0000190
817 Ga0496117_0071622
818 Ga0496118_0000020
819 Ga0496118_0000023
820 Ga0496118_0002690
821 Ga0496119_0001596
822 Ga0496119_0002576
823 Ga0496119_0005617
824 Ga0496119_0006869
825 Ga0496120_0000382
826 Ga0496120_0010739
827 Ga0496120_0034981
828 Ga0496120_0086211
829 Ga0496121_0000027
830 Ga0496121_0000039
831 Ga0496121_0000064
832 Ga0496121_0001772
833 Ga0496122_0000295
834 Ga0496124_0000016
835 Ga0496124_0006919
836 Ga0496125_0000008
837 Ga0496125_0008540
838 Ga0496126_0000025
839 Ga0496126_0000162
840 Ga0496126_0002244
841 Ga0496126_0007370
842 Ga0496126_0017449
843 Ga0501032_0009544
844 Ga0501033_0026722
845 Ga0501034_0015192
846 Ga0501034_0141403
847 Ga0501036_0003817
848 Ga0501036_0035685
849 Ga0501037_0000060
850 Ga0501037_0119670
851 Ga0501039_0001407
852 Ga0501039_0006999
853 Ga0501042_0024393
854 Ga0501042_0148183
855 Ga0501043_0002866
856 Ga0501046_0003011
857 Ga0501048_0027386
858 Ga0501070_0028628
859 Ga0501071_0098713
860 Ga0501072_0002649
861 Ga0501074_0126640
862 Ga0501075_0004226
863 Ga0501076_0006986
864 Ga0501076_0099395
865 Ga0501077_0019573
866 Ga0501079_0008238
867 Ga0501083_0111228
868 Ga0501044_0089035
869 Ga0501045_0004970
870 nmdc:mga03683_108445_c1
871 nmdc:mga03n38_16367_c1
872 nmdc:mga03n38_29335_c1
873 nmdc:mga03n38_31571_c1
874 nmdc:mga03n38_4652_c1
875 nmdc:mga00v17_11676_c1
876 nmdc:mga00v17_118233_c1
877 nmdc:mga00v17_13434_c1
878 nmdc:mga00v17_17329_c1
879 nmdc:mga00v17_291274_c1
880 nmdc:mga00v17_3626_c1
881 nmdc:mga00v17_936_c1
882 nmdc:mga0yw44_1249_c1
883 nmdc:mga0yw44_15689_c1
884 nmdc:mga0yw44_43728_c1
885 nmdc:mga0k408_83810_c1
886 nmdc:mga06z11_125218_c1
887 nmdc:mga06z11_151949_c1
888 nmdc:mga06z11_18762_c1
889 nmdc:mga07m45_10187_c1
890 nmdc:mga07m45_3696_c1
891 nmdc:mga05p37_156344_c1
892 nmdc:mga09592_113039_c1
893 nmdc:mga0qj67_88574_c1
894 nmdc:mga06r32_297184_c1
895 nmdc:mga0sz30_1185_c1
896 nmdc:mga0sz30_1263_c1
897 nmdc:mga0sz30_13518_c1
898 nmdc:mga0sz30_46014_c1
899 nmdc:mga0sz30_69864_c1
900 Ga0495601_0237962
901 Ga0495619_0059562
902 Ga0500643_008929
903 Ga0500642_0134271
904 Ga0500652_000547
905 Ga0500616_0025453
906 Ga0500627_0004430
907 Ga0500645_000035
908 Ga0500645_010693
909 Ga0501084_0017440
910 Ga0501084_0078040
911 Ga0466962_0032730
912 Ga0530510_0003778
913 Ga0530510_0006827
914 2929216090
915 2644485812
916 2644633928
917 2738704114
918 2739334491
919 2842137846
920 2902797739
921 2902800919
922 2902810834
923 2902843604
924 2939585768

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

80

364

0.88

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

120

361

0.85

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

74

330

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eqb-assembly2.cif.gz_B 1.5 angstrom crystal structure of spermidine/putrescine abc transporter substrate-binding protein potd from streptococcus pneumoniae strain canada mdr_19a in complex with calcium and hepes 0.9095 38 367
4eqb-assembly2.cif.gz_B 1.5 angstrom crystal structure of spermidine/putrescine abc transporter substrate-binding protein potd from streptococcus pneumoniae strain canada mdr_19a in complex with calcium and hepes 0.8963 38 367
2v84-assembly1.cif.gz_A crystal structure of the tp0655 (tppotd) lipoprotein of treponema pallidum 0.8688 39 368
2v84-assembly1.cif.gz_A crystal structure of the tp0655 (tppotd) lipoprotein of treponema pallidum 0.8637 39 368
7oyt-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d f88l in complex with spermidine 0.8589 38 368
ID Description Score Start End Superfamily
af_Q2G2A8_37_140_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9221 40 140 3.40.190.10
1poy101 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9034 38 331 3.40.190.10
2v84A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9031 39 319 3.40.190.10
af_Q2G2A8_33_356_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8858 39 367 3.40.190.10
3ttnB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8844 40 331 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7K2ZPR5-F1-model_v4 Extracellular solute-binding protein 0.9534 39 368 GO:0015846
GO:0019808
GO:0042597
AF-A0A6B1N4W6-F1-model_v4 deleted 0.9473 72 368
AF-A0A4R8VGI4-F1-model_v4 Spermidine/putrescine ABC transporter substrate-binding protein 0.9453 76 366 GO:0015846
GO:0019808
GO:0042597
AF-A0A7V8YAI9-F1-model_v4 Spermidine/putrescine ABC transporter substrate-binding protein 0.9333 45 368 GO:0015846
GO:0019808
GO:0042597
AF-A0A510THG6-F1-model_v4 Aminotransferase class V domain-containing protein 0.9313 75 368 GO:0015846
GO:0019808
GO:0042597

Map