F449075
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 463 | 202 | 926 | 286 |
Family's Representative Sequence
| Representative Sequence | 3300005468|Ga0070707_100117630|Ga0070707_1001176301 |
| Length | 307 |
| Sequence | MSEPSFNLKASGRSRRRLVVNRIAEGSALLAAARGIGALSIDFFTKGPPLFGAAGGGIAPAIAGSLLLVFIATVIALPFGVLTAIYVSEFAPEGIGRQIRLWLDVLNGFPSIVIGIFVFTIIVKTRLPVVGWGHHQSAIAGGFALAIIMLPLVARSTMEVLQLVPNHLREASYALGVSKWQTVVRVILPTSFGGILTGTTLAIARAAGETAPLLFTCAIAGQIVDWNPAHSVQSIPLTIFQYSESADPNLHQQAWAAAFILIMFVLVTSLTARYLLHRSRQKLEGSDRAGRMLNLTFVYGFFRGGGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 28 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 29 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 31 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 34 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 35 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 36 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 37 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 53 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 54 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 55 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 56 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 57 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 58 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 84 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 87 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 88 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 89 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 90 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 91 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 92 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 93 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 94 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 95 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 96 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 97 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 98 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 99 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 100 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 101 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 102 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 103 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 104 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 105 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 106 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 107 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 108 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 109 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 110 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 111 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 112 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 113 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 114 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 115 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 116 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 117 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 118 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 119 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 120 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 121 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 122 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 123 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 124 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 125 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 126 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 127 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 128 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 170 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 171 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 172 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 173 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 174 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 175 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 178 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 179 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 180 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 181 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 182 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 188 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 191 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 200 | 2523533629 | Kaistella palustris DSM 21579 | Isolate | Rhizosphere |
| 201 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 202 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.49 |
| Metatranscriptomes | 0.86 |
| Isolates | 0.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.43 |
| Nodule | 0 |
| Rhizoplane | 12.74 |
| Rhizosphere | 85.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070707_100117630 | 3300005468 | Bacteria | 2580 |
| 2 | rootH1_10278812 | 3300003323 | Bacteria | 1175 |
| 3 | Ga0070658_10211998 | 3300005327 | Unclassified | 1636 |
| 4 | Ga0070683_100013066 | 3300005329 | Bacteria | 7230 |
| 5 | Ga0070683_100035630 | 3300005329 | Bacteria | 4549 |
| 6 | Ga0070683_100194515 | 3300005329 | Bacteria | 1926 |
| 7 | Ga0070683_100340831 | 3300005329 | Bacteria | 1427 |
| 8 | Ga0070683_100366635 | 3300005329 | Bacteria | 1372 |
| 9 | Ga0070680_100001740 | 3300005336 | Bacteria | 15994 |
| 10 | Ga0070680_100028646 | 3300005336 | Bacteria | 4469 |
| 11 | Ga0070680_100043595 | 3300005336 | Bacteria | 3644 |
| 12 | Ga0070680_100371406 | 3300005336 | Bacteria | 1217 |
| 13 | Ga0070682_100181405 | 3300005337 | Bacteria | 1471 |
| 14 | Ga0068868_100429731 | 3300005338 | Unclassified | 1145 |
| 15 | Ga0070660_100000838 | 3300005339 | Bacteria | 20451 |
| 16 | Ga0070660_100004651 | 3300005339 | Bacteria | 9500 |
| 17 | Ga0070660_100022622 | 3300005339 | Bacteria | 4651 |
| 18 | Ga0070660_100087688 | 3300005339 | Bacteria | 2449 |
| 19 | Ga0070661_100054241 | 3300005344 | Bacteria | 2936 |
| 20 | Ga0070661_100086058 | 3300005344 | Bacteria | 2323 |
| 21 | Ga0070671_100142005 | 3300005355 | Bacteria | 2026 |
| 22 | Ga0070659_100096384 | 3300005366 | Bacteria | 2376 |
| 23 | Ga0070667_100393008 | 3300005367 | Bacteria | 1261 |
| 24 | Ga0070709_10100875 | 3300005434 | Unclassified | 1923 |
| 25 | Ga0070714_100470482 | 3300005435 | Bacteria | 1196 |
| 26 | Ga0070713_100051879 | 3300005436 | Bacteria | 3394 |
| 27 | Ga0070713_100155817 | 3300005436 | Bacteria | 2036 |
| 28 | Ga0070713_100300688 | 3300005436 | Bacteria | 1477 |
| 29 | Ga0070713_100504673 | 3300005436 | Bacteria | 1142 |
| 30 | Ga0070711_100025946 | 3300005439 | Bacteria | 3837 |
| 31 | Ga0070711_100248934 | 3300005439 | Bacteria | 1393 |
| 32 | Ga0070711_100314571 | 3300005439 | Bacteria | 1249 |
| 33 | Ga0070694_100087250 | 3300005444 | Bacteria | 2182 |
| 34 | Ga0070708_100033907 | 3300005445 | Bacteria | 4437 |
| 35 | Ga0070708_100085803 | 3300005445 | Bacteria | 2858 |
| 36 | Ga0070681_10000130 | 3300005458 | Bacteria | 56536 |
| 37 | Ga0070681_10003736 | 3300005458 | Bacteria | 14287 |
| 38 | Ga0070681_10004350 | 3300005458 | Bacteria | 13473 |
| 39 | Ga0070681_10104811 | 3300005458 | Bacteria | 2770 |
| 40 | Ga0070681_10120204 | 3300005458 | Archaea | 2562 |
| 41 | Ga0070681_10123734 | 3300005458 | Bacteria | 2519 |
| 42 | Ga0070706_100015919 | 3300005467 | Bacteria | 6944 |
| 43 | Ga0070707_100004757 | 3300005468 | Bacteria | 12710 |
| 44 | Ga0070698_100021238 | 3300005471 | Bacteria | 6802 |
| 45 | Ga0070698_100291132 | 3300005471 | Bacteria | 1564 |
| 46 | Ga0070679_100015446 | 3300005530 | Bacteria | 7337 |
| 47 | Ga0070679_100019347 | 3300005530 | Bacteria | 6617 |
| 48 | Ga0070679_100203519 | 3300005530 | Unclassified | 1944 |
| 49 | Ga0070684_100001412 | 3300005535 | Bacteria | 17270 |
| 50 | Ga0070684_100088985 | 3300005535 | Bacteria | 2744 |
| 51 | Ga0070684_100127562 | 3300005535 | Bacteria | 2293 |
| 52 | Ga0070684_100151125 | 3300005535 | Bacteria | 2104 |
| 53 | Ga0068853_100593469 | 3300005539 | Unclassified | 1052 |
| 54 | Ga0070665_100109129 | 3300005548 | Bacteria | 2770 |
| 55 | Ga0068855_100007768 | 3300005563 | Bacteria | 12954 |
| 56 | Ga0068855_100052032 | 3300005563 | Bacteria | 4822 |
| 57 | Ga0068855_100052814 | 3300005563 | Bacteria | 4783 |
| 58 | Ga0068855_100084972 | 3300005563 | Bacteria | 3662 |
| 59 | Ga0068855_100126286 | 3300005563 | Bacteria | 2924 |
| 60 | Ga0068855_100127576 | 3300005563 | Bacteria | 2908 |
| 61 | Ga0068857_100128503 | 3300005577 | Bacteria | 2284 |
| 62 | Ga0068857_100296692 | 3300005577 | Unclassified | 1489 |
| 63 | Ga0081455_10170095 | 3300005937 | Bacteria | 1661 |
| 64 | Ga0081455_10200679 | 3300005937 | Bacteria | 1494 |
| 65 | Ga0070717_10082566 | 3300006028 | Bacteria | 2701 |
| 66 | Ga0070717_10280776 | 3300006028 | Bacteria | 1477 |
| 67 | Ga0075365_10004605 | 3300006038 | Bacteria | 7338 |
| 68 | Ga0070712_100013817 | 3300006175 | Bacteria | 5167 |
| 69 | Ga0097621_100282266 | 3300006237 | Bacteria | 1462 |
| 70 | Ga0068871_100383914 | 3300006358 | Bacteria | 1248 |
| 71 | Ga0075428_100607373 | 3300006844 | Bacteria | 1168 |
| 72 | Ga0075433_10012284 | 3300006852 | Bacteria | 6908 |
| 73 | Ga0075435_100026940 | 3300007076 | Bacteria | 4491 |
| 74 | Ga0105240_10014721 | 3300009093 | Bacteria | 10670 |
| 75 | Ga0105240_10384892 | 3300009093 | Bacteria | 1583 |
| 76 | Ga0111539_10010446 | 3300009094 | Bacteria | 11685 |
| 77 | Ga0105245_10316464 | 3300009098 | Bacteria | 1536 |
| 78 | Ga0114129_10405927 | 3300009147 | Bacteria | 1795 |
| 79 | Ga0114129_10497068 | 3300009147 | Bacteria | 1593 |
| 80 | Ga0105241_10175716 | 3300009174 | Bacteria | 1772 |
| 81 | Ga0105242_10029747 | 3300009176 | Bacteria | 4357 |
| 82 | Ga0105242_10047142 | 3300009176 | Bacteria | 3498 |
| 83 | Ga0105242_10194840 | 3300009176 | Bacteria | 1796 |
| 84 | Ga0105237_10164959 | 3300009545 | Unclassified | 2214 |
| 85 | Ga0105238_10116963 | 3300009551 | Bacteria | 2646 |
| 86 | Ga0105239_10144395 | 3300010375 | Bacteria | 2653 |
| 87 | Ga0157370_10011524 | 3300013104 | Bacteria | 9235 |
| 88 | Ga0157370_10014156 | 3300013104 | Bacteria | 8179 |
| 89 | Ga0157370_10029452 | 3300013104 | Bacteria | 5386 |
| 90 | Ga0157370_10030785 | 3300013104 | Bacteria | 5256 |
| 91 | Ga0157370_10236044 | 3300013104 | Bacteria | 1692 |
| 92 | Ga0157369_10000274 | 3300013105 | Bacteria | 69432 |
| 93 | Ga0157369_10012696 | 3300013105 | Bacteria | 9554 |
| 94 | Ga0157369_10072131 | 3300013105 | Bacteria | 3706 |
| 95 | Ga0157369_10134496 | 3300013105 | Bacteria | 2618 |
| 96 | Ga0157369_10167499 | 3300013105 | Bacteria | 2316 |
| 97 | Ga0157369_10266788 | 3300013105 | Bacteria | 1785 |
| 98 | Ga0157374_10299145 | 3300013296 | Bacteria | 1591 |
| 99 | Ga0157372_10055102 | 3300013307 | Bacteria | 4439 |
| 100 | Ga0157372_10113631 | 3300013307 | Bacteria | 3103 |
| 101 | Ga0157372_10134849 | 3300013307 | Bacteria | 2843 |
| 102 | Ga0157372_10283898 | 3300013307 | Bacteria | 1925 |
| 103 | Ga0157375_10040089 | 3300013308 | Bacteria | 4513 |
| 104 | Ga0157380_10003893 | 3300014326 | Bacteria | 10295 |
| 105 | Ga0182008_10014308 | 3300014497 | Bacteria | 4157 |
| 106 | Ga0182008_10023404 | 3300014497 | Bacteria | 3155 |
| 107 | Ga0182008_10076467 | 3300014497 | Bacteria | 1647 |
| 108 | Ga0182007_10012160 | 3300015262 | Bacteria | 3322 |
| 109 | Ga0182007_10048896 | 3300015262 | Unclassified | 1397 |
| 110 | Ga0206356_10273602 | 3300020070 | Bacteria | 1635 |
| 111 | Ga0206354_11064135 | 3300020081 | Bacteria | 1334 |
| 112 | Ga0206353_10459516 | 3300020082 | Bacteria | 2928 |
| 113 | Ga0206353_11095007 | 3300020082 | Bacteria | 7110 |
| 114 | Ga0213871_10014356 | 3300021441 | Bacteria | 1877 |
| 115 | Ga0207705_10010059 | 3300025909 | Bacteria | 6884 |
| 116 | Ga0207705_10182690 | 3300025909 | Unclassified | 1583 |
| 117 | Ga0207684_10014952 | 3300025910 | Bacteria | 6680 |
| 118 | Ga0207707_10007369 | 3300025912 | Bacteria | 9582 |
| 119 | Ga0207707_10023280 | 3300025912 | Bacteria | 5420 |
| 120 | Ga0207707_10383135 | 3300025912 | Bacteria | 1208 |
| 121 | Ga0207695_10111482 | 3300025913 | Bacteria | 2715 |
| 122 | Ga0207695_10422966 | 3300025913 | Bacteria | 1216 |
| 123 | Ga0207671_10201172 | 3300025914 | Unclassified | 1556 |
| 124 | Ga0207693_10001636 | 3300025915 | Bacteria | 19776 |
| 125 | Ga0207693_10034024 | 3300025915 | Bacteria | 4020 |
| 126 | Ga0207693_10056128 | 3300025915 | Bacteria | 3088 |
| 127 | Ga0207663_10177955 | 3300025916 | Bacteria | 1516 |
| 128 | Ga0207660_10029806 | 3300025917 | Bacteria | 3747 |
| 129 | Ga0207660_10036525 | 3300025917 | Bacteria | 3416 |
| 130 | Ga0207657_10000976 | 3300025919 | Bacteria | 30357 |
| 131 | Ga0207657_10002512 | 3300025919 | Bacteria | 19848 |
| 132 | Ga0207657_10016038 | 3300025919 | Bacteria | 7231 |
| 133 | Ga0207657_10021635 | 3300025919 | Bacteria | 6046 |
| 134 | Ga0207657_10080712 | 3300025919 | Bacteria | 2734 |
| 135 | Ga0207649_10025750 | 3300025920 | Bacteria | 3433 |
| 136 | Ga0207649_10295281 | 3300025920 | Unclassified | 1183 |
| 137 | Ga0207652_10021027 | 3300025921 | Bacteria | 5382 |
| 138 | Ga0207652_10043134 | 3300025921 | Bacteria | 3841 |
| 139 | Ga0207652_10078827 | 3300025921 | Bacteria | 2877 |
| 140 | Ga0207652_10187262 | 3300025921 | Unclassified | 1861 |
| 141 | Ga0207652_10381529 | 3300025921 | Bacteria | 1272 |
| 142 | Ga0207646_10267481 | 3300025922 | Bacteria | 1545 |
| 143 | Ga0207694_10209310 | 3300025924 | Bacteria | 1588 |
| 144 | Ga0207694_10250840 | 3300025924 | Bacteria | 1448 |
| 145 | Ga0207700_10050128 | 3300025928 | Bacteria | 3110 |
| 146 | Ga0207664_10069157 | 3300025929 | Bacteria | 2839 |
| 147 | Ga0207686_10045066 | 3300025934 | Bacteria | 2712 |
| 148 | Ga0207686_10045631 | 3300025934 | Bacteria | 2698 |
| 149 | Ga0207686_10084479 | 3300025934 | Bacteria | 2080 |
| 150 | Ga0207686_10093364 | 3300025934 | Bacteria | 1992 |
| 151 | Ga0207665_10069350 | 3300025939 | Bacteria | 2404 |
| 152 | Ga0207661_10024732 | 3300025944 | Bacteria | 4555 |
| 153 | Ga0207661_10115131 | 3300025944 | Bacteria | 2281 |
| 154 | Ga0207661_10158975 | 3300025944 | Unclassified | 1959 |
| 155 | Ga0207661_10270776 | 3300025944 | Bacteria | 1515 |
| 156 | Ga0207667_10071038 | 3300025949 | Bacteria | 3621 |
| 157 | Ga0207667_10092134 | 3300025949 | Bacteria | 3130 |
| 158 | Ga0207667_10256009 | 3300025949 | Unclassified | 1790 |
| 159 | Ga0207658_10303397 | 3300025986 | Bacteria | 1376 |
| 160 | Ga0207678_10045607 | 3300026067 | Bacteria | 3790 |
| 161 | Ga0207678_10105589 | 3300026067 | Bacteria | 2403 |
| 162 | Ga0207702_10367984 | 3300026078 | Bacteria | 1379 |
| 163 | Ga0207674_10200170 | 3300026116 | Bacteria | 1947 |
| 164 | Ga0207674_10203900 | 3300026116 | Bacteria | 1927 |
| 165 | Ga0207683_10510463 | 3300026121 | Unclassified | 1111 |
| 166 | Ga0207698_10035958 | 3300026142 | Bacteria | 3629 |
| 167 | Ga0207698_10335292 | 3300026142 | Unclassified | 1422 |
| 168 | Ga0207428_10048776 | 3300027907 | Bacteria | 3395 |
| 169 | Ga0268266_10115069 | 3300028379 | Bacteria | 2387 |
| 170 | Ga0268266_10386076 | 3300028379 | Bacteria | 1322 |
| 171 | Ga0268265_10079650 | 3300028380 | Bacteria | 2581 |
| 172 | Ga0265338_10082052 | 3300028800 | Bacteria | 2701 |
| 173 | Ga0265338_10099663 | 3300028800 | Bacteria | 2372 |
| 174 | Ga0265338_10185346 | 3300028800 | Bacteria | 1582 |
| 175 | Ga0316177_1044313 | 3300030731 | Bacteria | 4344 |
| 176 | Ga0316176_1043240 | 3300030732 | Bacteria | 38084 |
| 177 | Ga0316181_1130119 | 3300030744 | Bacteria | 16613 |
| 178 | Ga0316182_1154965 | 3300030745 | Bacteria | 1440 |
| 179 | Ga0265320_10019125 | 3300031240 | Bacteria | 3753 |
| 180 | Ga0265327_10025245 | 3300031251 | Bacteria | 3470 |
| 181 | Ga0265327_10052251 | 3300031251 | Bacteria | 2129 |
| 182 | Ga0307408_100000389 | 3300031548 | Bacteria | 40047 |
| 183 | Ga0307408_100197453 | 3300031548 | Bacteria | 1626 |
| 184 | Ga0265313_10050288 | 3300031595 | Bacteria | 2001 |
| 185 | Ga0307412_10018240 | 3300031911 | Bacteria | 4219 |
| 186 | Ga0307412_10069233 | 3300031911 | Bacteria | 2402 |
| 187 | Ga0307416_100180252 | 3300032002 | Bacteria | 1979 |
| 188 | Ga0307414_10015326 | 3300032004 | Bacteria | 4627 |
| 189 | Ga0307414_10035800 | 3300032004 | Bacteria | 3307 |
| 190 | Ga0307414_10197855 | 3300032004 | Bacteria | 1632 |
| 191 | Ga0373944_0052690 | 3300035089 | Bacteria | 1286 |
| 192 | Ga0373945_0005439 | 3300035116 | Bacteria | 4075 |
| 193 | Ga0373945_0014519 | 3300035116 | Bacteria | 2640 |
| 194 | Ga0373943_0000321 | 3300035170 | Bacteria | 20135 |
| 195 | Ga0373943_0016359 | 3300035170 | Bacteria | 3381 |
| 196 | Ga0373946_0013685 | 3300035171 | Bacteria | 3052 |
| 197 | Ga0373935_0015054 | 3300035692 | Bacteria | 4671 |
| 198 | Ga0373935_0045537 | 3300035692 | Bacteria | 2768 |
| 199 | Ga0373935_0233600 | 3300035692 | Bacteria | 1281 |
| 200 | Ga0373927_0158333 | 3300035695 | Bacteria | 1483 |
| 201 | Ga0373947_0001733 | 3300035725 | Bacteria | 13339 |
| 202 | Ga0373947_0019472 | 3300035725 | Bacteria | 3913 |
| 203 | Ga0373947_0126393 | 3300035725 | Bacteria | 1628 |
| 204 | Ga0373937_0062305 | 3300036401 | Bacteria | 3429 |
| 205 | Ga0373937_0155484 | 3300036401 | Bacteria | 2143 |
| 206 | Ga0373925_0008675 | 3300037068 | Bacteria | 7406 |
| 207 | Ga0373925_0037423 | 3300037068 | Bacteria | 3583 |
| 208 | Ga0395899_0017632 | 3300037312 | Bacteria | 5437 |
| 209 | Ga0395899_0021861 | 3300037312 | Bacteria | 4853 |
| 210 | Ga0395899_0083360 | 3300037312 | Bacteria | 2325 |
| 211 | Ga0395899_0094478 | 3300037312 | Bacteria | 2164 |
| 212 | Ga0395899_0270162 | 3300037312 | Bacteria | 1160 |
| 213 | Ga0395900_0001712 | 3300037418 | Bacteria | 25354 |
| 214 | Ga0395900_0006471 | 3300037418 | Bacteria | 12213 |
| 215 | Ga0395900_0031612 | 3300037418 | Bacteria | 5441 |
| 216 | Ga0395900_0090784 | 3300037418 | Bacteria | 3139 |
| 217 | Ga0395900_0145434 | 3300037418 | Bacteria | 2424 |
| 218 | Ga0395900_0323308 | 3300037418 | Bacteria | 1522 |
| 219 | Ga0395900_0426545 | 3300037418 | Bacteria | 1286 |
| 220 | Ga0395900_0580761 | 3300037418 | Bacteria | 1063 |
| 221 | Ga0395898_0001935 | 3300037466 | Bacteria | 26310 |
| 222 | Ga0395898_0002702 | 3300037466 | Bacteria | 20514 |
| 223 | Ga0395898_0007872 | 3300037466 | Bacteria | 11305 |
| 224 | Ga0395898_0029423 | 3300037466 | Bacteria | 5502 |
| 225 | Ga0395898_0038231 | 3300037466 | Bacteria | 4757 |
| 226 | Ga0395898_0041401 | 3300037466 | Bacteria | 4550 |
| 227 | Ga0395898_0081187 | 3300037466 | Bacteria | 3127 |
| 228 | Ga0395898_0119714 | 3300037466 | Bacteria | 2522 |
| 229 | Ga0395898_0276966 | 3300037466 | Bacteria | 1600 |
| 230 | Ga0395898_0363301 | 3300037466 | Bacteria | 1380 |
| 231 | Ga0395905_0002251 | 3300037471 | Bacteria | 21694 |
| 232 | Ga0395905_0004857 | 3300037471 | Bacteria | 13857 |
| 233 | Ga0395905_0006548 | 3300037471 | Bacteria | 11707 |
| 234 | Ga0395905_0008968 | 3300037471 | Bacteria | 9815 |
| 235 | Ga0395905_0028354 | 3300037471 | Bacteria | 5278 |
| 236 | Ga0395905_0031773 | 3300037471 | Bacteria | 4968 |
| 237 | Ga0395905_0217422 | 3300037471 | Bacteria | 1789 |
| 238 | Ga0395905_0384717 | 3300037471 | Bacteria | 1297 |
| 239 | Ga0395901_0004308 | 3300038443 | Bacteria | 14358 |
| 240 | Ga0395901_0005287 | 3300038443 | Bacteria | 13044 |
| 241 | Ga0395901_0005519 | 3300038443 | Bacteria | 12808 |
| 242 | Ga0395901_0008516 | 3300038443 | Bacteria | 10360 |
| 243 | Ga0395901_0010249 | 3300038443 | Bacteria | 9494 |
| 244 | Ga0395901_0031330 | 3300038443 | Bacteria | 5484 |
| 245 | Ga0395901_0032173 | 3300038443 | Bacteria | 5413 |
| 246 | Ga0395901_0070564 | 3300038443 | Bacteria | 3640 |
| 247 | Ga0395901_0110473 | 3300038443 | Bacteria | 2886 |
| 248 | Ga0395901_0189528 | 3300038443 | Bacteria | 2157 |
| 249 | Ga0395901_0210378 | 3300038443 | Bacteria | 2036 |
| 250 | Ga0395901_0320321 | 3300038443 | Bacteria | 1604 |
| 251 | Ga0395901_0882593 | 3300038443 | Unclassified | 877 |
| 252 | Ga0436365_1463753 | 3300039437 | Bacteria | 1306 |
| 253 | Ga0436360_0873850 | 3300039438 | Bacteria | 2991 |
| 254 | Ga0439431_0042527 | 3300041997 | Bacteria | 1161 |
| 255 | Ga0439457_031014 | 3300042014 | Bacteria | 1185 |
| 256 | Ga0450894_022134 | 3300042131 | Unclassified | 861 |
| 257 | Ga0466961_0046268 | 3300044693 | Bacteria | 2783 |
| 258 | Ga0466961_0209024 | 3300044693 | Bacteria | 1205 |
| 259 | Ga0466963_0003087 | 3300044694 | Bacteria | 9442 |
| 260 | Ga0466963_0004327 | 3300044694 | Bacteria | 8242 |
| 261 | Ga0466963_0012459 | 3300044694 | Bacteria | 5205 |
| 262 | Ga0466963_0031883 | 3300044694 | Bacteria | 3408 |
| 263 | Ga0466963_0064876 | 3300044694 | Bacteria | 2447 |
| 264 | Ga0466963_0143931 | 3300044694 | Bacteria | 1653 |
| 265 | Ga0466963_0238880 | 3300044694 | Unclassified | 1274 |
| 266 | Ga0466964_0013203 | 3300044706 | Bacteria | 3132 |
| 267 | Ga0466964_0027106 | 3300044706 | Unclassified | 2247 |
| 268 | Ga0466964_0061443 | 3300044706 | Bacteria | 1564 |
| 269 | Ga0466971_0017217 | 3300044719 | Bacteria | 3195 |
| 270 | Ga0466971_0035329 | 3300044719 | Bacteria | 2240 |
| 271 | Ga0466968_0098308 | 3300044735 | Unclassified | 1304 |
| 272 | Ga0466968_0108299 | 3300044735 | Unclassified | 1247 |
| 273 | Ga0466970_0223431 | 3300044765 | Bacteria | 1051 |
| 274 | Ga0466957_0010391 | 3300044842 | Bacteria | 5341 |
| 275 | Ga0466957_0141197 | 3300044842 | Unclassified | 1552 |
| 276 | Ga0466959_0015963 | 3300045049 | Bacteria | 5480 |
| 277 | Ga0466959_0051930 | 3300045049 | Bacteria | 3004 |
| 278 | Ga0466959_0101240 | 3300045049 | Bacteria | 2062 |
| 279 | Ga0466959_0128160 | 3300045049 | Bacteria | 1800 |
| 280 | Ga0451576_0000002 | 3300045051 | Bacteria | 1670975 |
| 281 | Ga0466958_0015595 | 3300045836 | Bacteria | 4357 |
| 282 | Ga0466958_0024767 | 3300045836 | Bacteria | 3532 |
| 283 | Ga0466958_0073685 | 3300045836 | Bacteria | 2092 |
| 284 | Ga0466958_0281896 | 3300045836 | Bacteria | 1065 |
| 285 | Ga0466967_0009592 | 3300045976 | Bacteria | 7194 |
| 286 | Ga0466967_0009747 | 3300045976 | Bacteria | 7157 |
| 287 | Ga0466967_0025233 | 3300045976 | Bacteria | 4899 |
| 288 | Ga0466967_0041167 | 3300045976 | Bacteria | 3981 |
| 289 | Ga0466967_0049369 | 3300045976 | Bacteria | 3680 |
| 290 | Ga0466967_0069271 | 3300045976 | Bacteria | 3152 |
| 291 | Ga0466967_0091551 | 3300045976 | Bacteria | 2764 |
| 292 | Ga0466967_0092214 | 3300045976 | Bacteria | 2754 |
| 293 | Ga0466967_0160239 | 3300045976 | Bacteria | 2111 |
| 294 | Ga0466967_0273599 | 3300045976 | Bacteria | 1619 |
| 295 | Ga0466967_0349033 | 3300045976 | Bacteria | 1432 |
| 296 | Ga0466967_0442995 | 3300045976 | Bacteria | 1269 |
| 297 | Ga0466967_0513453 | 3300045976 | Bacteria | 1177 |
| 298 | Ga0495592_0127106 | 3300046454 | Bacteria | 1787 |
| 299 | Ga0495629_0002364 | 3300046459 | Bacteria | 14519 |
| 300 | Ga0495629_0150238 | 3300046459 | Bacteria | 1619 |
| 301 | Ga0495629_0193292 | 3300046459 | Bacteria | 1408 |
| 302 | Ga0495641_0001141 | 3300046461 | Bacteria | 22883 |
| 303 | Ga0495641_0033837 | 3300046461 | Bacteria | 2422 |
| 304 | Ga0495641_0043527 | 3300046461 | Bacteria | 2076 |
| 305 | Ga0495641_0048241 | 3300046461 | Bacteria | 1953 |
| 306 | Ga0495641_0130240 | 3300046461 | Bacteria | 1123 |
| 307 | Ga0495651_0004075 | 3300046462 | Bacteria | 11176 |
| 308 | Ga0495653_0017908 | 3300046463 | Bacteria | 5759 |
| 309 | Ga0495653_0037056 | 3300046463 | Bacteria | 3836 |
| 310 | Ga0495582_0000219 | 3300046473 | Bacteria | 31735 |
| 311 | Ga0495582_0262286 | 3300046473 | Bacteria | 991 |
| 312 | Ga0495662_0005886 | 3300046476 | Bacteria | 6130 |
| 313 | Ga0495585_0133623 | 3300046492 | Bacteria | 1304 |
| 314 | Ga0495594_0180367 | 3300046499 | Bacteria | 1202 |
| 315 | Ga0495608_0018108 | 3300046511 | Bacteria | 4864 |
| 316 | Ga0495608_0108505 | 3300046511 | Bacteria | 1785 |
| 317 | Ga0495618_0094566 | 3300046514 | Bacteria | 1911 |
| 318 | Ga0495628_0040271 | 3300046516 | Bacteria | 3734 |
| 319 | Ga0495628_0079756 | 3300046516 | Bacteria | 2545 |
| 320 | Ga0495628_0139852 | 3300046516 | Unclassified | 1848 |
| 321 | Ga0495630_0020061 | 3300046517 | Bacteria | 4923 |
| 322 | Ga0495630_0025302 | 3300046517 | Bacteria | 4387 |
| 323 | Ga0495630_0030253 | 3300046517 | Bacteria | 4027 |
| 324 | Ga0495630_0164415 | 3300046517 | Bacteria | 1689 |
| 325 | Ga0495644_0084960 | 3300046523 | Bacteria | 1193 |
| 326 | Ga0495652_0300923 | 3300046529 | Bacteria | 1166 |
| 327 | Ga0495665_0003758 | 3300046531 | Bacteria | 8216 |
| 328 | Ga0495640_0088796 | 3300046533 | Bacteria | 2042 |
| 329 | Ga0495586_0008736 | 3300046535 | Bacteria | 5393 |
| 330 | Ga0495667_0011789 | 3300046559 | Bacteria | 5922 |
| 331 | Ga0495667_0063906 | 3300046559 | Bacteria | 2408 |
| 332 | Ga0495667_0171658 | 3300046559 | Bacteria | 1393 |
| 333 | Ga0495656_0081715 | 3300046615 | Bacteria | 1459 |
| 334 | Ga0495634_0007256 | 3300046642 | Bacteria | 8353 |
| 335 | Ga0495634_0021302 | 3300046642 | Bacteria | 4585 |
| 336 | Ga0495634_0036195 | 3300046642 | Bacteria | 3377 |
| 337 | Ga0495635_0016943 | 3300046663 | Bacteria | 5090 |
| 338 | Ga0495635_0051459 | 3300046663 | Bacteria | 2838 |
| 339 | Ga0495635_0361061 | 3300046663 | Bacteria | 968 |
| 340 | Ga0495659_0032099 | 3300046664 | Bacteria | 1836 |
| 341 | Ga0495657_0017573 | 3300046675 | Bacteria | 5188 |
| 342 | Ga0495657_0037742 | 3300046675 | Bacteria | 3327 |
| 343 | Ga0495657_0058039 | 3300046675 | Bacteria | 2571 |
| 344 | Ga0495657_0212154 | 3300046675 | Unclassified | 1177 |
| 345 | Ga0495623_0174171 | 3300046679 | Bacteria | 1255 |
| 346 | Ga0495647_0057823 | 3300046681 | Bacteria | 1523 |
| 347 | Ga0495658_0000020 | 3300046683 | Bacteria | 87200 |
| 348 | Ga0495658_0012588 | 3300046683 | Bacteria | 4290 |
| 349 | Ga0495613_0010585 | 3300046689 | Bacteria | 6840 |
| 350 | Ga0495613_0049479 | 3300046689 | Bacteria | 3102 |
| 351 | Ga0495624_0008910 | 3300046690 | Bacteria | 6974 |
| 352 | Ga0495624_0088152 | 3300046690 | Bacteria | 1916 |
| 353 | Ga0495600_0045013 | 3300046809 | Bacteria | 2879 |
| 354 | Ga0495581_0001595 | 3300047315 | Bacteria | 12659 |
| 355 | Ga0495604_0028887 | 3300047317 | Bacteria | 4412 |
| 356 | Ga0495604_0164835 | 3300047317 | Bacteria | 1563 |
| 357 | Ga0495604_0320895 | 3300047317 | Bacteria | 1035 |
| 358 | Ga0495674_0002446 | 3300047319 | Bacteria | 18147 |
| 359 | Ga0495674_0031450 | 3300047319 | Bacteria | 4821 |
| 360 | Ga0495674_0036584 | 3300047319 | Bacteria | 4418 |
| 361 | Ga0495674_0043407 | 3300047319 | Bacteria | 4002 |
| 362 | Ga0495674_0074216 | 3300047319 | Bacteria | 2930 |
| 363 | Ga0495676_0000726 | 3300047321 | Bacteria | 27488 |
| 364 | Ga0495676_0047792 | 3300047321 | Bacteria | 3456 |
| 365 | Ga0495676_0114235 | 3300047321 | Bacteria | 1976 |
| 366 | Ga0495680_0001503 | 3300047322 | Bacteria | 25013 |
| 367 | Ga0495680_0004979 | 3300047322 | Bacteria | 12557 |
| 368 | Ga0495680_0022731 | 3300047322 | Bacteria | 5224 |
| 369 | Ga0495680_0084672 | 3300047322 | Unclassified | 2389 |
| 370 | Ga0495684_0006909 | 3300047471 | Bacteria | 8811 |
| 371 | Ga0495684_0012368 | 3300047471 | Bacteria | 6583 |
| 372 | Ga0495684_0036835 | 3300047471 | Bacteria | 3751 |
| 373 | Ga0495593_0143525 | 3300047673 | Bacteria | 1209 |
| 374 | Ga0495602_0023769 | 3300048088 | Bacteria | 5963 |
| 375 | Ga0495614_0036681 | 3300048089 | Bacteria | 2104 |
| 376 | Ga0496100_0007425 | 3300048903 | Bacteria | 6047 |
| 377 | Ga0496100_0008330 | 3300048903 | Bacteria | 5779 |
| 378 | Ga0496100_0066493 | 3300048903 | Bacteria | 2391 |
| 379 | Ga0496100_0077925 | 3300048903 | Bacteria | 2230 |
| 380 | Ga0496101_0000413 | 3300048904 | Bacteria | 27636 |
| 381 | Ga0496101_0007159 | 3300048904 | Bacteria | 7213 |
| 382 | Ga0496101_0032548 | 3300048904 | Bacteria | 3671 |
| 383 | Ga0496101_0035008 | 3300048904 | Bacteria | 3550 |
| 384 | Ga0496101_0096426 | 3300048904 | Bacteria | 2207 |
| 385 | Ga0496102_0032403 | 3300048905 | Bacteria | 4694 |
| 386 | Ga0496102_0238035 | 3300048905 | Bacteria | 1717 |
| 387 | Ga0496102_0624697 | 3300048905 | Unclassified | 1000 |
| 388 | Ga0496103_0014809 | 3300048906 | Bacteria | 4637 |
| 389 | Ga0496103_0179602 | 3300048906 | Bacteria | 1360 |
| 390 | Ga0496104_0001399 | 3300048907 | Bacteria | 20880 |
| 391 | Ga0496104_0040839 | 3300048907 | Bacteria | 4349 |
| 392 | Ga0496104_0078927 | 3300048907 | Bacteria | 3137 |
| 393 | Ga0496104_0275407 | 3300048907 | Bacteria | 1596 |
| 394 | Ga0496104_0482925 | 3300048907 | Bacteria | 1150 |
| 395 | Ga0496105_0001789 | 3300048908 | Bacteria | 15361 |
| 396 | Ga0496105_0012636 | 3300048908 | Bacteria | 6687 |
| 397 | Ga0496105_0069749 | 3300048908 | Bacteria | 2905 |
| 398 | Ga0496105_0081964 | 3300048908 | Bacteria | 2665 |
| 399 | Ga0496106_0004239 | 3300048909 | Bacteria | 10676 |
| 400 | Ga0496106_0014536 | 3300048909 | Bacteria | 5816 |
| 401 | Ga0496107_0003990 | 3300048910 | Bacteria | 9939 |
| 402 | Ga0496107_0007174 | 3300048910 | Bacteria | 7679 |
| 403 | Ga0496107_0008527 | 3300048910 | Bacteria | 7095 |
| 404 | Ga0496108_0004101 | 3300048911 | Bacteria | 11699 |
| 405 | Ga0496108_0009126 | 3300048911 | Bacteria | 8027 |
| 406 | Ga0496108_0500727 | 3300048911 | Bacteria | 1061 |
| 407 | Ga0496109_0003277 | 3300048912 | Bacteria | 13512 |
| 408 | Ga0496109_0026518 | 3300048912 | Bacteria | 5168 |
| 409 | Ga0496109_0589868 | 3300048912 | Bacteria | 1047 |
| 410 | Ga0496110_0056417 | 3300048913 | Bacteria | 3457 |
| 411 | Ga0496110_0092320 | 3300048913 | Bacteria | 2709 |
| 412 | Ga0496112_0007497 | 3300048915 | Bacteria | 9687 |
| 413 | Ga0496112_0015396 | 3300048915 | Bacteria | 7137 |
| 414 | Ga0496112_0038436 | 3300048915 | Bacteria | 4673 |
| 415 | Ga0496112_0056619 | 3300048915 | Bacteria | 3859 |
| 416 | Ga0496112_0099824 | 3300048915 | Bacteria | 2873 |
| 417 | Ga0496112_0211998 | 3300048915 | Bacteria | 1894 |
| 418 | Ga0496112_0618610 | 3300048915 | Bacteria | 1014 |
| 419 | Ga0496113_0022328 | 3300048916 | Bacteria | 4474 |
| 420 | Ga0496113_0061170 | 3300048916 | Bacteria | 2841 |
| 421 | Ga0496113_0083587 | 3300048916 | Bacteria | 2450 |
| 422 | Ga0496113_0292369 | 3300048916 | Bacteria | 1304 |
| 423 | Ga0496114_0001014 | 3300048917 | Bacteria | 21080 |
| 424 | Ga0496114_0015823 | 3300048917 | Bacteria | 6070 |
| 425 | Ga0496114_0017072 | 3300048917 | Bacteria | 5855 |
| 426 | Ga0496114_0047120 | 3300048917 | Bacteria | 3584 |
| 427 | Ga0496114_0101082 | 3300048917 | Bacteria | 2461 |
| 428 | Ga0496114_0141764 | 3300048917 | Bacteria | 2081 |
| 429 | Ga0496114_0243981 | 3300048917 | Bacteria | 1580 |
| 430 | Ga0496115_0000905 | 3300048918 | Bacteria | 21521 |
| 431 | Ga0496115_0075680 | 3300048918 | Bacteria | 2735 |
| 432 | Ga0496115_0229251 | 3300048918 | Bacteria | 1532 |
| 433 | Ga0496115_0255096 | 3300048918 | Bacteria | 1443 |
| 434 | Ga0496115_0509495 | 3300048918 | Bacteria | 966 |
| 435 | Ga0501034_0072955 | 3300049571 | Bacteria | 3441 |
| 436 | Ga0501047_0014373 | 3300049581 | Bacteria | 7527 |
| 437 | Ga0501067_0113298 | 3300049583 | Bacteria | 1508 |
| 438 | Ga0501069_0064275 | 3300049585 | Bacteria | 2051 |
| 439 | Ga0501069_0184529 | 3300049585 | Bacteria | 1206 |
| 440 | Ga0501070_0000228 | 3300049586 | Bacteria | 52799 |
| 441 | Ga0501070_0046697 | 3300049586 | Bacteria | 3601 |
| 442 | Ga0501070_0086882 | 3300049586 | Bacteria | 2589 |
| 443 | Ga0501070_0260740 | 3300049586 | Bacteria | 1417 |
| 444 | Ga0501223_003073 | 3300049663 | Bacteria | 3646 |
| 445 | Ga0501083_0338130 | 3300049744 | Bacteria | 979 |
| 446 | Ga0501035_0432064 | 3300049822 | Bacteria | 1092 |
| 447 | nmdc:mga0yw44_17977_c1 | 3300050492 | Bacteria | 3862 |
| 448 | nmdc:mga05p37_370416_c1 | 3300050507 | Bacteria | 1681 |
| 449 | nmdc:mga08y16_160897_c1 | 3300050511 | Bacteria | 2333 |
| 450 | nmdc:mga0n895_38467_c1 | 3300050512 | Bacteria | 4635 |
| 451 | nmdc:mga0n895_655362_c1 | 3300050512 | Bacteria | 1048 |
| 452 | nmdc:mga0rr50_45515_c1 | 3300050513 | Bacteria | 3226 |
| 453 | nmdc:mga0a205_28434_c2 | 3300050515 | Bacteria | 3916 |
| 454 | Ga0495601_0007822 | 3300053077 | Bacteria | 6289 |
| 455 | Ga0495601_0073265 | 3300053077 | Unclassified | 2189 |
| 456 | Ga0495595_0053094 | 3300053084 | Bacteria | 1882 |
| 457 | Ga0495619_0007146 | 3300053085 | Bacteria | 7070 |
| 458 | Ga0495619_0015801 | 3300053085 | Bacteria | 4779 |
| 459 | Ga0495619_0016567 | 3300053085 | Bacteria | 4666 |
| 460 | Ga0466962_0015684 | 3300061719 | Bacteria | 3652 |
| 461 | 2524004469 | 2523533629 | Bacteria | 2982326 |
| 462 | 2839990233 | 2839989709 | Bacteria | 3773432 |
| 463 | 2842904348 | 2842903701 | Bacteria | 6986368 |
| 464 | Ga0070707_100117630 | |||
| 465 | rootH1_10278812 | |||
| 466 | Ga0070658_10211998 | |||
| 467 | Ga0070683_100013066 | |||
| 468 | Ga0070683_100035630 | |||
| 469 | Ga0070683_100194515 | |||
| 470 | Ga0070683_100340831 | |||
| 471 | Ga0070683_100366635 | |||
| 472 | Ga0070680_100001740 | |||
| 473 | Ga0070680_100028646 | |||
| 474 | Ga0070680_100043595 | |||
| 475 | Ga0070680_100371406 | |||
| 476 | Ga0070682_100181405 | |||
| 477 | Ga0068868_100429731 | |||
| 478 | Ga0070660_100000838 | |||
| 479 | Ga0070660_100004651 | |||
| 480 | Ga0070660_100022622 | |||
| 481 | Ga0070660_100087688 | |||
| 482 | Ga0070661_100054241 | |||
| 483 | Ga0070661_100086058 | |||
| 484 | Ga0070671_100142005 | |||
| 485 | Ga0070659_100096384 | |||
| 486 | Ga0070667_100393008 | |||
| 487 | Ga0070709_10100875 | |||
| 488 | Ga0070714_100470482 | |||
| 489 | Ga0070713_100051879 | |||
| 490 | Ga0070713_100155817 | |||
| 491 | Ga0070713_100300688 | |||
| 492 | Ga0070713_100504673 | |||
| 493 | Ga0070711_100025946 | |||
| 494 | Ga0070711_100248934 | |||
| 495 | Ga0070711_100314571 | |||
| 496 | Ga0070694_100087250 | |||
| 497 | Ga0070708_100033907 | |||
| 498 | Ga0070708_100085803 | |||
| 499 | Ga0070681_10000130 | |||
| 500 | Ga0070681_10003736 | |||
| 501 | Ga0070681_10004350 | |||
| 502 | Ga0070681_10104811 | |||
| 503 | Ga0070681_10120204 | |||
| 504 | Ga0070681_10123734 | |||
| 505 | Ga0070706_100015919 | |||
| 506 | Ga0070707_100004757 | |||
| 507 | Ga0070698_100021238 | |||
| 508 | Ga0070698_100291132 | |||
| 509 | Ga0070679_100015446 | |||
| 510 | Ga0070679_100019347 | |||
| 511 | Ga0070679_100203519 | |||
| 512 | Ga0070684_100001412 | |||
| 513 | Ga0070684_100088985 | |||
| 514 | Ga0070684_100127562 | |||
| 515 | Ga0070684_100151125 | |||
| 516 | Ga0068853_100593469 | |||
| 517 | Ga0070665_100109129 | |||
| 518 | Ga0068855_100007768 | |||
| 519 | Ga0068855_100052032 | |||
| 520 | Ga0068855_100052814 | |||
| 521 | Ga0068855_100084972 | |||
| 522 | Ga0068855_100126286 | |||
| 523 | Ga0068855_100127576 | |||
| 524 | Ga0068857_100128503 | |||
| 525 | Ga0068857_100296692 | |||
| 526 | Ga0081455_10170095 | |||
| 527 | Ga0081455_10200679 | |||
| 528 | Ga0070717_10082566 | |||
| 529 | Ga0070717_10280776 | |||
| 530 | Ga0075365_10004605 | |||
| 531 | Ga0070712_100013817 | |||
| 532 | Ga0097621_100282266 | |||
| 533 | Ga0068871_100383914 | |||
| 534 | Ga0075428_100607373 | |||
| 535 | Ga0075433_10012284 | |||
| 536 | Ga0075435_100026940 | |||
| 537 | Ga0105240_10014721 | |||
| 538 | Ga0105240_10384892 | |||
| 539 | Ga0111539_10010446 | |||
| 540 | Ga0105245_10316464 | |||
| 541 | Ga0114129_10405927 | |||
| 542 | Ga0114129_10497068 | |||
| 543 | Ga0105241_10175716 | |||
| 544 | Ga0105242_10029747 | |||
| 545 | Ga0105242_10047142 | |||
| 546 | Ga0105242_10194840 | |||
| 547 | Ga0105237_10164959 | |||
| 548 | Ga0105238_10116963 | |||
| 549 | Ga0105239_10144395 | |||
| 550 | Ga0157370_10011524 | |||
| 551 | Ga0157370_10014156 | |||
| 552 | Ga0157370_10029452 | |||
| 553 | Ga0157370_10030785 | |||
| 554 | Ga0157370_10236044 | |||
| 555 | Ga0157369_10000274 | |||
| 556 | Ga0157369_10012696 | |||
| 557 | Ga0157369_10072131 | |||
| 558 | Ga0157369_10134496 | |||
| 559 | Ga0157369_10167499 | |||
| 560 | Ga0157369_10266788 | |||
| 561 | Ga0157374_10299145 | |||
| 562 | Ga0157372_10055102 | |||
| 563 | Ga0157372_10113631 | |||
| 564 | Ga0157372_10134849 | |||
| 565 | Ga0157372_10283898 | |||
| 566 | Ga0157375_10040089 | |||
| 567 | Ga0157380_10003893 | |||
| 568 | Ga0182008_10014308 | |||
| 569 | Ga0182008_10023404 | |||
| 570 | Ga0182008_10076467 | |||
| 571 | Ga0182007_10012160 | |||
| 572 | Ga0182007_10048896 | |||
| 573 | Ga0206356_10273602 | |||
| 574 | Ga0206354_11064135 | |||
| 575 | Ga0206353_10459516 | |||
| 576 | Ga0206353_11095007 | |||
| 577 | Ga0213871_10014356 | |||
| 578 | Ga0207705_10010059 | |||
| 579 | Ga0207705_10182690 | |||
| 580 | Ga0207684_10014952 | |||
| 581 | Ga0207707_10007369 | |||
| 582 | Ga0207707_10023280 | |||
| 583 | Ga0207707_10383135 | |||
| 584 | Ga0207695_10111482 | |||
| 585 | Ga0207695_10422966 | |||
| 586 | Ga0207671_10201172 | |||
| 587 | Ga0207693_10001636 | |||
| 588 | Ga0207693_10034024 | |||
| 589 | Ga0207693_10056128 | |||
| 590 | Ga0207663_10177955 | |||
| 591 | Ga0207660_10029806 | |||
| 592 | Ga0207660_10036525 | |||
| 593 | Ga0207657_10000976 | |||
| 594 | Ga0207657_10002512 | |||
| 595 | Ga0207657_10016038 | |||
| 596 | Ga0207657_10021635 | |||
| 597 | Ga0207657_10080712 | |||
| 598 | Ga0207649_10025750 | |||
| 599 | Ga0207649_10295281 | |||
| 600 | Ga0207652_10021027 | |||
| 601 | Ga0207652_10043134 | |||
| 602 | Ga0207652_10078827 | |||
| 603 | Ga0207652_10187262 | |||
| 604 | Ga0207652_10381529 | |||
| 605 | Ga0207646_10267481 | |||
| 606 | Ga0207694_10209310 | |||
| 607 | Ga0207694_10250840 | |||
| 608 | Ga0207700_10050128 | |||
| 609 | Ga0207664_10069157 | |||
| 610 | Ga0207686_10045066 | |||
| 611 | Ga0207686_10045631 | |||
| 612 | Ga0207686_10084479 | |||
| 613 | Ga0207686_10093364 | |||
| 614 | Ga0207665_10069350 | |||
| 615 | Ga0207661_10024732 | |||
| 616 | Ga0207661_10115131 | |||
| 617 | Ga0207661_10158975 | |||
| 618 | Ga0207661_10270776 | |||
| 619 | Ga0207667_10071038 | |||
| 620 | Ga0207667_10092134 | |||
| 621 | Ga0207667_10256009 | |||
| 622 | Ga0207658_10303397 | |||
| 623 | Ga0207678_10045607 | |||
| 624 | Ga0207678_10105589 | |||
| 625 | Ga0207702_10367984 | |||
| 626 | Ga0207674_10200170 | |||
| 627 | Ga0207674_10203900 | |||
| 628 | Ga0207683_10510463 | |||
| 629 | Ga0207698_10035958 | |||
| 630 | Ga0207698_10335292 | |||
| 631 | Ga0207428_10048776 | |||
| 632 | Ga0268266_10115069 | |||
| 633 | Ga0268266_10386076 | |||
| 634 | Ga0268265_10079650 | |||
| 635 | Ga0265338_10082052 | |||
| 636 | Ga0265338_10099663 | |||
| 637 | Ga0265338_10185346 | |||
| 638 | Ga0316177_1044313 | |||
| 639 | Ga0316176_1043240 | |||
| 640 | Ga0316181_1130119 | |||
| 641 | Ga0316182_1154965 | |||
| 642 | Ga0265320_10019125 | |||
| 643 | Ga0265327_10025245 | |||
| 644 | Ga0265327_10052251 | |||
| 645 | Ga0307408_100000389 | |||
| 646 | Ga0307408_100197453 | |||
| 647 | Ga0265313_10050288 | |||
| 648 | Ga0307412_10018240 | |||
| 649 | Ga0307412_10069233 | |||
| 650 | Ga0307416_100180252 | |||
| 651 | Ga0307414_10015326 | |||
| 652 | Ga0307414_10035800 | |||
| 653 | Ga0307414_10197855 | |||
| 654 | Ga0373944_0052690 | |||
| 655 | Ga0373945_0005439 | |||
| 656 | Ga0373945_0014519 | |||
| 657 | Ga0373943_0000321 | |||
| 658 | Ga0373943_0016359 | |||
| 659 | Ga0373946_0013685 | |||
| 660 | Ga0373935_0015054 | |||
| 661 | Ga0373935_0045537 | |||
| 662 | Ga0373935_0233600 | |||
| 663 | Ga0373927_0158333 | |||
| 664 | Ga0373947_0001733 | |||
| 665 | Ga0373947_0019472 | |||
| 666 | Ga0373947_0126393 | |||
| 667 | Ga0373937_0062305 | |||
| 668 | Ga0373937_0155484 | |||
| 669 | Ga0373925_0008675 | |||
| 670 | Ga0373925_0037423 | |||
| 671 | Ga0395899_0017632 | |||
| 672 | Ga0395899_0021861 | |||
| 673 | Ga0395899_0083360 | |||
| 674 | Ga0395899_0094478 | |||
| 675 | Ga0395899_0270162 | |||
| 676 | Ga0395900_0001712 | |||
| 677 | Ga0395900_0006471 | |||
| 678 | Ga0395900_0031612 | |||
| 679 | Ga0395900_0090784 | |||
| 680 | Ga0395900_0145434 | |||
| 681 | Ga0395900_0323308 | |||
| 682 | Ga0395900_0426545 | |||
| 683 | Ga0395900_0580761 | |||
| 684 | Ga0395898_0001935 | |||
| 685 | Ga0395898_0002702 | |||
| 686 | Ga0395898_0007872 | |||
| 687 | Ga0395898_0029423 | |||
| 688 | Ga0395898_0038231 | |||
| 689 | Ga0395898_0041401 | |||
| 690 | Ga0395898_0081187 | |||
| 691 | Ga0395898_0119714 | |||
| 692 | Ga0395898_0276966 | |||
| 693 | Ga0395898_0363301 | |||
| 694 | Ga0395905_0002251 | |||
| 695 | Ga0395905_0004857 | |||
| 696 | Ga0395905_0006548 | |||
| 697 | Ga0395905_0008968 | |||
| 698 | Ga0395905_0028354 | |||
| 699 | Ga0395905_0031773 | |||
| 700 | Ga0395905_0217422 | |||
| 701 | Ga0395905_0384717 | |||
| 702 | Ga0395901_0004308 | |||
| 703 | Ga0395901_0005287 | |||
| 704 | Ga0395901_0005519 | |||
| 705 | Ga0395901_0008516 | |||
| 706 | Ga0395901_0010249 | |||
| 707 | Ga0395901_0031330 | |||
| 708 | Ga0395901_0032173 | |||
| 709 | Ga0395901_0070564 | |||
| 710 | Ga0395901_0110473 | |||
| 711 | Ga0395901_0189528 | |||
| 712 | Ga0395901_0210378 | |||
| 713 | Ga0395901_0320321 | |||
| 714 | Ga0395901_0882593 | |||
| 715 | Ga0436365_1463753 | |||
| 716 | Ga0436360_0873850 | |||
| 717 | Ga0439431_0042527 | |||
| 718 | Ga0439457_031014 | |||
| 719 | Ga0450894_022134 | |||
| 720 | Ga0466961_0046268 | |||
| 721 | Ga0466961_0209024 | |||
| 722 | Ga0466963_0003087 | |||
| 723 | Ga0466963_0004327 | |||
| 724 | Ga0466963_0012459 | |||
| 725 | Ga0466963_0031883 | |||
| 726 | Ga0466963_0064876 | |||
| 727 | Ga0466963_0143931 | |||
| 728 | Ga0466963_0238880 | |||
| 729 | Ga0466964_0013203 | |||
| 730 | Ga0466964_0027106 | |||
| 731 | Ga0466964_0061443 | |||
| 732 | Ga0466971_0017217 | |||
| 733 | Ga0466971_0035329 | |||
| 734 | Ga0466968_0098308 | |||
| 735 | Ga0466968_0108299 | |||
| 736 | Ga0466970_0223431 | |||
| 737 | Ga0466957_0010391 | |||
| 738 | Ga0466957_0141197 | |||
| 739 | Ga0466959_0015963 | |||
| 740 | Ga0466959_0051930 | |||
| 741 | Ga0466959_0101240 | |||
| 742 | Ga0466959_0128160 | |||
| 743 | Ga0451576_0000002 | |||
| 744 | Ga0466958_0015595 | |||
| 745 | Ga0466958_0024767 | |||
| 746 | Ga0466958_0073685 | |||
| 747 | Ga0466958_0281896 | |||
| 748 | Ga0466967_0009592 | |||
| 749 | Ga0466967_0009747 | |||
| 750 | Ga0466967_0025233 | |||
| 751 | Ga0466967_0041167 | |||
| 752 | Ga0466967_0049369 | |||
| 753 | Ga0466967_0069271 | |||
| 754 | Ga0466967_0091551 | |||
| 755 | Ga0466967_0092214 | |||
| 756 | Ga0466967_0160239 | |||
| 757 | Ga0466967_0273599 | |||
| 758 | Ga0466967_0349033 | |||
| 759 | Ga0466967_0442995 | |||
| 760 | Ga0466967_0513453 | |||
| 761 | Ga0495592_0127106 | |||
| 762 | Ga0495629_0002364 | |||
| 763 | Ga0495629_0150238 | |||
| 764 | Ga0495629_0193292 | |||
| 765 | Ga0495641_0001141 | |||
| 766 | Ga0495641_0033837 | |||
| 767 | Ga0495641_0043527 | |||
| 768 | Ga0495641_0048241 | |||
| 769 | Ga0495641_0130240 | |||
| 770 | Ga0495651_0004075 | |||
| 771 | Ga0495653_0017908 | |||
| 772 | Ga0495653_0037056 | |||
| 773 | Ga0495582_0000219 | |||
| 774 | Ga0495582_0262286 | |||
| 775 | Ga0495662_0005886 | |||
| 776 | Ga0495585_0133623 | |||
| 777 | Ga0495594_0180367 | |||
| 778 | Ga0495608_0018108 | |||
| 779 | Ga0495608_0108505 | |||
| 780 | Ga0495618_0094566 | |||
| 781 | Ga0495628_0040271 | |||
| 782 | Ga0495628_0079756 | |||
| 783 | Ga0495628_0139852 | |||
| 784 | Ga0495630_0020061 | |||
| 785 | Ga0495630_0025302 | |||
| 786 | Ga0495630_0030253 | |||
| 787 | Ga0495630_0164415 | |||
| 788 | Ga0495644_0084960 | |||
| 789 | Ga0495652_0300923 | |||
| 790 | Ga0495665_0003758 | |||
| 791 | Ga0495640_0088796 | |||
| 792 | Ga0495586_0008736 | |||
| 793 | Ga0495667_0011789 | |||
| 794 | Ga0495667_0063906 | |||
| 795 | Ga0495667_0171658 | |||
| 796 | Ga0495656_0081715 | |||
| 797 | Ga0495634_0007256 | |||
| 798 | Ga0495634_0021302 | |||
| 799 | Ga0495634_0036195 | |||
| 800 | Ga0495635_0016943 | |||
| 801 | Ga0495635_0051459 | |||
| 802 | Ga0495635_0361061 | |||
| 803 | Ga0495659_0032099 | |||
| 804 | Ga0495657_0017573 | |||
| 805 | Ga0495657_0037742 | |||
| 806 | Ga0495657_0058039 | |||
| 807 | Ga0495657_0212154 | |||
| 808 | Ga0495623_0174171 | |||
| 809 | Ga0495647_0057823 | |||
| 810 | Ga0495658_0000020 | |||
| 811 | Ga0495658_0012588 | |||
| 812 | Ga0495613_0010585 | |||
| 813 | Ga0495613_0049479 | |||
| 814 | Ga0495624_0008910 | |||
| 815 | Ga0495624_0088152 | |||
| 816 | Ga0495600_0045013 | |||
| 817 | Ga0495581_0001595 | |||
| 818 | Ga0495604_0028887 | |||
| 819 | Ga0495604_0164835 | |||
| 820 | Ga0495604_0320895 | |||
| 821 | Ga0495674_0002446 | |||
| 822 | Ga0495674_0031450 | |||
| 823 | Ga0495674_0036584 | |||
| 824 | Ga0495674_0043407 | |||
| 825 | Ga0495674_0074216 | |||
| 826 | Ga0495676_0000726 | |||
| 827 | Ga0495676_0047792 | |||
| 828 | Ga0495676_0114235 | |||
| 829 | Ga0495680_0001503 | |||
| 830 | Ga0495680_0004979 | |||
| 831 | Ga0495680_0022731 | |||
| 832 | Ga0495680_0084672 | |||
| 833 | Ga0495684_0006909 | |||
| 834 | Ga0495684_0012368 | |||
| 835 | Ga0495684_0036835 | |||
| 836 | Ga0495593_0143525 | |||
| 837 | Ga0495602_0023769 | |||
| 838 | Ga0495614_0036681 | |||
| 839 | Ga0496100_0007425 | |||
| 840 | Ga0496100_0008330 | |||
| 841 | Ga0496100_0066493 | |||
| 842 | Ga0496100_0077925 | |||
| 843 | Ga0496101_0000413 | |||
| 844 | Ga0496101_0007159 | |||
| 845 | Ga0496101_0032548 | |||
| 846 | Ga0496101_0035008 | |||
| 847 | Ga0496101_0096426 | |||
| 848 | Ga0496102_0032403 | |||
| 849 | Ga0496102_0238035 | |||
| 850 | Ga0496102_0624697 | |||
| 851 | Ga0496103_0014809 | |||
| 852 | Ga0496103_0179602 | |||
| 853 | Ga0496104_0001399 | |||
| 854 | Ga0496104_0040839 | |||
| 855 | Ga0496104_0078927 | |||
| 856 | Ga0496104_0275407 | |||
| 857 | Ga0496104_0482925 | |||
| 858 | Ga0496105_0001789 | |||
| 859 | Ga0496105_0012636 | |||
| 860 | Ga0496105_0069749 | |||
| 861 | Ga0496105_0081964 | |||
| 862 | Ga0496106_0004239 | |||
| 863 | Ga0496106_0014536 | |||
| 864 | Ga0496107_0003990 | |||
| 865 | Ga0496107_0007174 | |||
| 866 | Ga0496107_0008527 | |||
| 867 | Ga0496108_0004101 | |||
| 868 | Ga0496108_0009126 | |||
| 869 | Ga0496108_0500727 | |||
| 870 | Ga0496109_0003277 | |||
| 871 | Ga0496109_0026518 | |||
| 872 | Ga0496109_0589868 | |||
| 873 | Ga0496110_0056417 | |||
| 874 | Ga0496110_0092320 | |||
| 875 | Ga0496112_0007497 | |||
| 876 | Ga0496112_0015396 | |||
| 877 | Ga0496112_0038436 | |||
| 878 | Ga0496112_0056619 | |||
| 879 | Ga0496112_0099824 | |||
| 880 | Ga0496112_0211998 | |||
| 881 | Ga0496112_0618610 | |||
| 882 | Ga0496113_0022328 | |||
| 883 | Ga0496113_0061170 | |||
| 884 | Ga0496113_0083587 | |||
| 885 | Ga0496113_0292369 | |||
| 886 | Ga0496114_0001014 | |||
| 887 | Ga0496114_0015823 | |||
| 888 | Ga0496114_0017072 | |||
| 889 | Ga0496114_0047120 | |||
| 890 | Ga0496114_0101082 | |||
| 891 | Ga0496114_0141764 | |||
| 892 | Ga0496114_0243981 | |||
| 893 | Ga0496115_0000905 | |||
| 894 | Ga0496115_0075680 | |||
| 895 | Ga0496115_0229251 | |||
| 896 | Ga0496115_0255096 | |||
| 897 | Ga0496115_0509495 | |||
| 898 | Ga0501034_0072955 | |||
| 899 | Ga0501047_0014373 | |||
| 900 | Ga0501067_0113298 | |||
| 901 | Ga0501069_0064275 | |||
| 902 | Ga0501069_0184529 | |||
| 903 | Ga0501070_0000228 | |||
| 904 | Ga0501070_0046697 | |||
| 905 | Ga0501070_0086882 | |||
| 906 | Ga0501070_0260740 | |||
| 907 | Ga0501223_003073 | |||
| 908 | Ga0501083_0338130 | |||
| 909 | Ga0501035_0432064 | |||
| 910 | nmdc:mga0yw44_17977_c1 | |||
| 911 | nmdc:mga05p37_370416_c1 | |||
| 912 | nmdc:mga08y16_160897_c1 | |||
| 913 | nmdc:mga0n895_38467_c1 | |||
| 914 | nmdc:mga0n895_655362_c1 | |||
| 915 | nmdc:mga0rr50_45515_c1 | |||
| 916 | nmdc:mga0a205_28434_c2 | |||
| 917 | Ga0495601_0007822 | |||
| 918 | Ga0495601_0073265 | |||
| 919 | Ga0495595_0053094 | |||
| 920 | Ga0495619_0007146 | |||
| 921 | Ga0495619_0015801 | |||
| 922 | Ga0495619_0016567 | |||
| 923 | Ga0466962_0015684 | |||
| 924 | 2524004469 | |||
| 925 | 2839990233 | |||
| 926 | 2842904348 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
76
281
0.81
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ahh-assembly1.cif.gz_A | opua inhibited inward-facing, sbd docked | 0.8303 | 70 | 264 |
| 7ahc-assembly1.cif.gz_B | opua apo inward-facing | 0.7954 | 67 | 264 |
| 2onk-assembly2.cif.gz_I | abc transporter modbc in complex with its binding protein moda | 0.7644 | 24 | 265 |
| 4jbw-assembly2.cif.gz_I | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.7562 | 67 | 266 |
| 3d31-assembly1.cif.gz_C | modbc from methanosarcina acetivorans | 0.7426 | 25 | 263 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WG09_26_296_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9266 | 15 | 266 | 1.10.3720.10 |
| af_P9WG11_24_299_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9179 | 12 | 266 | 1.10.3720.10 |
| af_Q2FYP8_79_307_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9177 | 67 | 271 | 1.10.3720.10 |
| af_P07654_38_293_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9054 | 30 | 264 | 1.10.3720.10 |
| af_Q58419_14_276_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.88 | 18 | 264 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538JHT3-F1-model_v4 | Phosphate transport system permease protein PstA | 0.9543 | 7 | 276 |
GO:0005315
GO:0005886 GO:0035435 |
| AF-A0A2T7YWL0-F1-model_v4 | deleted | 0.9484 | 64 | 272 |
|
| AF-A0A7G1I7T9-F1-model_v4 | Phosphate transport system permease protein PstA | 0.9471 | 62 | 275 |
GO:0005315
GO:0005886 GO:0035435 |
| AF-A0A7J3HAY6-F1-model_v4 | ABC transporter permease subunit | 0.9468 | 64 | 268 |
GO:0005886
GO:0055085 |
| AF-A0A535CHS1-F1-model_v4 | Phosphate transport system permease protein PstA | 0.9426 | 67 | 272 |
GO:0005315
GO:0005886 GO:0035435 |