F449044

General Info

Members Datasets Scaffolds Average Seq Length
463 171 926 188

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100011389|Ga0070683_1000113894
Length 185
Sequence MPHINVDESLPGIRSLMAFSPGTAEPMSKLANLLLRNHEGLSMADSELIATYVSYLNDCFYCHQSHGAIAACYLNNEALVEQVKKNYQQANIPDKLKALLAIAGSVQKGGKHVTQEQIEKAKELGATDKDIHDTVLIAAAFCMFNRYVDGLAANTPTDLLTYGLRAKQVAERGYGNHIYNEKQPA

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
147 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 1.08
Rhizosphere 95.68
Stem 0
Stem Tuber 0
Unclassified 27.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100011389 3300005329 Bacteria 7687
2 rootH1_10159400 3300003316 Bacteria 2667
3 rootH2_10007197 3300003320 Bacteria 152995
4 rootH2_10060626 3300003320 Bacteria 6361
5 rootL2_10020955 3300003322 Bacteria 2656
6 rootL2_10118237 3300003322 Bacteria 1865
7 rootH1_10189510 3300003323 Unclassified 2197
8 JGI25160J50197_1003086 3300003354 Bacteria 7601
9 Ga0065712_10086636 3300005290 Bacteria 2620
10 Ga0065712_10453096 3300005290 Unclassified 684
11 Ga0065715_10604831 3300005293 Unclassified 705
12 Ga0070658_10000058 3300005327 Bacteria 113042
13 Ga0070658_10006010 3300005327 Bacteria 9847
14 Ga0070676_10003968 3300005328 Bacteria 7762
15 Ga0070676_10012233 3300005328 Bacteria 4681
16 Ga0070676_10112228 3300005328 Bacteria 1699
17 Ga0070676_10120073 3300005328 Unclassified 1649
18 Ga0070683_100003637 3300005329 Bacteria 12561
19 Ga0070683_100011761 3300005329 Bacteria 7578
20 Ga0070690_100116438 3300005330 Unclassified 1789
21 Ga0070670_100043906 3300005331 Bacteria 3843
22 Ga0070670_100045293 3300005331 Unclassified 3781
23 Ga0070670_100218229 3300005331 Bacteria 1659
24 Ga0070670_100238498 3300005331 Bacteria 1583
25 Ga0070670_100539762 3300005331 Unclassified 1040
26 Ga0070670_100598603 3300005331 Bacteria 986
27 Ga0070677_10187865 3300005333 Unclassified 988
28 Ga0068869_100022796 3300005334 Unclassified 4318
29 Ga0068869_100108102 3300005334 Unclassified 2113
30 Ga0070666_10082386 3300005335 Unclassified 2200
31 Ga0070666_10097356 3300005335 Bacteria 2026
32 Ga0070666_10246082 3300005335 Bacteria 1265
33 Ga0070682_100012589 3300005337 Bacteria 4853
34 Ga0068868_100002377 3300005338 Bacteria 13035
35 Ga0068868_100006082 3300005338 Bacteria 8522
36 Ga0068868_100030882 3300005338 Bacteria 4110
37 Ga0068868_100060867 3300005338 Unclassified 2990
38 Ga0068868_100197958 3300005338 Unclassified 1673
39 Ga0068868_100512961 3300005338 Bacteria 1051
40 Ga0068868_100934485 3300005338 Unclassified 790
41 Ga0070660_100008421 3300005339 Bacteria 7209
42 Ga0070660_100241267 3300005339 Bacteria 1472
43 Ga0070689_100067620 3300005340 Unclassified 2786
44 Ga0070661_100004850 3300005344 Bacteria 9261
45 Ga0070661_100017287 3300005344 Bacteria 5114
46 Ga0070661_100137233 3300005344 Bacteria 1841
47 Ga0070668_100003989 3300005347 Bacteria 10931
48 Ga0070668_100020319 3300005347 Bacteria 5010
49 Ga0070668_100122819 3300005347 Bacteria 2077
50 Ga0070668_100123609 3300005347 Bacteria 2071
51 Ga0070669_100017599 3300005353 Bacteria 5098
52 Ga0070675_100007967 3300005354 Bacteria 8211
53 Ga0070675_100029705 3300005354 Bacteria 4410
54 Ga0070675_100037525 3300005354 Unclassified 3948
55 Ga0070675_100495511 3300005354 Bacteria 1100
56 Ga0070675_100754984 3300005354 Unclassified 888
57 Ga0070671_100122136 3300005355 Bacteria 2192
58 Ga0070674_100812842 3300005356 Bacteria 808
59 Ga0070673_100000975 3300005364 Bacteria 16253
60 Ga0070673_100022478 3300005364 Bacteria 4591
61 Ga0070673_100086232 3300005364 Unclassified 2558
62 Ga0070673_101039218 3300005364 Unclassified 764
63 Ga0070688_100041176 3300005365 Unclassified 2834
64 Ga0070659_100020174 3300005366 Bacteria 5060
65 Ga0070659_100098954 3300005366 Unclassified 2345
66 Ga0070667_100005944 3300005367 Bacteria 10158
67 Ga0070667_100007892 3300005367 Bacteria 8831
68 Ga0070667_100077314 3300005367 Unclassified 2842
69 Ga0070667_100432405 3300005367 Bacteria 1201
70 Ga0070667_100438771 3300005367 Bacteria 1192
71 Ga0070667_100866274 3300005367 Unclassified 840
72 Ga0070694_100730845 3300005444 Bacteria 807
73 Ga0070678_100002806 3300005456 Bacteria 9627
74 Ga0070678_100063234 3300005456 Bacteria 2737
75 Ga0070678_100092093 3300005456 Unclassified 2328
76 Ga0070662_100025086 3300005457 Bacteria 4114
77 Ga0070662_100031159 3300005457 Unclassified 3740
78 Ga0068867_100009398 3300005459 Bacteria 6897
79 Ga0068867_100048237 3300005459 Bacteria 3132
80 Ga0068867_100107437 3300005459 Unclassified 2139
81 Ga0070685_10086696 3300005466 Bacteria 1888
82 Ga0070685_10485598 3300005466 Unclassified 871
83 Ga0070685_10548942 3300005466 Bacteria 824
84 Ga0070679_100082378 3300005530 Unclassified 3207
85 Ga0070679_100400032 3300005530 Bacteria 1319
86 Ga0070679_100416785 3300005530 Bacteria 1288
87 Ga0070684_100005417 3300005535 Bacteria 9776
88 Ga0070684_100006602 3300005535 Bacteria 8987
89 Ga0070684_100357330 3300005535 Bacteria 1344
90 Ga0068853_100008443 3300005539 Bacteria 8277
91 Ga0068853_100013961 3300005539 Bacteria 6570
92 Ga0068853_100016459 3300005539 Bacteria 6085
93 Ga0068853_100030370 3300005539 Bacteria 4564
94 Ga0068853_100036632 3300005539 Unclassified 4173
95 Ga0068853_100185706 3300005539 Bacteria 1887
96 Ga0068853_100373741 3300005539 Bacteria 1330
97 Ga0068853_101054229 3300005539 Bacteria 783
98 Ga0068853_101195493 3300005539 Bacteria 734
99 Ga0070672_100001245 3300005543 Bacteria 15660
100 Ga0070672_100085965 3300005543 Unclassified 2528
101 Ga0070693_100354441 3300005547 Bacteria 1005
102 Ga0070665_100000003 3300005548 Bacteria 811857
103 Ga0070665_100003860 3300005548 Bacteria 15863
104 Ga0068855_100001221 3300005563 Bacteria 31892
105 Ga0068855_100012811 3300005563 Bacteria 10117
106 Ga0068855_100013689 3300005563 Bacteria 9783
107 Ga0068855_100416288 3300005563 Bacteria 1470
108 Ga0070664_100005718 3300005564 Bacteria 10019
109 Ga0070664_100026264 3300005564 Bacteria 4829
110 Ga0070664_100218760 3300005564 Unclassified 1704
111 Ga0070664_100326510 3300005564 Bacteria 1391
112 Ga0070664_100622471 3300005564 Bacteria 1002
113 Ga0068857_100008967 3300005577 Bacteria 8668
114 Ga0068857_100021942 3300005577 Bacteria 5620
115 Ga0068857_100162592 3300005577 Unclassified 2026
116 Ga0068857_101327420 3300005577 Bacteria 698
117 Ga0068854_100072267 3300005578 Unclassified 2526
118 Ga0068854_100080562 3300005578 Unclassified 2403
119 Ga0068854_100263698 3300005578 Bacteria 1380
120 Ga0068856_100022578 3300005614 Bacteria 6118
121 Ga0068856_100218132 3300005614 Bacteria 1923
122 Ga0068852_100000515 3300005616 Bacteria 25446
123 Ga0068852_100032375 3300005616 Bacteria 4329
124 Ga0068852_100877478 3300005616 Unclassified 913
125 Ga0068852_101085671 3300005616 Unclassified 820
126 Ga0068859_100000006 3300005617 Bacteria 421509
127 Ga0068859_100065109 3300005617 Unclassified 3679
128 Ga0068859_100096415 3300005617 Unclassified 3010
129 Ga0068859_100213396 3300005617 Bacteria 2017
130 Ga0068864_100002292 3300005618 Bacteria 15821
131 Ga0068864_100003053 3300005618 Bacteria 13822
132 Ga0068864_100005461 3300005618 Bacteria 10425
133 Ga0068864_100111884 3300005618 Unclassified 2433
134 Ga0068864_100243409 3300005618 Bacteria 1667
135 Ga0068864_100262867 3300005618 Bacteria 1606
136 Ga0068866_10117592 3300005718 Bacteria 1493
137 Ga0068861_100077167 3300005719 Unclassified 2598
138 Ga0068861_101685915 3300005719 Bacteria 626
139 Ga0068851_10207956 3300005834 Unclassified 1095
140 Ga0068870_10586716 3300005840 Bacteria 755
141 Ga0068863_100028915 3300005841 Bacteria 5293
142 Ga0068863_100335187 3300005841 Unclassified 1471
143 Ga0068863_101175574 3300005841 Bacteria 773
144 Ga0068858_100000396 3300005842 Bacteria 45694
145 Ga0068858_100002516 3300005842 Bacteria 18469
146 Ga0068858_100827567 3300005842 Unclassified 904
147 Ga0068858_101312555 3300005842 Bacteria 712
148 Ga0068860_100001991 3300005843 Bacteria 21550
149 Ga0068860_100009673 3300005843 Bacteria 9575
150 Ga0068860_100019654 3300005843 Bacteria 6550
151 Ga0068860_100145974 3300005843 Bacteria 2277
152 Ga0068862_100025607 3300005844 Bacteria 4953
153 Ga0097621_100001004 3300006237 Bacteria 19846
154 Ga0097621_100007438 3300006237 Bacteria 7835
155 Ga0097621_100016225 3300006237 Bacteria 5625
156 Ga0097621_100044051 3300006237 Unclassified 3599
157 Ga0097621_100427087 3300006237 Bacteria 1190
158 Ga0068871_100000196 3300006358 Bacteria 41550
159 Ga0068871_100028609 3300006358 Unclassified 4370
160 Ga0068871_100035249 3300006358 Bacteria 3974
161 Ga0068871_100076652 3300006358 Bacteria 2762
162 Ga0068871_100110843 3300006358 Bacteria 2308
163 Ga0068871_100332672 3300006358 Unclassified 1340
164 Ga0068865_100000022 3300006881 Bacteria 102976
165 Ga0068865_100003608 3300006881 Bacteria 9303
166 Ga0068865_100018382 3300006881 Unclassified 4509
167 Ga0068865_101029950 3300006881 Bacteria 722
168 Ga0097620_100000006 3300006931 Bacteria 421509
169 Ga0097620_100065108 3300006931 Unclassified 3679
170 Ga0097620_100096423 3300006931 Unclassified 3010
171 Ga0097620_100213388 3300006931 Bacteria 2017
172 Ga0105240_10061095 3300009093 Bacteria 4696
173 Ga0105240_10138485 3300009093 Unclassified 2912
174 Ga0111539_10047822 3300009094 Bacteria 5112
175 Ga0105245_10018067 3300009098 Bacteria 6162
176 Ga0105245_10176885 3300009098 Unclassified 2036
177 Ga0105247_10117582 3300009101 Bacteria 1719
178 Ga0105243_10003187 3300009148 Bacteria 13434
179 Ga0105243_10876608 3300009148 Bacteria 891
180 Ga0105241_10003858 3300009174 Bacteria 11111
181 Ga0105241_10006479 3300009174 Bacteria 8629
182 Ga0105241_10387173 3300009174 Bacteria 1223
183 Ga0105241_10500651 3300009174 Unclassified 1083
184 Ga0105241_10711404 3300009174 Bacteria 918
185 Ga0105242_10015678 3300009176 Bacteria 5887
186 Ga0105242_10039819 3300009176 Unclassified 3784
187 Ga0105242_10079250 3300009176 Bacteria 2743
188 Ga0105242_10621161 3300009176 Unclassified 1047
189 Ga0105248_10735834 3300009177 Bacteria 1113
190 Ga0105237_10001888 3300009545 Bacteria 26745
191 Ga0105237_10043742 3300009545 Unclassified 4510
192 Ga0105237_10176561 3300009545 Bacteria 2136
193 Ga0105237_10460841 3300009545 Unclassified 1277
194 Ga0105238_10017681 3300009551 Bacteria 7249
195 Ga0105238_10183666 3300009551 Bacteria 2068
196 Ga0105249_10303923 3300009553 Bacteria 1601
197 Ga0105249_10326813 3300009553 Unclassified 1546
198 Ga0105249_10749090 3300009553 Unclassified 1039
199 Ga0105249_11430651 3300009553 Bacteria 763
200 Ga0105239_10063710 3300010375 Bacteria 4048
201 Ga0105239_10110971 3300010375 Unclassified 3040
202 Ga0105239_10224427 3300010375 Bacteria 2107
203 Ga0105239_10292883 3300010375 Bacteria 1833
204 Ga0105239_11202991 3300010375 Bacteria 873
205 Ga0105246_10117962 3300011119 Bacteria 1962
206 Ga0157373_10016772 3300013100 Bacteria 5338
207 Ga0157373_10116744 3300013100 Bacteria 1875
208 Ga0157373_10301207 3300013100 Bacteria 1138
209 Ga0157373_10466326 3300013100 Unclassified 910
210 Ga0157371_10192065 3300013102 Bacteria 1462
211 Ga0157371_10827277 3300013102 Bacteria 699
212 Ga0157370_10003210 3300013104 Bacteria 19329
213 Ga0157370_10190487 3300013104 Unclassified 1904
214 Ga0157369_10110271 3300013105 Bacteria 2926
215 Ga0157369_10183303 3300013105 Bacteria 2202
216 Ga0157369_10335449 3300013105 Bacteria 1571
217 Ga0157374_10006063 3300013296 Bacteria 10231
218 Ga0157374_10012422 3300013296 Bacteria 7408
219 Ga0157374_10013240 3300013296 Bacteria 7196
220 Ga0157374_10040954 3300013296 Unclassified 4267
221 Ga0157374_10121573 3300013296 Bacteria 2520
222 Ga0157374_10270325 3300013296 Bacteria 1676
223 Ga0157378_10001999 3300013297 Bacteria 18236
224 Ga0157378_10006773 3300013297 Bacteria 10007
225 Ga0157378_10115411 3300013297 Bacteria 2468
226 Ga0157378_10167454 3300013297 Bacteria 2059
227 Ga0157378_10226879 3300013297 Unclassified 1778
228 Ga0157378_10435979 3300013297 Unclassified 1298
229 Ga0163162_10000064 3300013306 Bacteria 103542
230 Ga0163162_10002297 3300013306 Bacteria 17950
231 Ga0163162_10004331 3300013306 Bacteria 13665
232 Ga0163162_10022513 3300013306 Bacteria 6210
233 Ga0163162_10146174 3300013306 Unclassified 2480
234 Ga0163162_10179881 3300013306 Bacteria 2241
235 Ga0163162_10313143 3300013306 Unclassified 1702
236 Ga0163162_10389560 3300013306 Bacteria 1526
237 Ga0163162_10395437 3300013306 Bacteria 1515
238 Ga0163162_11601904 3300013306 Bacteria 743
239 Ga0157372_10158416 3300013307 Bacteria 2615
240 Ga0157372_10644121 3300013307 Bacteria 1234
241 Ga0157372_10798380 3300013307 Bacteria 1097
242 Ga0157372_11708929 3300013307 Bacteria 724
243 Ga0157372_11987543 3300013307 Bacteria 668
244 Ga0157375_10002371 3300013308 Bacteria 16297
245 Ga0157375_10007898 3300013308 Bacteria 9314
246 Ga0157375_10116710 3300013308 Unclassified 2774
247 Ga0157375_10347820 3300013308 Bacteria 1648
248 Ga0157375_10633239 3300013308 Bacteria 1227
249 Ga0157375_11694199 3300013308 Bacteria 748
250 Ga0163163_10000385 3300014325 Bacteria 41966
251 Ga0163163_10000694 3300014325 Bacteria 28641
252 Ga0163163_10181167 3300014325 Unclassified 2154
253 Ga0163163_10662868 3300014325 Bacteria 1107
254 Ga0163163_10806058 3300014325 Bacteria 1002
255 Ga0163163_10810163 3300014325 Bacteria 1000
256 Ga0157380_10971157 3300014326 Unclassified 881
257 Ga0157377_10042100 3300014745 Unclassified 2536
258 Ga0157377_10158135 3300014745 Bacteria 1407
259 Ga0157377_10672276 3300014745 Unclassified 748
260 Ga0157379_10000628 3300014968 Bacteria 28461
261 Ga0157379_10022898 3300014968 Bacteria 5538
262 Ga0157379_10261363 3300014968 Bacteria 1573
263 Ga0157379_10576755 3300014968 Unclassified 1048
264 Ga0157379_11322324 3300014968 Unclassified 697
265 Ga0157376_10002580 3300014969 Bacteria 12296
266 Ga0157376_10131698 3300014969 Bacteria 2232
267 Ga0157376_10444557 3300014969 Bacteria 1263
268 Ga0157376_10749291 3300014969 Bacteria 986
269 Ga0157376_11259627 3300014969 Unclassified 769
270 Ga0163161_10034330 3300017792 Bacteria 3629
271 Ga0163161_10043353 3300017792 Unclassified 3239
272 Ga0163161_10470724 3300017792 Bacteria 1019
273 Ga0163161_10635669 3300017792 Bacteria 883
274 Ga0213872_10003463 3300021361 Bacteria 8765
275 Ga0213876_10041861 3300021384 Unclassified 2420
276 Ga0207426_1000105 3300025302 Bacteria 247269
277 Ga0207656_10442263 3300025321 Unclassified 656
278 Ga0207642_10472691 3300025899 Unclassified 763
279 Ga0207688_10059443 3300025901 Unclassified 2153
280 Ga0207680_10060010 3300025903 Bacteria 2313
281 Ga0207680_10346980 3300025903 Bacteria 1042
282 Ga0207647_10018935 3300025904 Bacteria 4639
283 Ga0207647_10068262 3300025904 Bacteria 2152
284 Ga0207645_10000613 3300025907 Bacteria 29540
285 Ga0207645_10004380 3300025907 Bacteria 10456
286 Ga0207645_10004901 3300025907 Bacteria 9816
287 Ga0207645_10008717 3300025907 Bacteria 7062
288 Ga0207645_10184366 3300025907 Unclassified 1370
289 Ga0207645_10421388 3300025907 Bacteria 899
290 Ga0207643_10015310 3300025908 Unclassified 4175
291 Ga0207643_10096727 3300025908 Bacteria 1727
292 Ga0207705_10000090 3300025909 Bacteria 113233
293 Ga0207705_10285027 3300025909 Bacteria 1265
294 Ga0207654_10057061 3300025911 Bacteria 2267
295 Ga0207654_10161686 3300025911 Unclassified 1447
296 Ga0207654_10253395 3300025911 Bacteria 1181
297 Ga0207695_10075788 3300025913 Bacteria 3421
298 Ga0207695_10249014 3300025913 Unclassified 1676
299 Ga0207671_10000799 3300025914 Bacteria 39903
300 Ga0207671_10045031 3300025914 Unclassified 3262
301 Ga0207671_10066417 3300025914 Bacteria 2685
302 Ga0207660_10152156 3300025917 Bacteria 1778
303 Ga0207657_10011327 3300025919 Bacteria 8855
304 Ga0207649_10004576 3300025920 Bacteria 7502
305 Ga0207649_10036949 3300025920 Bacteria 2946
306 Ga0207649_10111543 3300025920 Bacteria 1828
307 Ga0207652_10032836 3300025921 Bacteria 4367
308 Ga0207652_10125637 3300025921 Bacteria 2284
309 Ga0207694_10012221 3300025924 Bacteria 6472
310 Ga0207694_10294158 3300025924 Bacteria 1336
311 Ga0207650_10051937 3300025925 Unclassified 3035
312 Ga0207650_10166069 3300025925 Bacteria 1752
313 Ga0207650_10242480 3300025925 Bacteria 1457
314 Ga0207650_10259576 3300025925 Unclassified 1409
315 Ga0207659_10049078 3300025926 Unclassified 2992
316 Ga0207659_10059776 3300025926 Bacteria 2741
317 Ga0207659_10072474 3300025926 Unclassified 2518
318 Ga0207659_10193782 3300025926 Bacteria 1618
319 Ga0207659_10277146 3300025926 Unclassified 1370
320 Ga0207659_10670781 3300025926 Bacteria 887
321 Ga0207687_10453249 3300025927 Unclassified 1064
322 Ga0207690_10115146 3300025932 Bacteria 1942
323 Ga0207706_10006551 3300025933 Bacteria 10787
324 Ga0207706_10019620 3300025933 Bacteria 6082
325 Ga0207706_10025599 3300025933 Bacteria 5285
326 Ga0207686_10333640 3300025934 Bacteria 1137
327 Ga0207686_10373082 3300025934 Unclassified 1080
328 Ga0207686_10396197 3300025934 Unclassified 1050
329 Ga0207686_10564131 3300025934 Unclassified 892
330 Ga0207709_10007759 3300025935 Bacteria 5947
331 Ga0207670_10023584 3300025936 Unclassified 3833
332 Ga0207669_10168919 3300025937 Bacteria 1554
333 Ga0207704_10000011 3300025938 Bacteria 180140
334 Ga0207704_10011245 3300025938 Bacteria 4400
335 Ga0207704_10013018 3300025938 Unclassified 4148
336 Ga0207704_10325152 3300025938 Unclassified 1188
337 Ga0207691_10015798 3300025940 Bacteria 7173
338 Ga0207691_10016919 3300025940 Bacteria 6918
339 Ga0207691_10465329 3300025940 Bacteria 1075
340 Ga0207691_10560363 3300025940 Bacteria 968
341 Ga0207689_10005328 3300025942 Bacteria 11529
342 Ga0207689_10060961 3300025942 Bacteria 3102
343 Ga0207689_10105631 3300025942 Unclassified 2314
344 Ga0207689_10236303 3300025942 Unclassified 1511
345 Ga0207661_10003828 3300025944 Bacteria 10494
346 Ga0207661_10019884 3300025944 Bacteria 5011
347 Ga0207661_10376785 3300025944 Bacteria 1284
348 Ga0207661_10386385 3300025944 Bacteria 1267
349 Ga0207679_10018757 3300025945 Bacteria 4641
350 Ga0207679_10127423 3300025945 Bacteria 2037
351 Ga0207679_10315388 3300025945 Bacteria 1352
352 Ga0207679_10588106 3300025945 Bacteria 1002
353 Ga0207667_10002727 3300025949 Bacteria 21833
354 Ga0207667_10009633 3300025949 Bacteria 11362
355 Ga0207667_10051993 3300025949 Unclassified 4317
356 Ga0207667_10220092 3300025949 Bacteria 1945
357 Ga0207667_10248395 3300025949 Unclassified 1820
358 Ga0207651_10031839 3300025960 Bacteria 3378
359 Ga0207651_10074114 3300025960 Unclassified 2423
360 Ga0207651_10075993 3300025960 Bacteria 2399
361 Ga0207712_10155966 3300025961 Unclassified 1769
362 Ga0207712_10477434 3300025961 Bacteria 1062
363 Ga0207712_10484664 3300025961 Unclassified 1054
364 Ga0207668_10002394 3300025972 Bacteria 10967
365 Ga0207668_10106693 3300025972 Bacteria 2093
366 Ga0207668_10159789 3300025972 Unclassified 1754
367 Ga0207640_10081060 3300025981 Unclassified 2218
368 Ga0207640_10160611 3300025981 Unclassified 1662
369 Ga0207658_10002313 3300025986 Bacteria 14033
370 Ga0207658_10021227 3300025986 Unclassified 4504
371 Ga0207658_10078929 3300025986 Unclassified 2517
372 Ga0207658_10348517 3300025986 Bacteria 1289
373 Ga0207677_10001760 3300026023 Bacteria 11451
374 Ga0207677_10008527 3300026023 Bacteria 5733
375 Ga0207677_10011790 3300026023 Bacteria 4998
376 Ga0207677_10065782 3300026023 Bacteria 2531
377 Ga0207677_10141694 3300026023 Bacteria 1841
378 Ga0207677_10257042 3300026023 Bacteria 1422
379 Ga0207677_10293908 3300026023 Bacteria 1339
380 Ga0207677_10459095 3300026023 Unclassified 1093
381 Ga0207703_10005846 3300026035 Bacteria 9852
382 Ga0207703_10017794 3300026035 Bacteria 5549
383 Ga0207703_11154284 3300026035 Bacteria 744
384 Ga0207639_10016480 3300026041 Bacteria 5231
385 Ga0207639_10049328 3300026041 Unclassified 3192
386 Ga0207639_10267632 3300026041 Bacteria 1498
387 Ga0207639_10322855 3300026041 Unclassified 1371
388 Ga0207639_10356553 3300026041 Bacteria 1308
389 Ga0207639_10863045 3300026041 Bacteria 845
390 Ga0207678_10019272 3300026067 Bacteria 5992
391 Ga0207678_10502623 3300026067 Bacteria 1057
392 Ga0207702_10025132 3300026078 Unclassified 4942
393 Ga0207702_10437872 3300026078 Bacteria 1266
394 Ga0207641_10021396 3300026088 Bacteria 5315
395 Ga0207641_10062440 3300026088 Unclassified 3179
396 Ga0207641_10397878 3300026088 Bacteria 1322
397 Ga0207641_10616877 3300026088 Bacteria 1063
398 Ga0207641_10676494 3300026088 Bacteria 1015
399 Ga0207648_10000588 3300026089 Bacteria 40775
400 Ga0207648_10011345 3300026089 Bacteria 8399
401 Ga0207648_10013414 3300026089 Bacteria 7626
402 Ga0207648_10021913 3300026089 Bacteria 5740
403 Ga0207676_10001480 3300026095 Bacteria 17399
404 Ga0207676_10006644 3300026095 Bacteria 8175
405 Ga0207676_10009951 3300026095 Bacteria 6763
406 Ga0207676_10095064 3300026095 Bacteria 2457
407 Ga0207676_10117355 3300026095 Bacteria 2238
408 Ga0207674_10001086 3300026116 Bacteria 35383
409 Ga0207674_10013460 3300026116 Bacteria 9074
410 Ga0207674_10073626 3300026116 Bacteria 3429
411 Ga0207674_10298193 3300026116 Unclassified 1561
412 Ga0207675_100151565 3300026118 Unclassified 2207
413 Ga0207683_10002722 3300026121 Bacteria 15435
414 Ga0207683_10013718 3300026121 Bacteria 6908
415 Ga0207683_10396340 3300026121 Bacteria 1270
416 Ga0207683_10568837 3300026121 Unclassified 1048
417 Ga0207698_10076417 3300026142 Unclassified 2680
418 Ga0207698_10822947 3300026142 Unclassified 932
419 Ga0207698_11019527 3300026142 Unclassified 839
420 Ga0207698_11238102 3300026142 Bacteria 761
421 Ga0268266_10000078 3300028379 Bacteria 213632
422 Ga0268266_10004131 3300028379 Bacteria 14025
423 Ga0268266_10070253 3300028379 Unclassified 3034
424 Ga0268265_10016362 3300028380 Bacteria 5093
425 Ga0268265_10410736 3300028380 Unclassified 1254
426 Ga0268264_10011245 3300028381 Bacteria 7396
427 Ga0268264_10056820 3300028381 Bacteria 3272
428 Ga0268264_10099160 3300028381 Bacteria 2528
429 Ga0268264_10441814 3300028381 Bacteria 1258
430 Ga0268264_10469902 3300028381 Unclassified 1222
431 Ga0307517_10001460 3300028786 Bacteria 39582
432 Ga0265338_10237105 3300028800 Bacteria 1353
433 Ga0265327_10109532 3300031251 Unclassified 1322
434 Ga0265313_10120801 3300031595 Bacteria 1143
435 Ga0307510_10005212 3300033180 Bacteria 15447
436 Ga0373937_0057555 3300036401 Bacteria 3572
437 Ga0395898_0192072 3300037466 Bacteria 1951
438 Ga0395905_0002613 3300037471 Bacteria 19818
439 Ga0395901_0040544 3300038443 Bacteria 4823
440 Ga0395901_0184894 3300038443 Bacteria 2186
441 Ga0436365_0314362 3300039437 Unclassified 2708
442 Ga0436365_1474167 3300039437 Viruses 706
443 Ga0436361_0460351 3300039447 Bacteria 15392
444 Ga0466959_0070878 3300045049 Unclassified 2525
445 Ga0495596_0041056 3300046500 Bacteria 1825
446 Ga0495630_0317668 3300046517 Bacteria 1190
447 Ga0495674_0783548 3300047319 Bacteria 743
448 Ga0495672_0011703 3300047320 Bacteria 6171
449 Ga0495672_0206765 3300047320 Unclassified 978
450 Ga0495683_0021861 3300047323 Bacteria 3295
451 Ga0495686_0173051 3300047472 Bacteria 1255
452 Ga0496104_0460820 3300048907 Bacteria 1183
453 Ga0496105_0930451 3300048908 Bacteria 654
454 Ga0496108_0527711 3300048911 Bacteria 1031
455 Ga0496110_0108916 3300048913 Bacteria 2488
456 Ga0496110_0399430 3300048913 Unclassified 1253
457 Ga0496126_0563572 3300048929 Bacteria 902
458 Ga0495682_0079947 3300049460 Bacteria 1176
459 Ga0501037_0044072 3300049573 Unclassified 3278
460 Ga0501070_0249817 3300049586 Bacteria 1451
461 Ga0501044_0288194 3300049823 Bacteria 1574
462 nmdc:mga08y16_418389_c1 3300050511 Bacteria 783
463 Ga0500608_002598 3300053122 Bacteria 6603
464 Ga0070683_100011389
465 rootH1_10159400
466 rootH2_10007197
467 rootH2_10060626
468 rootL2_10020955
469 rootL2_10118237
470 rootH1_10189510
471 JGI25160J50197_1003086
472 Ga0065712_10086636
473 Ga0065712_10453096
474 Ga0065715_10604831
475 Ga0070658_10000058
476 Ga0070658_10006010
477 Ga0070676_10003968
478 Ga0070676_10012233
479 Ga0070676_10112228
480 Ga0070676_10120073
481 Ga0070683_100003637
482 Ga0070683_100011761
483 Ga0070690_100116438
484 Ga0070670_100043906
485 Ga0070670_100045293
486 Ga0070670_100218229
487 Ga0070670_100238498
488 Ga0070670_100539762
489 Ga0070670_100598603
490 Ga0070677_10187865
491 Ga0068869_100022796
492 Ga0068869_100108102
493 Ga0070666_10082386
494 Ga0070666_10097356
495 Ga0070666_10246082
496 Ga0070682_100012589
497 Ga0068868_100002377
498 Ga0068868_100006082
499 Ga0068868_100030882
500 Ga0068868_100060867
501 Ga0068868_100197958
502 Ga0068868_100512961
503 Ga0068868_100934485
504 Ga0070660_100008421
505 Ga0070660_100241267
506 Ga0070689_100067620
507 Ga0070661_100004850
508 Ga0070661_100017287
509 Ga0070661_100137233
510 Ga0070668_100003989
511 Ga0070668_100020319
512 Ga0070668_100122819
513 Ga0070668_100123609
514 Ga0070669_100017599
515 Ga0070675_100007967
516 Ga0070675_100029705
517 Ga0070675_100037525
518 Ga0070675_100495511
519 Ga0070675_100754984
520 Ga0070671_100122136
521 Ga0070674_100812842
522 Ga0070673_100000975
523 Ga0070673_100022478
524 Ga0070673_100086232
525 Ga0070673_101039218
526 Ga0070688_100041176
527 Ga0070659_100020174
528 Ga0070659_100098954
529 Ga0070667_100005944
530 Ga0070667_100007892
531 Ga0070667_100077314
532 Ga0070667_100432405
533 Ga0070667_100438771
534 Ga0070667_100866274
535 Ga0070694_100730845
536 Ga0070678_100002806
537 Ga0070678_100063234
538 Ga0070678_100092093
539 Ga0070662_100025086
540 Ga0070662_100031159
541 Ga0068867_100009398
542 Ga0068867_100048237
543 Ga0068867_100107437
544 Ga0070685_10086696
545 Ga0070685_10485598
546 Ga0070685_10548942
547 Ga0070679_100082378
548 Ga0070679_100400032
549 Ga0070679_100416785
550 Ga0070684_100005417
551 Ga0070684_100006602
552 Ga0070684_100357330
553 Ga0068853_100008443
554 Ga0068853_100013961
555 Ga0068853_100016459
556 Ga0068853_100030370
557 Ga0068853_100036632
558 Ga0068853_100185706
559 Ga0068853_100373741
560 Ga0068853_101054229
561 Ga0068853_101195493
562 Ga0070672_100001245
563 Ga0070672_100085965
564 Ga0070693_100354441
565 Ga0070665_100000003
566 Ga0070665_100003860
567 Ga0068855_100001221
568 Ga0068855_100012811
569 Ga0068855_100013689
570 Ga0068855_100416288
571 Ga0070664_100005718
572 Ga0070664_100026264
573 Ga0070664_100218760
574 Ga0070664_100326510
575 Ga0070664_100622471
576 Ga0068857_100008967
577 Ga0068857_100021942
578 Ga0068857_100162592
579 Ga0068857_101327420
580 Ga0068854_100072267
581 Ga0068854_100080562
582 Ga0068854_100263698
583 Ga0068856_100022578
584 Ga0068856_100218132
585 Ga0068852_100000515
586 Ga0068852_100032375
587 Ga0068852_100877478
588 Ga0068852_101085671
589 Ga0068859_100000006
590 Ga0068859_100065109
591 Ga0068859_100096415
592 Ga0068859_100213396
593 Ga0068864_100002292
594 Ga0068864_100003053
595 Ga0068864_100005461
596 Ga0068864_100111884
597 Ga0068864_100243409
598 Ga0068864_100262867
599 Ga0068866_10117592
600 Ga0068861_100077167
601 Ga0068861_101685915
602 Ga0068851_10207956
603 Ga0068870_10586716
604 Ga0068863_100028915
605 Ga0068863_100335187
606 Ga0068863_101175574
607 Ga0068858_100000396
608 Ga0068858_100002516
609 Ga0068858_100827567
610 Ga0068858_101312555
611 Ga0068860_100001991
612 Ga0068860_100009673
613 Ga0068860_100019654
614 Ga0068860_100145974
615 Ga0068862_100025607
616 Ga0097621_100001004
617 Ga0097621_100007438
618 Ga0097621_100016225
619 Ga0097621_100044051
620 Ga0097621_100427087
621 Ga0068871_100000196
622 Ga0068871_100028609
623 Ga0068871_100035249
624 Ga0068871_100076652
625 Ga0068871_100110843
626 Ga0068871_100332672
627 Ga0068865_100000022
628 Ga0068865_100003608
629 Ga0068865_100018382
630 Ga0068865_101029950
631 Ga0097620_100000006
632 Ga0097620_100065108
633 Ga0097620_100096423
634 Ga0097620_100213388
635 Ga0105240_10061095
636 Ga0105240_10138485
637 Ga0111539_10047822
638 Ga0105245_10018067
639 Ga0105245_10176885
640 Ga0105247_10117582
641 Ga0105243_10003187
642 Ga0105243_10876608
643 Ga0105241_10003858
644 Ga0105241_10006479
645 Ga0105241_10387173
646 Ga0105241_10500651
647 Ga0105241_10711404
648 Ga0105242_10015678
649 Ga0105242_10039819
650 Ga0105242_10079250
651 Ga0105242_10621161
652 Ga0105248_10735834
653 Ga0105237_10001888
654 Ga0105237_10043742
655 Ga0105237_10176561
656 Ga0105237_10460841
657 Ga0105238_10017681
658 Ga0105238_10183666
659 Ga0105249_10303923
660 Ga0105249_10326813
661 Ga0105249_10749090
662 Ga0105249_11430651
663 Ga0105239_10063710
664 Ga0105239_10110971
665 Ga0105239_10224427
666 Ga0105239_10292883
667 Ga0105239_11202991
668 Ga0105246_10117962
669 Ga0157373_10016772
670 Ga0157373_10116744
671 Ga0157373_10301207
672 Ga0157373_10466326
673 Ga0157371_10192065
674 Ga0157371_10827277
675 Ga0157370_10003210
676 Ga0157370_10190487
677 Ga0157369_10110271
678 Ga0157369_10183303
679 Ga0157369_10335449
680 Ga0157374_10006063
681 Ga0157374_10012422
682 Ga0157374_10013240
683 Ga0157374_10040954
684 Ga0157374_10121573
685 Ga0157374_10270325
686 Ga0157378_10001999
687 Ga0157378_10006773
688 Ga0157378_10115411
689 Ga0157378_10167454
690 Ga0157378_10226879
691 Ga0157378_10435979
692 Ga0163162_10000064
693 Ga0163162_10002297
694 Ga0163162_10004331
695 Ga0163162_10022513
696 Ga0163162_10146174
697 Ga0163162_10179881
698 Ga0163162_10313143
699 Ga0163162_10389560
700 Ga0163162_10395437
701 Ga0163162_11601904
702 Ga0157372_10158416
703 Ga0157372_10644121
704 Ga0157372_10798380
705 Ga0157372_11708929
706 Ga0157372_11987543
707 Ga0157375_10002371
708 Ga0157375_10007898
709 Ga0157375_10116710
710 Ga0157375_10347820
711 Ga0157375_10633239
712 Ga0157375_11694199
713 Ga0163163_10000385
714 Ga0163163_10000694
715 Ga0163163_10181167
716 Ga0163163_10662868
717 Ga0163163_10806058
718 Ga0163163_10810163
719 Ga0157380_10971157
720 Ga0157377_10042100
721 Ga0157377_10158135
722 Ga0157377_10672276
723 Ga0157379_10000628
724 Ga0157379_10022898
725 Ga0157379_10261363
726 Ga0157379_10576755
727 Ga0157379_11322324
728 Ga0157376_10002580
729 Ga0157376_10131698
730 Ga0157376_10444557
731 Ga0157376_10749291
732 Ga0157376_11259627
733 Ga0163161_10034330
734 Ga0163161_10043353
735 Ga0163161_10470724
736 Ga0163161_10635669
737 Ga0213872_10003463
738 Ga0213876_10041861
739 Ga0207426_1000105
740 Ga0207656_10442263
741 Ga0207642_10472691
742 Ga0207688_10059443
743 Ga0207680_10060010
744 Ga0207680_10346980
745 Ga0207647_10018935
746 Ga0207647_10068262
747 Ga0207645_10000613
748 Ga0207645_10004380
749 Ga0207645_10004901
750 Ga0207645_10008717
751 Ga0207645_10184366
752 Ga0207645_10421388
753 Ga0207643_10015310
754 Ga0207643_10096727
755 Ga0207705_10000090
756 Ga0207705_10285027
757 Ga0207654_10057061
758 Ga0207654_10161686
759 Ga0207654_10253395
760 Ga0207695_10075788
761 Ga0207695_10249014
762 Ga0207671_10000799
763 Ga0207671_10045031
764 Ga0207671_10066417
765 Ga0207660_10152156
766 Ga0207657_10011327
767 Ga0207649_10004576
768 Ga0207649_10036949
769 Ga0207649_10111543
770 Ga0207652_10032836
771 Ga0207652_10125637
772 Ga0207694_10012221
773 Ga0207694_10294158
774 Ga0207650_10051937
775 Ga0207650_10166069
776 Ga0207650_10242480
777 Ga0207650_10259576
778 Ga0207659_10049078
779 Ga0207659_10059776
780 Ga0207659_10072474
781 Ga0207659_10193782
782 Ga0207659_10277146
783 Ga0207659_10670781
784 Ga0207687_10453249
785 Ga0207690_10115146
786 Ga0207706_10006551
787 Ga0207706_10019620
788 Ga0207706_10025599
789 Ga0207686_10333640
790 Ga0207686_10373082
791 Ga0207686_10396197
792 Ga0207686_10564131
793 Ga0207709_10007759
794 Ga0207670_10023584
795 Ga0207669_10168919
796 Ga0207704_10000011
797 Ga0207704_10011245
798 Ga0207704_10013018
799 Ga0207704_10325152
800 Ga0207691_10015798
801 Ga0207691_10016919
802 Ga0207691_10465329
803 Ga0207691_10560363
804 Ga0207689_10005328
805 Ga0207689_10060961
806 Ga0207689_10105631
807 Ga0207689_10236303
808 Ga0207661_10003828
809 Ga0207661_10019884
810 Ga0207661_10376785
811 Ga0207661_10386385
812 Ga0207679_10018757
813 Ga0207679_10127423
814 Ga0207679_10315388
815 Ga0207679_10588106
816 Ga0207667_10002727
817 Ga0207667_10009633
818 Ga0207667_10051993
819 Ga0207667_10220092
820 Ga0207667_10248395
821 Ga0207651_10031839
822 Ga0207651_10074114
823 Ga0207651_10075993
824 Ga0207712_10155966
825 Ga0207712_10477434
826 Ga0207712_10484664
827 Ga0207668_10002394
828 Ga0207668_10106693
829 Ga0207668_10159789
830 Ga0207640_10081060
831 Ga0207640_10160611
832 Ga0207658_10002313
833 Ga0207658_10021227
834 Ga0207658_10078929
835 Ga0207658_10348517
836 Ga0207677_10001760
837 Ga0207677_10008527
838 Ga0207677_10011790
839 Ga0207677_10065782
840 Ga0207677_10141694
841 Ga0207677_10257042
842 Ga0207677_10293908
843 Ga0207677_10459095
844 Ga0207703_10005846
845 Ga0207703_10017794
846 Ga0207703_11154284
847 Ga0207639_10016480
848 Ga0207639_10049328
849 Ga0207639_10267632
850 Ga0207639_10322855
851 Ga0207639_10356553
852 Ga0207639_10863045
853 Ga0207678_10019272
854 Ga0207678_10502623
855 Ga0207702_10025132
856 Ga0207702_10437872
857 Ga0207641_10021396
858 Ga0207641_10062440
859 Ga0207641_10397878
860 Ga0207641_10616877
861 Ga0207641_10676494
862 Ga0207648_10000588
863 Ga0207648_10011345
864 Ga0207648_10013414
865 Ga0207648_10021913
866 Ga0207676_10001480
867 Ga0207676_10006644
868 Ga0207676_10009951
869 Ga0207676_10095064
870 Ga0207676_10117355
871 Ga0207674_10001086
872 Ga0207674_10013460
873 Ga0207674_10073626
874 Ga0207674_10298193
875 Ga0207675_100151565
876 Ga0207683_10002722
877 Ga0207683_10013718
878 Ga0207683_10396340
879 Ga0207683_10568837
880 Ga0207698_10076417
881 Ga0207698_10822947
882 Ga0207698_11019527
883 Ga0207698_11238102
884 Ga0268266_10000078
885 Ga0268266_10004131
886 Ga0268266_10070253
887 Ga0268265_10016362
888 Ga0268265_10410736
889 Ga0268264_10011245
890 Ga0268264_10056820
891 Ga0268264_10099160
892 Ga0268264_10441814
893 Ga0268264_10469902
894 Ga0307517_10001460
895 Ga0265338_10237105
896 Ga0265327_10109532
897 Ga0265313_10120801
898 Ga0307510_10005212
899 Ga0373937_0057555
900 Ga0395898_0192072
901 Ga0395905_0002613
902 Ga0395901_0040544
903 Ga0395901_0184894
904 Ga0436365_0314362
905 Ga0436365_1474167
906 Ga0436361_0460351
907 Ga0466959_0070878
908 Ga0495596_0041056
909 Ga0495630_0317668
910 Ga0495674_0783548
911 Ga0495672_0011703
912 Ga0495672_0206765
913 Ga0495683_0021861
914 Ga0495686_0173051
915 Ga0496104_0460820
916 Ga0496105_0930451
917 Ga0496108_0527711
918 Ga0496110_0108916
919 Ga0496110_0399430
920 Ga0496126_0563572
921 Ga0495682_0079947
922 Ga0501037_0044072
923 Ga0501070_0249817
924 Ga0501044_0288194
925 nmdc:mga08y16_418389_c1
926 Ga0500608_002598

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

75

155

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2prr-assembly1.cif.gz_E crystal structure of alkylhydroperoxidase ahpd core: uncharacterized peroxidase-related protein (yp_296737.1) from ralstonia eutropha jmp134 at 2.15 a resolution 0.9066 10 165
2pfx-assembly1.cif.gz_A crystal structure of uncharacterized peroxidase-related protein (yp_614459.1) from silicibacter sp. tm1040 at 1.70 a resolution 0.8963 11 164
3c1l-assembly1.cif.gz_B crystal structure of an antioxidant defense protein (mlr4105) from mesorhizobium loti maff303099 at 2.00 a resolution 0.8869 10 164
3c1l-assembly2.cif.gz_J crystal structure of an antioxidant defense protein (mlr4105) from mesorhizobium loti maff303099 at 2.00 a resolution 0.8808 11 164
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.871 20 151
ID Description Score Start End Superfamily
2prrB02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8824 41 164 1.20.1290.10
2oyoB02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8751 41 164 1.20.1290.10
3c1lB02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8624 41 164 1.20.1290.10
2ijcF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8571 16 157 1.20.1290.10
2prrB02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8557 41 164 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A3E1NH92-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9931 1 185 GO:0051920
AF-A0A1V5QXN1-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9874 1 175 GO:0051920
AF-A0A816HC44-F1-model_v4 Uncharacterized protein 0.9873 65 175
AF-A0A2N9MA02-F1-model_v4 Peroxidase family protein 0.9845 1 175 GO:0051920
AF-A0A7W8N1A6-F1-model_v4 deleted 0.9815 1 179

Map