F449062

General Info

Members Datasets Scaffolds Average Seq Length
463 261 926 180

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10044476|Ga0070710_100444762
Length 204
Sequence MLWEFRPFFCNLIKHEFLQQFTSGVMLLYMPFPRPKKTDSQDVLYEYAVGALARRMRSVAELKRLLRPRVEADTEYGKTLVELVIRRLKDQGYLNDAKYATAFSSFRRDNEKFGRRRVVTDLKAKGVHAEVIDQAVDSNEEQQARDYLRRKRLKKPSNQKEAARVFRQLMRGGFAAKTIFAILKKWEVDDETLQVLEGELESSS

Samples

Sample ID Description Type Environment
1 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
90 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
119 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
122 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
123 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
194 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
199 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
200 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
201 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
202 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
203 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
205 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
207 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
208 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
209 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
210 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
211 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
212 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
214 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
220 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
221 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
222 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
223 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
224 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
225 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
226 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
229 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
230 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
234 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
235 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
238 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
239 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
240 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
257 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 1.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.4
Rhizosphere 92.66
Stem 0
Stem Tuber 0
Unclassified 16.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070710_10044476 3300005437 Bacteria 2464
2 MBSR1b_contig_5770676 2162886012 Bacteria 907
3 JGI24746J21847_1046699 3300001977 Unclassified 606
4 JGI24743J22301_10038668 3300001991 Bacteria 954
5 JGI24034J26672_10008753 3300002239 Bacteria 1483
6 JGI24751J29686_10007208 3300002459 Bacteria 2272
7 Ga0065712_10023542 3300005290 Bacteria 1887
8 Ga0065712_10140535 3300005290 Bacteria 1454
9 Ga0065715_10177074 3300005293 Bacteria 1490
10 Ga0070676_10001510 3300005328 Bacteria 11768
11 Ga0070676_10020234 3300005328 Unclassified 3712
12 Ga0070683_100002406 3300005329 Bacteria 14859
13 Ga0070683_100037246 3300005329 Bacteria 4452
14 Ga0070690_100051607 3300005330 Bacteria 2626
15 Ga0070670_100050557 3300005331 Bacteria 3571
16 Ga0070677_10171511 3300005333 Bacteria 1026
17 Ga0068869_100019584 3300005334 Bacteria 4627
18 Ga0068869_100046270 3300005334 Bacteria 3137
19 Ga0070666_10147649 3300005335 Bacteria 1639
20 Ga0070680_100569321 3300005336 Unclassified 971
21 Ga0070682_100036060 3300005337 Bacteria 3022
22 Ga0070682_100270729 3300005337 Unclassified 1234
23 Ga0068868_100006208 3300005338 Bacteria 8452
24 Ga0068868_100068411 3300005338 Bacteria 2828
25 Ga0070660_100073188 3300005339 Bacteria 2679
26 Ga0070689_100000465 3300005340 Bacteria 23884
27 Ga0070689_100025088 3300005340 Unclassified 4477
28 Ga0070691_10050103 3300005341 Bacteria 1992
29 Ga0070687_100010732 3300005343 Bacteria 3978
30 Ga0070661_100002139 3300005344 Bacteria 13614
31 Ga0070692_10027279 3300005345 Bacteria 2829
32 Ga0070692_10155751 3300005345 Bacteria 1305
33 Ga0070668_100006832 3300005347 Bacteria 8457
34 Ga0070668_100064816 3300005347 Bacteria 2833
35 Ga0070669_100015306 3300005353 Bacteria 5465
36 Ga0070669_100041577 3300005353 Bacteria 3343
37 Ga0070675_100001737 3300005354 Bacteria 16089
38 Ga0070673_100000350 3300005364 Bacteria 24283
39 Ga0070688_100019495 3300005365 Bacteria 3930
40 Ga0070659_100008565 3300005366 Bacteria 7477
41 Ga0070659_100017944 3300005366 Bacteria 5332
42 Ga0070667_100028136 3300005367 Unclassified 4678
43 Ga0070667_100745708 3300005367 Archaea 907
44 Ga0070709_10000563 3300005434 Bacteria 21656
45 Ga0070709_10019292 3300005434 Bacteria 3939
46 Ga0070709_10020537 3300005434 Bacteria 3833
47 Ga0070709_10069158 3300005434 Bacteria 2273
48 Ga0070709_10469271 3300005434 Unclassified 951
49 Ga0070709_10524423 3300005434 Bacteria 903
50 Ga0070714_100033896 3300005435 Bacteria 4274
51 Ga0070714_100135786 3300005435 Bacteria 2202
52 Ga0070714_100274667 3300005435 Bacteria 1564
53 Ga0070714_100996328 3300005435 Unclassified 815
54 Ga0070713_100000021 3300005436 Bacteria 107806
55 Ga0070713_100010406 3300005436 Bacteria 6717
56 Ga0070713_100385877 3300005436 Bacteria 1306
57 Ga0070713_100445837 3300005436 Bacteria 1215
58 Ga0070713_100787588 3300005436 Bacteria 911
59 Ga0070713_100972818 3300005436 Unclassified 818
60 Ga0070710_10066809 3300005437 Unclassified 2062
61 Ga0070701_10019993 3300005438 Bacteria 3171
62 Ga0070711_100000077 3300005439 Bacteria 54563
63 Ga0070711_100001080 3300005439 Bacteria 14559
64 Ga0070711_100073726 3300005439 Unclassified 2413
65 Ga0070711_100842183 3300005439 Bacteria 780
66 Ga0070700_100021477 3300005441 Bacteria 3753
67 Ga0070708_100111239 3300005445 Bacteria 2518
68 Ga0070708_100244314 3300005445 Bacteria 1686
69 Ga0070708_100605664 3300005445 Unclassified 1033
70 Ga0070663_100003567 3300005455 Bacteria 8986
71 Ga0070663_100081149 3300005455 Bacteria 2383
72 Ga0070678_100002935 3300005456 Bacteria 9450
73 Ga0070678_100413887 3300005456 Bacteria 1174
74 Ga0070662_100002160 3300005457 Bacteria 12043
75 Ga0070662_100035908 3300005457 Bacteria 3503
76 Ga0068867_100019947 3300005459 Unclassified 4777
77 Ga0068867_100026112 3300005459 Bacteria 4192
78 Ga0068867_100580604 3300005459 Unclassified 975
79 Ga0070685_10003352 3300005466 Bacteria 8152
80 Ga0070706_100000791 3300005467 Bacteria 35363
81 Ga0070706_100068918 3300005467 Bacteria 3271
82 Ga0070706_100079557 3300005467 Bacteria 3034
83 Ga0070706_100422601 3300005467 Unclassified 1240
84 Ga0070707_100111961 3300005468 Bacteria 2647
85 Ga0070707_100128299 3300005468 Bacteria 2465
86 Ga0070707_100740794 3300005468 Unclassified 946
87 Ga0070698_100093985 3300005471 Bacteria 2978
88 Ga0070698_100192699 3300005471 Bacteria 1975
89 Ga0070698_100550759 3300005471 Unclassified 1093
90 Ga0070699_100178436 3300005518 Bacteria 1884
91 Ga0070679_100027072 3300005530 Bacteria 5638
92 Ga0070679_100263451 3300005530 Bacteria 1679
93 Ga0070679_100274465 3300005530 Bacteria 1639
94 Ga0070684_100000713 3300005535 Bacteria 23014
95 Ga0070684_100028627 3300005535 Bacteria 4714
96 Ga0070697_100000724 3300005536 Bacteria 24575
97 Ga0070697_100013641 3300005536 Bacteria 6374
98 Ga0070697_100035453 3300005536 Bacteria 4024
99 Ga0070697_100260432 3300005536 Bacteria 1485
100 Ga0070697_100486140 3300005536 Bacteria 1078
101 Ga0070697_100545437 3300005536 Bacteria 1017
102 Ga0068853_100023880 3300005539 Bacteria 5124
103 Ga0068853_100026145 3300005539 Bacteria 4900
104 Ga0070672_100026956 3300005543 Bacteria 4283
105 Ga0070686_100018690 3300005544 Bacteria 4074
106 Ga0070695_100287494 3300005545 Bacteria 1210
107 Ga0070696_100030322 3300005546 Bacteria 3702
108 Ga0070693_100126926 3300005547 Bacteria 1589
109 Ga0070665_100043267 3300005548 Unclassified 4525
110 Ga0070704_100187922 3300005549 Bacteria 1658
111 Ga0068855_100264859 3300005563 Bacteria 1913
112 Ga0070664_100023322 3300005564 Bacteria 5110
113 Ga0070664_100051388 3300005564 Unclassified 3490
114 Ga0068857_100000378 3300005577 Bacteria 31224
115 Ga0068854_100008282 3300005578 Bacteria 6673
116 Ga0068856_100059910 3300005614 Bacteria 3760
117 Ga0068856_100081779 3300005614 Bacteria 3205
118 Ga0068856_100164113 3300005614 Bacteria 2232
119 Ga0070702_100016654 3300005615 Bacteria 3775
120 Ga0068852_100042261 3300005616 Bacteria 3858
121 Ga0068852_100043654 3300005616 Unclassified 3804
122 Ga0068852_100175998 3300005616 Bacteria 2009
123 Ga0068859_100008838 3300005617 Bacteria 10174
124 Ga0068859_100046558 3300005617 Bacteria 4355
125 Ga0068864_100003254 3300005618 Bacteria 13427
126 Ga0068864_100073776 3300005618 Bacteria 2975
127 Ga0068866_10011386 3300005718 Bacteria 3847
128 Ga0068866_10127448 3300005718 Bacteria 1442
129 Ga0068861_100003528 3300005719 Bacteria 10398
130 Ga0068851_10001087 3300005834 Bacteria 11790
131 Ga0068870_10000523 3300005840 Bacteria 14440
132 Ga0068863_100043540 3300005841 Bacteria 4261
133 Ga0068858_100059982 3300005842 Bacteria 3516
134 Ga0068858_100089991 3300005842 Bacteria 2856
135 Ga0068860_100052143 3300005843 Bacteria 3891
136 Ga0068860_100053084 3300005843 Bacteria 3854
137 Ga0068862_100008847 3300005844 Bacteria 8335
138 Ga0070717_10013699 3300006028 Bacteria 6221
139 Ga0070717_10076431 3300006028 Bacteria 2803
140 Ga0070717_10142935 3300006028 Bacteria 2065
141 Ga0070717_10178271 3300006028 Bacteria 1851
142 Ga0070717_10244025 3300006028 Bacteria 1585
143 Ga0070717_10300096 3300006028 Bacteria 1428
144 Ga0070717_10490984 3300006028 Unclassified 1109
145 Ga0070715_10002364 3300006163 Bacteria 5777
146 Ga0070715_10008179 3300006163 Bacteria 3635
147 Ga0070715_10011007 3300006163 Bacteria 3243
148 Ga0070716_100013991 3300006173 Unclassified 4103
149 Ga0070716_100151293 3300006173 Unclassified 1493
150 Ga0070716_100669073 3300006173 Bacteria 789
151 Ga0070712_100000947 3300006175 Bacteria 17441
152 Ga0070712_100001223 3300006175 Bacteria 15553
153 Ga0097621_100023784 3300006237 Bacteria 4774
154 Ga0097621_100086373 3300006237 Bacteria 2618
155 Ga0097621_100978562 3300006237 Archaea 791
156 Ga0068871_100042870 3300006358 Unclassified 3635
157 Ga0068871_100122905 3300006358 Bacteria 2194
158 Ga0075433_10027585 3300006852 Bacteria 4818
159 Ga0075434_100000423 3300006871 Bacteria 31288
160 Ga0075434_100399575 3300006871 Bacteria 1395
161 Ga0068865_100029737 3300006881 Bacteria 3628
162 Ga0068865_100060214 3300006881 Unclassified 2657
163 Ga0075436_100007787 3300006914 Bacteria 7327
164 Ga0075436_100043662 3300006914 Unclassified 3091
165 Ga0075436_100049070 3300006914 Bacteria 2913
166 Ga0097620_100008838 3300006931 Bacteria 10174
167 Ga0097620_100046558 3300006931 Bacteria 4355
168 Ga0075435_100183653 3300007076 Unclassified 1768
169 Ga0075435_100350078 3300007076 Bacteria 1266
170 Ga0099794_10127836 3300007265 Unclassified 1282
171 Ga0099795_10084767 3300007788 Bacteria 1218
172 Ga0105250_10018587 3300009092 Bacteria 2814
173 Ga0105250_10125557 3300009092 Bacteria 1057
174 Ga0105240_10700412 3300009093 Bacteria 1106
175 Ga0105240_10813547 3300009093 Bacteria 1011
176 Ga0105240_11065191 3300009093 Bacteria 862
177 Ga0105245_10026366 3300009098 Bacteria 5115
178 Ga0105245_10065902 3300009098 Unclassified 3276
179 Ga0105247_10030626 3300009101 Bacteria 3261
180 Ga0105247_10081104 3300009101 Bacteria 2045
181 Ga0105243_10074548 3300009148 Bacteria 2753
182 Ga0105241_10001811 3300009174 Bacteria 16223
183 Ga0105241_10126276 3300009174 Bacteria 2066
184 Ga0105241_10307251 3300009174 Bacteria 1363
185 Ga0105241_10414266 3300009174 Unclassified 1184
186 Ga0105241_10599083 3300009174 Unclassified 995
187 Ga0105241_10926592 3300009174 Unclassified 811
188 Ga0105242_10005608 3300009176 Bacteria 9685
189 Ga0105242_10058794 3300009176 Unclassified 3153
190 Ga0105248_10060457 3300009177 Unclassified 4254
191 Ga0105248_10103967 3300009177 Bacteria 3201
192 Ga0105237_10036000 3300009545 Bacteria 5007
193 Ga0105237_10210127 3300009545 Bacteria 1946
194 Ga0105237_10237184 3300009545 Bacteria 1825
195 Ga0105237_10890574 3300009545 Unclassified 897
196 Ga0105238_10031850 3300009551 Bacteria 5365
197 Ga0105238_10046656 3300009551 Bacteria 4371
198 Ga0105238_10380120 3300009551 Bacteria 1404
199 Ga0105238_10598173 3300009551 Bacteria 1111
200 Ga0105249_10024966 3300009553 Bacteria 5377
201 Ga0105249_10025360 3300009553 Bacteria 5336
202 Ga0105249_12478934 3300009553 Unclassified 591
203 Ga0099796_10288487 3300010159 Bacteria 692
204 Ga0105239_10083787 3300010375 Bacteria 3512
205 Ga0105246_10007167 3300011119 Bacteria 6831
206 Ga0105246_10155281 3300011119 Bacteria 1737
207 Ga0157373_10018484 3300013100 Bacteria 5074
208 Ga0157373_10019275 3300013100 Bacteria 4969
209 Ga0157373_10135143 3300013100 Bacteria 1734
210 Ga0157371_10005929 3300013102 Bacteria 10204
211 Ga0157370_10015145 3300013104 Bacteria 7855
212 Ga0157370_10274444 3300013104 Bacteria 1558
213 Ga0157370_10291089 3300013104 Bacteria 1508
214 Ga0157370_10553883 3300013104 Bacteria 1054
215 Ga0157370_10730161 3300013104 Bacteria 903
216 Ga0157370_11434700 3300013104 Unclassified 621
217 Ga0157369_10019384 3300013105 Bacteria 7610
218 Ga0157369_10023375 3300013105 Bacteria 6884
219 Ga0157369_10058737 3300013105 Bacteria 4149
220 Ga0157369_10593009 3300013105 Unclassified 1144
221 Ga0157374_10059869 3300013296 Bacteria 3562
222 Ga0157374_11804794 3300013296 Unclassified 637
223 Ga0157374_11804799 3300013296 Bacteria 637
224 Ga0157378_10680877 3300013297 Unclassified 1046
225 Ga0163162_10006283 3300013306 Bacteria 11506
226 Ga0163162_10391513 3300013306 Bacteria 1522
227 Ga0157372_10080149 3300013307 Unclassified 3693
228 Ga0157375_10055527 3300013308 Bacteria 3906
229 Ga0163163_10001562 3300014325 Bacteria 19327
230 Ga0157380_10072181 3300014326 Bacteria 2795
231 Ga0157379_10090205 3300014968 Bacteria 2750
232 Ga0157376_10033303 3300014969 Bacteria 4147
233 Ga0157376_10233299 3300014969 Unclassified 1710
234 Ga0163161_10074298 3300017792 Bacteria 2492
235 Ga0213873_10026224 3300021358 Bacteria 1414
236 Ga0213874_10003363 3300021377 Bacteria 3540
237 Ga0213876_10070831 3300021384 Bacteria 1842
238 Ga0224570_100741 3300022730 Bacteria 2606
239 Ga0224572_1012786 3300024225 Bacteria 1599
240 Ga0228598_1000330 3300024227 Bacteria 9274
241 Ga0228598_1003018 3300024227 Bacteria 3648
242 Ga0207692_10013019 3300025898 Bacteria 3595
243 Ga0207692_10252842 3300025898 Bacteria 1057
244 Ga0207692_10340079 3300025898 Bacteria 923
245 Ga0207642_10170080 3300025899 Unclassified 1178
246 Ga0207710_10368495 3300025900 Unclassified 734
247 Ga0207688_10008630 3300025901 Bacteria 5549
248 Ga0207680_10049940 3300025903 Bacteria 2493
249 Ga0207680_10296521 3300025903 Bacteria 1126
250 Ga0207647_10034426 3300025904 Bacteria 3233
251 Ga0207685_10012273 3300025905 Unclassified 2609
252 Ga0207685_10016999 3300025905 Bacteria 2340
253 Ga0207699_10006450 3300025906 Bacteria 5682
254 Ga0207699_10015625 3300025906 Bacteria 3948
255 Ga0207699_10100876 3300025906 Bacteria 1832
256 Ga0207699_10680267 3300025906 Unclassified 752
257 Ga0207645_10000173 3300025907 Bacteria 51615
258 Ga0207645_10013591 3300025907 Bacteria 5481
259 Ga0207643_10001062 3300025908 Bacteria 16248
260 Ga0207705_10123756 3300025909 Bacteria 1921
261 Ga0207684_10003547 3300025910 Bacteria 15206
262 Ga0207684_10033092 3300025910 Bacteria 4397
263 Ga0207654_10019182 3300025911 Bacteria 3605
264 Ga0207654_10352291 3300025911 Bacteria 1014
265 Ga0207707_10325172 3300025912 Bacteria 1327
266 Ga0207695_10006689 3300025913 Bacteria 14874
267 Ga0207695_10127032 3300025913 Bacteria 2511
268 Ga0207671_10125220 3300025914 Bacteria 1968
269 Ga0207693_10000047 3300025915 Bacteria 100876
270 Ga0207693_10003397 3300025915 Bacteria 13604
271 Ga0207663_10012426 3300025916 Bacteria 4604
272 Ga0207663_10106539 3300025916 Unclassified 1895
273 Ga0207660_10257373 3300025917 Unclassified 1379
274 Ga0207660_10684626 3300025917 Bacteria 836
275 Ga0207662_10006209 3300025918 Bacteria 6435
276 Ga0207657_10000361 3300025919 Bacteria 48111
277 Ga0207657_10007319 3300025919 Bacteria 11322
278 Ga0207649_10011330 3300025920 Bacteria 4914
279 Ga0207649_10018455 3300025920 Unclassified 3968
280 Ga0207652_10058500 3300025921 Bacteria 3321
281 Ga0207652_10402451 3300025921 Unclassified 1235
282 Ga0207646_10027005 3300025922 Bacteria 5234
283 Ga0207646_10136265 3300025922 Bacteria 2211
284 Ga0207646_11165688 3300025922 Bacteria 676
285 Ga0207681_10008655 3300025923 Bacteria 6215
286 Ga0207694_10037931 3300025924 Bacteria 3704
287 Ga0207694_10479491 3300025924 Bacteria 1040
288 Ga0207650_10000024 3300025925 Bacteria 299184
289 Ga0207659_10014160 3300025926 Bacteria 5136
290 Ga0207687_10020561 3300025927 Unclassified 4380
291 Ga0207700_10000682 3300025928 Bacteria 19775
292 Ga0207700_10024077 3300025928 Bacteria 4209
293 Ga0207700_10090597 3300025928 Bacteria 2414
294 Ga0207700_10173204 3300025928 Bacteria 1802
295 Ga0207664_10000282 3300025929 Bacteria 38631
296 Ga0207664_10101520 3300025929 Bacteria 2377
297 Ga0207664_10342874 3300025929 Bacteria 1321
298 Ga0207644_10065495 3300025931 Bacteria 2642
299 Ga0207690_10402907 3300025932 Bacteria 1091
300 Ga0207690_10501060 3300025932 Bacteria 982
301 Ga0207706_10000422 3300025933 Bacteria 45508
302 Ga0207706_10000578 3300025933 Bacteria 39082
303 Ga0207686_10006886 3300025934 Bacteria 6120
304 Ga0207686_10079266 3300025934 Unclassified 2138
305 Ga0207686_10130747 3300025934 Bacteria 1721
306 Ga0207709_10236339 3300025935 Bacteria 1327
307 Ga0207670_10005532 3300025936 Bacteria 6944
308 Ga0207669_10184877 3300025937 Unclassified 1498
309 Ga0207665_10012129 3300025939 Bacteria 5656
310 Ga0207665_10053168 3300025939 Bacteria 2730
311 Ga0207665_10059964 3300025939 Bacteria 2576
312 Ga0207665_10110618 3300025939 Unclassified 1930
313 Ga0207665_10239037 3300025939 Unclassified 1338
314 Ga0207691_10000072 3300025940 Bacteria 83580
315 Ga0207711_10004372 3300025941 Bacteria 12053
316 Ga0207711_10027791 3300025941 Bacteria 4754
317 Ga0207689_10001329 3300025942 Bacteria 23863
318 Ga0207689_10032651 3300025942 Bacteria 4328
319 Ga0207661_10000062 3300025944 Bacteria 75988
320 Ga0207661_10087223 3300025944 Bacteria 2591
321 Ga0207661_10436762 3300025944 Bacteria 1191
322 Ga0207679_10000040 3300025945 Bacteria 127317
323 Ga0207667_10444862 3300025949 Bacteria 1317
324 Ga0207651_10000453 3300025960 Bacteria 17310
325 Ga0207712_10240868 3300025961 Archaea 1457
326 Ga0207668_10042640 3300025972 Bacteria 3074
327 Ga0207668_10062036 3300025972 Bacteria 2631
328 Ga0207640_10011374 3300025981 Bacteria 5038
329 Ga0207640_10354062 3300025981 Bacteria 1180
330 Ga0207658_10015101 3300025986 Bacteria 5296
331 Ga0207677_10004507 3300026023 Bacteria 7490
332 Ga0207677_10661298 3300026023 Unclassified 923
333 Ga0207703_10016369 3300026035 Bacteria 5780
334 Ga0207703_10409055 3300026035 Bacteria 1260
335 Ga0207639_10164367 3300026041 Bacteria 1873
336 Ga0207639_10598538 3300026041 Bacteria 1016
337 Ga0207639_11147109 3300026041 Unclassified 729
338 Ga0207678_10000208 3300026067 Bacteria 51930
339 Ga0207678_10005233 3300026067 Bacteria 11624
340 Ga0207702_10026514 3300026078 Bacteria 4811
341 Ga0207702_10064081 3300026078 Unclassified 3145
342 Ga0207702_10161153 3300026078 Bacteria 2048
343 Ga0207702_10214634 3300026078 Unclassified 1790
344 Ga0207641_10000030 3300026088 Bacteria 224468
345 Ga0207648_10000303 3300026089 Bacteria 53727
346 Ga0207648_10051252 3300026089 Bacteria 3607
347 Ga0207648_10549314 3300026089 Bacteria 1061
348 Ga0207676_10000134 3300026095 Bacteria 65594
349 Ga0207676_10514718 3300026095 Bacteria 1138
350 Ga0207674_10000069 3300026116 Bacteria 106470
351 Ga0207674_10007171 3300026116 Bacteria 13019
352 Ga0207675_100043208 3300026118 Bacteria 4209
353 Ga0207683_10000186 3300026121 Bacteria 53265
354 Ga0207698_10019837 3300026142 Unclassified 4613
355 Ga0207698_10429060 3300026142 Bacteria 1270
356 Ga0265356_1018829 3300028017 Unclassified 746
357 Ga0268266_10019454 3300028379 Bacteria 5783
358 Ga0268266_10100387 3300028379 Bacteria 2549
359 Ga0268265_10005761 3300028380 Bacteria 8458
360 Ga0268264_10032392 3300028381 Bacteria 4288
361 Ga0268264_10114099 3300028381 Bacteria 2371
362 Ga0265770_1005062 3300030878 Bacteria 1809
363 Ga0265770_1029549 3300030878 Bacteria 911
364 Ga0265765_1038161 3300030879 Unclassified 632
365 Ga0265760_10001124 3300031090 Bacteria 7773
366 Ga0265760_10012091 3300031090 Bacteria 2467
367 Ga0265325_10322555 3300031241 Unclassified 686
368 Ga0265331_10067975 3300031250 Bacteria 1671
369 Ga0265316_10059560 3300031344 Bacteria 2969
370 Ga0265314_10051777 3300031711 Bacteria 2858
371 Ga0307416_100796703 3300032002 Bacteria 1040
372 Ga0316212_1019153 3300033547 Bacteria 961
373 Ga0373958_0107873 3300034819 Unclassified 661
374 Ga0373926_0131593 3300035083 Bacteria 947
375 Ga0373929_0010460 3300035085 Bacteria 1735
376 Ga0373934_0030734 3300035086 Bacteria 2101
377 Ga0373923_0034247 3300035111 Bacteria 2060
378 Ga0373932_0224379 3300035112 Unclassified 676
379 Ga0373936_0000877 3300035113 Bacteria 10729
380 Ga0373941_0106984 3300035115 Bacteria 981
381 Ga0373953_0255142 3300035117 Bacteria 762
382 Ga0373954_0382512 3300035118 Bacteria 695
383 Ga0373943_0000242 3300035170 Bacteria 22548
384 Ga0373943_0095645 3300035170 Bacteria 1545
385 Ga0373942_0127279 3300035207 Bacteria 801
386 Ga0373962_0093170 3300035242 Bacteria 931
387 Ga0373924_0019793 3300035410 Bacteria 2610
388 Ga0373924_0057795 3300035410 Bacteria 1618
389 Ga0373931_0101537 3300035691 Bacteria 1618
390 Ga0373931_0523708 3300035691 Unclassified 767
391 Ga0373935_0005596 3300035692 Bacteria 7410
392 Ga0373927_0000240 3300035695 Bacteria 43006
393 Ga0373933_0119649 3300035724 Bacteria 1648
394 Ga0373947_0000384 3300035725 Bacteria 24915
395 Ga0373925_0002108 3300037068 Bacteria 16330
396 Ga0395898_0064172 3300037466 Bacteria 3562
397 Ga0436365_0904862 3300039437 Bacteria 2487
398 Ga0436365_1032470 3300039437 Unclassified 968
399 Ga0436363_0017403 3300039450 Bacteria 889
400 Ga0436363_0160329 3300039450 Bacteria 3319
401 Ga0436363_1097442 3300039450 Bacteria 5667
402 Ga0436363_1326637 3300039450 Unclassified 583
403 Ga0436362_0200137 3300039453 Bacteria 4056
404 Ga0436362_0819142 3300039453 Bacteria 5428
405 Ga0466963_0052764 3300044694 Unclassified 2699
406 Ga0466963_0751288 3300044694 Bacteria 688
407 Ga0466968_0115445 3300044735 Bacteria 1211
408 Ga0466957_0000242 3300044842 Bacteria 26107
409 Ga0466957_0117360 3300044842 Unclassified 1694
410 Ga0451576_0191580 3300045051 Bacteria 2136
411 Ga0466967_0013528 3300045976 Bacteria 6310
412 Ga0466967_0452177 3300045976 Bacteria 1255
413 Ga0466967_1616603 3300045976 Unclassified 645
414 Ga0495629_0162069 3300046459 Bacteria 1553
415 Ga0495580_0002357 3300046472 Bacteria 16495
416 Ga0495580_0056782 3300046472 Bacteria 2756
417 Ga0495580_0175191 3300046472 Bacteria 1482
418 Ga0495582_0012419 3300046473 Bacteria 4693
419 Ga0495582_0041507 3300046473 Bacteria 2535
420 Ga0495664_0047753 3300046477 Bacteria 2541
421 Ga0495628_0199050 3300046516 Bacteria 1510
422 Ga0495646_0419997 3300046680 Unclassified 693
423 Ga0495647_0248862 3300046681 Bacteria 791
424 Ga0495669_0210315 3300046684 Bacteria 931
425 Ga0495613_0122221 3300046689 Bacteria 1869
426 Ga0495624_0099826 3300046690 Bacteria 1787
427 Ga0495604_0312358 3300047317 Bacteria 1053
428 Ga0495674_0182940 3300047319 Bacteria 1745
429 Ga0495676_0344095 3300047321 Unclassified 998
430 Ga0495602_0276595 3300048088 Bacteria 1239
431 Ga0496100_0260893 3300048903 Bacteria 1285
432 Ga0496102_0074745 3300048905 Bacteria 3115
433 Ga0496103_0010114 3300048906 Bacteria 5577
434 Ga0496104_0096527 3300048907 Bacteria 2828
435 Ga0496104_0142469 3300048907 Bacteria 2303
436 Ga0496104_0212494 3300048907 Bacteria 1846
437 Ga0496105_0044162 3300048908 Bacteria 3675
438 Ga0496105_0115178 3300048908 Bacteria 2217
439 Ga0496105_0971284 3300048908 Bacteria 637
440 Ga0496106_0254201 3300048909 Bacteria 1405
441 Ga0496108_0000410 3300048911 Bacteria 35171
442 Ga0496108_0230437 3300048911 Bacteria 1611
443 Ga0496109_0000319 3300048912 Bacteria 45214
444 Ga0496109_0071663 3300048912 Bacteria 3182
445 Ga0496110_0006903 3300048913 Bacteria 9028
446 Ga0496111_0008657 3300048914 Bacteria 6748
447 Ga0496111_0546176 3300048914 Bacteria 851
448 Ga0496112_0000104 3300048915 Bacteria 53125
449 Ga0496112_0014637 3300048915 Bacteria 7289
450 Ga0496112_0110936 3300048915 Bacteria 2713
451 Ga0496113_0223746 3300048916 Bacteria 1500
452 Ga0496113_1086943 3300048916 Unclassified 628
453 Ga0496114_0854836 3300048917 Bacteria 790
454 Ga0496115_0004132 3300048918 Bacteria 10477
455 Ga0496115_0425612 3300048918 Unclassified 1075
456 Ga0501292_044253 3300049515 Bacteria 776
457 Ga0501298_082903 3300049521 Bacteria 708
458 nmdc:mga0n895_396922_c1 3300050512 Bacteria 1395
459 nmdc:mga0n895_517_c1 3300050512 Bacteria 26235
460 nmdc:mga0rr50_228566_c1 3300050513 Bacteria 1538
461 nmdc:mga08x19_40838_c1 3300050514 Bacteria 2954
462 nmdc:mga08x19_7944_c1 3300050514 Bacteria 6304
463 nmdc:mga0a205_33783_c1 3300050515 Bacteria 4905
464 Ga0070710_10044476
465 MBSR1b_contig_5770676
466 JGI24746J21847_1046699
467 JGI24743J22301_10038668
468 JGI24034J26672_10008753
469 JGI24751J29686_10007208
470 Ga0065712_10023542
471 Ga0065712_10140535
472 Ga0065715_10177074
473 Ga0070676_10001510
474 Ga0070676_10020234
475 Ga0070683_100002406
476 Ga0070683_100037246
477 Ga0070690_100051607
478 Ga0070670_100050557
479 Ga0070677_10171511
480 Ga0068869_100019584
481 Ga0068869_100046270
482 Ga0070666_10147649
483 Ga0070680_100569321
484 Ga0070682_100036060
485 Ga0070682_100270729
486 Ga0068868_100006208
487 Ga0068868_100068411
488 Ga0070660_100073188
489 Ga0070689_100000465
490 Ga0070689_100025088
491 Ga0070691_10050103
492 Ga0070687_100010732
493 Ga0070661_100002139
494 Ga0070692_10027279
495 Ga0070692_10155751
496 Ga0070668_100006832
497 Ga0070668_100064816
498 Ga0070669_100015306
499 Ga0070669_100041577
500 Ga0070675_100001737
501 Ga0070673_100000350
502 Ga0070688_100019495
503 Ga0070659_100008565
504 Ga0070659_100017944
505 Ga0070667_100028136
506 Ga0070667_100745708
507 Ga0070709_10000563
508 Ga0070709_10019292
509 Ga0070709_10020537
510 Ga0070709_10069158
511 Ga0070709_10469271
512 Ga0070709_10524423
513 Ga0070714_100033896
514 Ga0070714_100135786
515 Ga0070714_100274667
516 Ga0070714_100996328
517 Ga0070713_100000021
518 Ga0070713_100010406
519 Ga0070713_100385877
520 Ga0070713_100445837
521 Ga0070713_100787588
522 Ga0070713_100972818
523 Ga0070710_10066809
524 Ga0070701_10019993
525 Ga0070711_100000077
526 Ga0070711_100001080
527 Ga0070711_100073726
528 Ga0070711_100842183
529 Ga0070700_100021477
530 Ga0070708_100111239
531 Ga0070708_100244314
532 Ga0070708_100605664
533 Ga0070663_100003567
534 Ga0070663_100081149
535 Ga0070678_100002935
536 Ga0070678_100413887
537 Ga0070662_100002160
538 Ga0070662_100035908
539 Ga0068867_100019947
540 Ga0068867_100026112
541 Ga0068867_100580604
542 Ga0070685_10003352
543 Ga0070706_100000791
544 Ga0070706_100068918
545 Ga0070706_100079557
546 Ga0070706_100422601
547 Ga0070707_100111961
548 Ga0070707_100128299
549 Ga0070707_100740794
550 Ga0070698_100093985
551 Ga0070698_100192699
552 Ga0070698_100550759
553 Ga0070699_100178436
554 Ga0070679_100027072
555 Ga0070679_100263451
556 Ga0070679_100274465
557 Ga0070684_100000713
558 Ga0070684_100028627
559 Ga0070697_100000724
560 Ga0070697_100013641
561 Ga0070697_100035453
562 Ga0070697_100260432
563 Ga0070697_100486140
564 Ga0070697_100545437
565 Ga0068853_100023880
566 Ga0068853_100026145
567 Ga0070672_100026956
568 Ga0070686_100018690
569 Ga0070695_100287494
570 Ga0070696_100030322
571 Ga0070693_100126926
572 Ga0070665_100043267
573 Ga0070704_100187922
574 Ga0068855_100264859
575 Ga0070664_100023322
576 Ga0070664_100051388
577 Ga0068857_100000378
578 Ga0068854_100008282
579 Ga0068856_100059910
580 Ga0068856_100081779
581 Ga0068856_100164113
582 Ga0070702_100016654
583 Ga0068852_100042261
584 Ga0068852_100043654
585 Ga0068852_100175998
586 Ga0068859_100008838
587 Ga0068859_100046558
588 Ga0068864_100003254
589 Ga0068864_100073776
590 Ga0068866_10011386
591 Ga0068866_10127448
592 Ga0068861_100003528
593 Ga0068851_10001087
594 Ga0068870_10000523
595 Ga0068863_100043540
596 Ga0068858_100059982
597 Ga0068858_100089991
598 Ga0068860_100052143
599 Ga0068860_100053084
600 Ga0068862_100008847
601 Ga0070717_10013699
602 Ga0070717_10076431
603 Ga0070717_10142935
604 Ga0070717_10178271
605 Ga0070717_10244025
606 Ga0070717_10300096
607 Ga0070717_10490984
608 Ga0070715_10002364
609 Ga0070715_10008179
610 Ga0070715_10011007
611 Ga0070716_100013991
612 Ga0070716_100151293
613 Ga0070716_100669073
614 Ga0070712_100000947
615 Ga0070712_100001223
616 Ga0097621_100023784
617 Ga0097621_100086373
618 Ga0097621_100978562
619 Ga0068871_100042870
620 Ga0068871_100122905
621 Ga0075433_10027585
622 Ga0075434_100000423
623 Ga0075434_100399575
624 Ga0068865_100029737
625 Ga0068865_100060214
626 Ga0075436_100007787
627 Ga0075436_100043662
628 Ga0075436_100049070
629 Ga0097620_100008838
630 Ga0097620_100046558
631 Ga0075435_100183653
632 Ga0075435_100350078
633 Ga0099794_10127836
634 Ga0099795_10084767
635 Ga0105250_10018587
636 Ga0105250_10125557
637 Ga0105240_10700412
638 Ga0105240_10813547
639 Ga0105240_11065191
640 Ga0105245_10026366
641 Ga0105245_10065902
642 Ga0105247_10030626
643 Ga0105247_10081104
644 Ga0105243_10074548
645 Ga0105241_10001811
646 Ga0105241_10126276
647 Ga0105241_10307251
648 Ga0105241_10414266
649 Ga0105241_10599083
650 Ga0105241_10926592
651 Ga0105242_10005608
652 Ga0105242_10058794
653 Ga0105248_10060457
654 Ga0105248_10103967
655 Ga0105237_10036000
656 Ga0105237_10210127
657 Ga0105237_10237184
658 Ga0105237_10890574
659 Ga0105238_10031850
660 Ga0105238_10046656
661 Ga0105238_10380120
662 Ga0105238_10598173
663 Ga0105249_10024966
664 Ga0105249_10025360
665 Ga0105249_12478934
666 Ga0099796_10288487
667 Ga0105239_10083787
668 Ga0105246_10007167
669 Ga0105246_10155281
670 Ga0157373_10018484
671 Ga0157373_10019275
672 Ga0157373_10135143
673 Ga0157371_10005929
674 Ga0157370_10015145
675 Ga0157370_10274444
676 Ga0157370_10291089
677 Ga0157370_10553883
678 Ga0157370_10730161
679 Ga0157370_11434700
680 Ga0157369_10019384
681 Ga0157369_10023375
682 Ga0157369_10058737
683 Ga0157369_10593009
684 Ga0157374_10059869
685 Ga0157374_11804794
686 Ga0157374_11804799
687 Ga0157378_10680877
688 Ga0163162_10006283
689 Ga0163162_10391513
690 Ga0157372_10080149
691 Ga0157375_10055527
692 Ga0163163_10001562
693 Ga0157380_10072181
694 Ga0157379_10090205
695 Ga0157376_10033303
696 Ga0157376_10233299
697 Ga0163161_10074298
698 Ga0213873_10026224
699 Ga0213874_10003363
700 Ga0213876_10070831
701 Ga0224570_100741
702 Ga0224572_1012786
703 Ga0228598_1000330
704 Ga0228598_1003018
705 Ga0207692_10013019
706 Ga0207692_10252842
707 Ga0207692_10340079
708 Ga0207642_10170080
709 Ga0207710_10368495
710 Ga0207688_10008630
711 Ga0207680_10049940
712 Ga0207680_10296521
713 Ga0207647_10034426
714 Ga0207685_10012273
715 Ga0207685_10016999
716 Ga0207699_10006450
717 Ga0207699_10015625
718 Ga0207699_10100876
719 Ga0207699_10680267
720 Ga0207645_10000173
721 Ga0207645_10013591
722 Ga0207643_10001062
723 Ga0207705_10123756
724 Ga0207684_10003547
725 Ga0207684_10033092
726 Ga0207654_10019182
727 Ga0207654_10352291
728 Ga0207707_10325172
729 Ga0207695_10006689
730 Ga0207695_10127032
731 Ga0207671_10125220
732 Ga0207693_10000047
733 Ga0207693_10003397
734 Ga0207663_10012426
735 Ga0207663_10106539
736 Ga0207660_10257373
737 Ga0207660_10684626
738 Ga0207662_10006209
739 Ga0207657_10000361
740 Ga0207657_10007319
741 Ga0207649_10011330
742 Ga0207649_10018455
743 Ga0207652_10058500
744 Ga0207652_10402451
745 Ga0207646_10027005
746 Ga0207646_10136265
747 Ga0207646_11165688
748 Ga0207681_10008655
749 Ga0207694_10037931
750 Ga0207694_10479491
751 Ga0207650_10000024
752 Ga0207659_10014160
753 Ga0207687_10020561
754 Ga0207700_10000682
755 Ga0207700_10024077
756 Ga0207700_10090597
757 Ga0207700_10173204
758 Ga0207664_10000282
759 Ga0207664_10101520
760 Ga0207664_10342874
761 Ga0207644_10065495
762 Ga0207690_10402907
763 Ga0207690_10501060
764 Ga0207706_10000422
765 Ga0207706_10000578
766 Ga0207686_10006886
767 Ga0207686_10079266
768 Ga0207686_10130747
769 Ga0207709_10236339
770 Ga0207670_10005532
771 Ga0207669_10184877
772 Ga0207665_10012129
773 Ga0207665_10053168
774 Ga0207665_10059964
775 Ga0207665_10110618
776 Ga0207665_10239037
777 Ga0207691_10000072
778 Ga0207711_10004372
779 Ga0207711_10027791
780 Ga0207689_10001329
781 Ga0207689_10032651
782 Ga0207661_10000062
783 Ga0207661_10087223
784 Ga0207661_10436762
785 Ga0207679_10000040
786 Ga0207667_10444862
787 Ga0207651_10000453
788 Ga0207712_10240868
789 Ga0207668_10042640
790 Ga0207668_10062036
791 Ga0207640_10011374
792 Ga0207640_10354062
793 Ga0207658_10015101
794 Ga0207677_10004507
795 Ga0207677_10661298
796 Ga0207703_10016369
797 Ga0207703_10409055
798 Ga0207639_10164367
799 Ga0207639_10598538
800 Ga0207639_11147109
801 Ga0207678_10000208
802 Ga0207678_10005233
803 Ga0207702_10026514
804 Ga0207702_10064081
805 Ga0207702_10161153
806 Ga0207702_10214634
807 Ga0207641_10000030
808 Ga0207648_10000303
809 Ga0207648_10051252
810 Ga0207648_10549314
811 Ga0207676_10000134
812 Ga0207676_10514718
813 Ga0207674_10000069
814 Ga0207674_10007171
815 Ga0207675_100043208
816 Ga0207683_10000186
817 Ga0207698_10019837
818 Ga0207698_10429060
819 Ga0265356_1018829
820 Ga0268266_10019454
821 Ga0268266_10100387
822 Ga0268265_10005761
823 Ga0268264_10032392
824 Ga0268264_10114099
825 Ga0265770_1005062
826 Ga0265770_1029549
827 Ga0265765_1038161
828 Ga0265760_10001124
829 Ga0265760_10012091
830 Ga0265325_10322555
831 Ga0265331_10067975
832 Ga0265316_10059560
833 Ga0265314_10051777
834 Ga0307416_100796703
835 Ga0316212_1019153
836 Ga0373958_0107873
837 Ga0373926_0131593
838 Ga0373929_0010460
839 Ga0373934_0030734
840 Ga0373923_0034247
841 Ga0373932_0224379
842 Ga0373936_0000877
843 Ga0373941_0106984
844 Ga0373953_0255142
845 Ga0373954_0382512
846 Ga0373943_0000242
847 Ga0373943_0095645
848 Ga0373942_0127279
849 Ga0373962_0093170
850 Ga0373924_0019793
851 Ga0373924_0057795
852 Ga0373931_0101537
853 Ga0373931_0523708
854 Ga0373935_0005596
855 Ga0373927_0000240
856 Ga0373933_0119649
857 Ga0373947_0000384
858 Ga0373925_0002108
859 Ga0395898_0064172
860 Ga0436365_0904862
861 Ga0436365_1032470
862 Ga0436363_0017403
863 Ga0436363_0160329
864 Ga0436363_1097442
865 Ga0436363_1326637
866 Ga0436362_0200137
867 Ga0436362_0819142
868 Ga0466963_0052764
869 Ga0466963_0751288
870 Ga0466968_0115445
871 Ga0466957_0000242
872 Ga0466957_0117360
873 Ga0451576_0191580
874 Ga0466967_0013528
875 Ga0466967_0452177
876 Ga0466967_1616603
877 Ga0495629_0162069
878 Ga0495580_0002357
879 Ga0495580_0056782
880 Ga0495580_0175191
881 Ga0495582_0012419
882 Ga0495582_0041507
883 Ga0495664_0047753
884 Ga0495628_0199050
885 Ga0495646_0419997
886 Ga0495647_0248862
887 Ga0495669_0210315
888 Ga0495613_0122221
889 Ga0495624_0099826
890 Ga0495604_0312358
891 Ga0495674_0182940
892 Ga0495676_0344095
893 Ga0495602_0276595
894 Ga0496100_0260893
895 Ga0496102_0074745
896 Ga0496103_0010114
897 Ga0496104_0096527
898 Ga0496104_0142469
899 Ga0496104_0212494
900 Ga0496105_0044162
901 Ga0496105_0115178
902 Ga0496105_0971284
903 Ga0496106_0254201
904 Ga0496108_0000410
905 Ga0496108_0230437
906 Ga0496109_0000319
907 Ga0496109_0071663
908 Ga0496110_0006903
909 Ga0496111_0008657
910 Ga0496111_0546176
911 Ga0496112_0000104
912 Ga0496112_0014637
913 Ga0496112_0110936
914 Ga0496113_0223746
915 Ga0496113_1086943
916 Ga0496114_0854836
917 Ga0496115_0004132
918 Ga0496115_0425612
919 Ga0501292_044253
920 Ga0501298_082903
921 nmdc:mga0n895_396922_c1
922 nmdc:mga0n895_517_c1
923 nmdc:mga0rr50_228566_c1
924 nmdc:mga08x19_40838_c1
925 nmdc:mga08x19_7944_c1
926 nmdc:mga0a205_33783_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02631

RecX_HTH2

RecX, second three-helix domain

95

136

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dfg-assembly1.cif.gz_A crystal structure of recx: a potent inhibitor protein of reca from xanthomonas campestris 0.801 15 155
3c1d-assembly3.cif.gz_A x-ray crystal structure of recx 0.7856 12 158
3c1d-assembly3.cif.gz_A x-ray crystal structure of recx 0.7617 12 158
3dfg-assembly1.cif.gz_A crystal structure of recx: a potent inhibitor protein of reca from xanthomonas campestris 0.7568 15 155
3d5l-assembly2.cif.gz_B crystal structure of regulatory protein recx 0.7542 12 161
ID Description Score Start End Superfamily
3e3vA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9811 66 107 1.10.10.10
3d5lA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9459 66 109 1.10.10.10
3d5lB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9421 66 109 1.10.10.10
3d5lA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9074 66 109 1.10.10.10
3d5lB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9041 66 109 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V9T461-F1-model_v4 Regulatory protein RecX 0.9551 1 175 GO:0005737
GO:0006282
AF-A0A2V9YS53-F1-model_v4 Regulatory protein RecX 0.9507 6 176 GO:0005737
GO:0006282
AF-A0A2V9P5Q9-F1-model_v4 Regulatory protein RecX 0.9419 1 164 GO:0005737
GO:0006282
AF-A0A2V9R2A0-F1-model_v4 Regulatory protein RecX 0.9409 4 173 GO:0005737
GO:0006282
AF-A0A2V9YS53-F1-model_v4 Regulatory protein RecX 0.9401 6 176 GO:0005737
GO:0006282

Map