F449075

General Info

Members Datasets Scaffolds Average Seq Length
463 202 926 286

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100117630|Ga0070707_1001176301
Length 307
Sequence MSEPSFNLKASGRSRRRLVVNRIAEGSALLAAARGIGALSIDFFTKGPPLFGAAGGGIAPAIAGSLLLVFIATVIALPFGVLTAIYVSEFAPEGIGRQIRLWLDVLNGFPSIVIGIFVFTIIVKTRLPVVGWGHHQSAIAGGFALAIIMLPLVARSTMEVLQLVPNHLREASYALGVSKWQTVVRVILPTSFGGILTGTTLAIARAAGETAPLLFTCAIAGQIVDWNPAHSVQSIPLTIFQYSESADPNLHQQAWAAAFILIMFVLVTSLTARYLLHRSRQKLEGSDRAGRMLNLTFVYGFFRGGGS

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
54 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
88 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
89 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
90 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
91 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
99 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
100 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
101 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
114 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
115 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
116 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
120 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
121 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
135 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
136 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
148 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
153 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
200 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
201 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
202 2842903701 Olivibacter sp. R-72191 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 0.86
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 12.74
Rhizosphere 85.96
Stem 0
Stem Tuber 0
Unclassified 6.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100117630 3300005468 Bacteria 2580
2 rootH1_10278812 3300003323 Bacteria 1175
3 Ga0070658_10211998 3300005327 Unclassified 1636
4 Ga0070683_100013066 3300005329 Bacteria 7230
5 Ga0070683_100035630 3300005329 Bacteria 4549
6 Ga0070683_100194515 3300005329 Bacteria 1926
7 Ga0070683_100340831 3300005329 Bacteria 1427
8 Ga0070683_100366635 3300005329 Bacteria 1372
9 Ga0070680_100001740 3300005336 Bacteria 15994
10 Ga0070680_100028646 3300005336 Bacteria 4469
11 Ga0070680_100043595 3300005336 Bacteria 3644
12 Ga0070680_100371406 3300005336 Bacteria 1217
13 Ga0070682_100181405 3300005337 Bacteria 1471
14 Ga0068868_100429731 3300005338 Unclassified 1145
15 Ga0070660_100000838 3300005339 Bacteria 20451
16 Ga0070660_100004651 3300005339 Bacteria 9500
17 Ga0070660_100022622 3300005339 Bacteria 4651
18 Ga0070660_100087688 3300005339 Bacteria 2449
19 Ga0070661_100054241 3300005344 Bacteria 2936
20 Ga0070661_100086058 3300005344 Bacteria 2323
21 Ga0070671_100142005 3300005355 Bacteria 2026
22 Ga0070659_100096384 3300005366 Bacteria 2376
23 Ga0070667_100393008 3300005367 Bacteria 1261
24 Ga0070709_10100875 3300005434 Unclassified 1923
25 Ga0070714_100470482 3300005435 Bacteria 1196
26 Ga0070713_100051879 3300005436 Bacteria 3394
27 Ga0070713_100155817 3300005436 Bacteria 2036
28 Ga0070713_100300688 3300005436 Bacteria 1477
29 Ga0070713_100504673 3300005436 Bacteria 1142
30 Ga0070711_100025946 3300005439 Bacteria 3837
31 Ga0070711_100248934 3300005439 Bacteria 1393
32 Ga0070711_100314571 3300005439 Bacteria 1249
33 Ga0070694_100087250 3300005444 Bacteria 2182
34 Ga0070708_100033907 3300005445 Bacteria 4437
35 Ga0070708_100085803 3300005445 Bacteria 2858
36 Ga0070681_10000130 3300005458 Bacteria 56536
37 Ga0070681_10003736 3300005458 Bacteria 14287
38 Ga0070681_10004350 3300005458 Bacteria 13473
39 Ga0070681_10104811 3300005458 Bacteria 2770
40 Ga0070681_10120204 3300005458 Archaea 2562
41 Ga0070681_10123734 3300005458 Bacteria 2519
42 Ga0070706_100015919 3300005467 Bacteria 6944
43 Ga0070707_100004757 3300005468 Bacteria 12710
44 Ga0070698_100021238 3300005471 Bacteria 6802
45 Ga0070698_100291132 3300005471 Bacteria 1564
46 Ga0070679_100015446 3300005530 Bacteria 7337
47 Ga0070679_100019347 3300005530 Bacteria 6617
48 Ga0070679_100203519 3300005530 Unclassified 1944
49 Ga0070684_100001412 3300005535 Bacteria 17270
50 Ga0070684_100088985 3300005535 Bacteria 2744
51 Ga0070684_100127562 3300005535 Bacteria 2293
52 Ga0070684_100151125 3300005535 Bacteria 2104
53 Ga0068853_100593469 3300005539 Unclassified 1052
54 Ga0070665_100109129 3300005548 Bacteria 2770
55 Ga0068855_100007768 3300005563 Bacteria 12954
56 Ga0068855_100052032 3300005563 Bacteria 4822
57 Ga0068855_100052814 3300005563 Bacteria 4783
58 Ga0068855_100084972 3300005563 Bacteria 3662
59 Ga0068855_100126286 3300005563 Bacteria 2924
60 Ga0068855_100127576 3300005563 Bacteria 2908
61 Ga0068857_100128503 3300005577 Bacteria 2284
62 Ga0068857_100296692 3300005577 Unclassified 1489
63 Ga0081455_10170095 3300005937 Bacteria 1661
64 Ga0081455_10200679 3300005937 Bacteria 1494
65 Ga0070717_10082566 3300006028 Bacteria 2701
66 Ga0070717_10280776 3300006028 Bacteria 1477
67 Ga0075365_10004605 3300006038 Bacteria 7338
68 Ga0070712_100013817 3300006175 Bacteria 5167
69 Ga0097621_100282266 3300006237 Bacteria 1462
70 Ga0068871_100383914 3300006358 Bacteria 1248
71 Ga0075428_100607373 3300006844 Bacteria 1168
72 Ga0075433_10012284 3300006852 Bacteria 6908
73 Ga0075435_100026940 3300007076 Bacteria 4491
74 Ga0105240_10014721 3300009093 Bacteria 10670
75 Ga0105240_10384892 3300009093 Bacteria 1583
76 Ga0111539_10010446 3300009094 Bacteria 11685
77 Ga0105245_10316464 3300009098 Bacteria 1536
78 Ga0114129_10405927 3300009147 Bacteria 1795
79 Ga0114129_10497068 3300009147 Bacteria 1593
80 Ga0105241_10175716 3300009174 Bacteria 1772
81 Ga0105242_10029747 3300009176 Bacteria 4357
82 Ga0105242_10047142 3300009176 Bacteria 3498
83 Ga0105242_10194840 3300009176 Bacteria 1796
84 Ga0105237_10164959 3300009545 Unclassified 2214
85 Ga0105238_10116963 3300009551 Bacteria 2646
86 Ga0105239_10144395 3300010375 Bacteria 2653
87 Ga0157370_10011524 3300013104 Bacteria 9235
88 Ga0157370_10014156 3300013104 Bacteria 8179
89 Ga0157370_10029452 3300013104 Bacteria 5386
90 Ga0157370_10030785 3300013104 Bacteria 5256
91 Ga0157370_10236044 3300013104 Bacteria 1692
92 Ga0157369_10000274 3300013105 Bacteria 69432
93 Ga0157369_10012696 3300013105 Bacteria 9554
94 Ga0157369_10072131 3300013105 Bacteria 3706
95 Ga0157369_10134496 3300013105 Bacteria 2618
96 Ga0157369_10167499 3300013105 Bacteria 2316
97 Ga0157369_10266788 3300013105 Bacteria 1785
98 Ga0157374_10299145 3300013296 Bacteria 1591
99 Ga0157372_10055102 3300013307 Bacteria 4439
100 Ga0157372_10113631 3300013307 Bacteria 3103
101 Ga0157372_10134849 3300013307 Bacteria 2843
102 Ga0157372_10283898 3300013307 Bacteria 1925
103 Ga0157375_10040089 3300013308 Bacteria 4513
104 Ga0157380_10003893 3300014326 Bacteria 10295
105 Ga0182008_10014308 3300014497 Bacteria 4157
106 Ga0182008_10023404 3300014497 Bacteria 3155
107 Ga0182008_10076467 3300014497 Bacteria 1647
108 Ga0182007_10012160 3300015262 Bacteria 3322
109 Ga0182007_10048896 3300015262 Unclassified 1397
110 Ga0206356_10273602 3300020070 Bacteria 1635
111 Ga0206354_11064135 3300020081 Bacteria 1334
112 Ga0206353_10459516 3300020082 Bacteria 2928
113 Ga0206353_11095007 3300020082 Bacteria 7110
114 Ga0213871_10014356 3300021441 Bacteria 1877
115 Ga0207705_10010059 3300025909 Bacteria 6884
116 Ga0207705_10182690 3300025909 Unclassified 1583
117 Ga0207684_10014952 3300025910 Bacteria 6680
118 Ga0207707_10007369 3300025912 Bacteria 9582
119 Ga0207707_10023280 3300025912 Bacteria 5420
120 Ga0207707_10383135 3300025912 Bacteria 1208
121 Ga0207695_10111482 3300025913 Bacteria 2715
122 Ga0207695_10422966 3300025913 Bacteria 1216
123 Ga0207671_10201172 3300025914 Unclassified 1556
124 Ga0207693_10001636 3300025915 Bacteria 19776
125 Ga0207693_10034024 3300025915 Bacteria 4020
126 Ga0207693_10056128 3300025915 Bacteria 3088
127 Ga0207663_10177955 3300025916 Bacteria 1516
128 Ga0207660_10029806 3300025917 Bacteria 3747
129 Ga0207660_10036525 3300025917 Bacteria 3416
130 Ga0207657_10000976 3300025919 Bacteria 30357
131 Ga0207657_10002512 3300025919 Bacteria 19848
132 Ga0207657_10016038 3300025919 Bacteria 7231
133 Ga0207657_10021635 3300025919 Bacteria 6046
134 Ga0207657_10080712 3300025919 Bacteria 2734
135 Ga0207649_10025750 3300025920 Bacteria 3433
136 Ga0207649_10295281 3300025920 Unclassified 1183
137 Ga0207652_10021027 3300025921 Bacteria 5382
138 Ga0207652_10043134 3300025921 Bacteria 3841
139 Ga0207652_10078827 3300025921 Bacteria 2877
140 Ga0207652_10187262 3300025921 Unclassified 1861
141 Ga0207652_10381529 3300025921 Bacteria 1272
142 Ga0207646_10267481 3300025922 Bacteria 1545
143 Ga0207694_10209310 3300025924 Bacteria 1588
144 Ga0207694_10250840 3300025924 Bacteria 1448
145 Ga0207700_10050128 3300025928 Bacteria 3110
146 Ga0207664_10069157 3300025929 Bacteria 2839
147 Ga0207686_10045066 3300025934 Bacteria 2712
148 Ga0207686_10045631 3300025934 Bacteria 2698
149 Ga0207686_10084479 3300025934 Bacteria 2080
150 Ga0207686_10093364 3300025934 Bacteria 1992
151 Ga0207665_10069350 3300025939 Bacteria 2404
152 Ga0207661_10024732 3300025944 Bacteria 4555
153 Ga0207661_10115131 3300025944 Bacteria 2281
154 Ga0207661_10158975 3300025944 Unclassified 1959
155 Ga0207661_10270776 3300025944 Bacteria 1515
156 Ga0207667_10071038 3300025949 Bacteria 3621
157 Ga0207667_10092134 3300025949 Bacteria 3130
158 Ga0207667_10256009 3300025949 Unclassified 1790
159 Ga0207658_10303397 3300025986 Bacteria 1376
160 Ga0207678_10045607 3300026067 Bacteria 3790
161 Ga0207678_10105589 3300026067 Bacteria 2403
162 Ga0207702_10367984 3300026078 Bacteria 1379
163 Ga0207674_10200170 3300026116 Bacteria 1947
164 Ga0207674_10203900 3300026116 Bacteria 1927
165 Ga0207683_10510463 3300026121 Unclassified 1111
166 Ga0207698_10035958 3300026142 Bacteria 3629
167 Ga0207698_10335292 3300026142 Unclassified 1422
168 Ga0207428_10048776 3300027907 Bacteria 3395
169 Ga0268266_10115069 3300028379 Bacteria 2387
170 Ga0268266_10386076 3300028379 Bacteria 1322
171 Ga0268265_10079650 3300028380 Bacteria 2581
172 Ga0265338_10082052 3300028800 Bacteria 2701
173 Ga0265338_10099663 3300028800 Bacteria 2372
174 Ga0265338_10185346 3300028800 Bacteria 1582
175 Ga0316177_1044313 3300030731 Bacteria 4344
176 Ga0316176_1043240 3300030732 Bacteria 38084
177 Ga0316181_1130119 3300030744 Bacteria 16613
178 Ga0316182_1154965 3300030745 Bacteria 1440
179 Ga0265320_10019125 3300031240 Bacteria 3753
180 Ga0265327_10025245 3300031251 Bacteria 3470
181 Ga0265327_10052251 3300031251 Bacteria 2129
182 Ga0307408_100000389 3300031548 Bacteria 40047
183 Ga0307408_100197453 3300031548 Bacteria 1626
184 Ga0265313_10050288 3300031595 Bacteria 2001
185 Ga0307412_10018240 3300031911 Bacteria 4219
186 Ga0307412_10069233 3300031911 Bacteria 2402
187 Ga0307416_100180252 3300032002 Bacteria 1979
188 Ga0307414_10015326 3300032004 Bacteria 4627
189 Ga0307414_10035800 3300032004 Bacteria 3307
190 Ga0307414_10197855 3300032004 Bacteria 1632
191 Ga0373944_0052690 3300035089 Bacteria 1286
192 Ga0373945_0005439 3300035116 Bacteria 4075
193 Ga0373945_0014519 3300035116 Bacteria 2640
194 Ga0373943_0000321 3300035170 Bacteria 20135
195 Ga0373943_0016359 3300035170 Bacteria 3381
196 Ga0373946_0013685 3300035171 Bacteria 3052
197 Ga0373935_0015054 3300035692 Bacteria 4671
198 Ga0373935_0045537 3300035692 Bacteria 2768
199 Ga0373935_0233600 3300035692 Bacteria 1281
200 Ga0373927_0158333 3300035695 Bacteria 1483
201 Ga0373947_0001733 3300035725 Bacteria 13339
202 Ga0373947_0019472 3300035725 Bacteria 3913
203 Ga0373947_0126393 3300035725 Bacteria 1628
204 Ga0373937_0062305 3300036401 Bacteria 3429
205 Ga0373937_0155484 3300036401 Bacteria 2143
206 Ga0373925_0008675 3300037068 Bacteria 7406
207 Ga0373925_0037423 3300037068 Bacteria 3583
208 Ga0395899_0017632 3300037312 Bacteria 5437
209 Ga0395899_0021861 3300037312 Bacteria 4853
210 Ga0395899_0083360 3300037312 Bacteria 2325
211 Ga0395899_0094478 3300037312 Bacteria 2164
212 Ga0395899_0270162 3300037312 Bacteria 1160
213 Ga0395900_0001712 3300037418 Bacteria 25354
214 Ga0395900_0006471 3300037418 Bacteria 12213
215 Ga0395900_0031612 3300037418 Bacteria 5441
216 Ga0395900_0090784 3300037418 Bacteria 3139
217 Ga0395900_0145434 3300037418 Bacteria 2424
218 Ga0395900_0323308 3300037418 Bacteria 1522
219 Ga0395900_0426545 3300037418 Bacteria 1286
220 Ga0395900_0580761 3300037418 Bacteria 1063
221 Ga0395898_0001935 3300037466 Bacteria 26310
222 Ga0395898_0002702 3300037466 Bacteria 20514
223 Ga0395898_0007872 3300037466 Bacteria 11305
224 Ga0395898_0029423 3300037466 Bacteria 5502
225 Ga0395898_0038231 3300037466 Bacteria 4757
226 Ga0395898_0041401 3300037466 Bacteria 4550
227 Ga0395898_0081187 3300037466 Bacteria 3127
228 Ga0395898_0119714 3300037466 Bacteria 2522
229 Ga0395898_0276966 3300037466 Bacteria 1600
230 Ga0395898_0363301 3300037466 Bacteria 1380
231 Ga0395905_0002251 3300037471 Bacteria 21694
232 Ga0395905_0004857 3300037471 Bacteria 13857
233 Ga0395905_0006548 3300037471 Bacteria 11707
234 Ga0395905_0008968 3300037471 Bacteria 9815
235 Ga0395905_0028354 3300037471 Bacteria 5278
236 Ga0395905_0031773 3300037471 Bacteria 4968
237 Ga0395905_0217422 3300037471 Bacteria 1789
238 Ga0395905_0384717 3300037471 Bacteria 1297
239 Ga0395901_0004308 3300038443 Bacteria 14358
240 Ga0395901_0005287 3300038443 Bacteria 13044
241 Ga0395901_0005519 3300038443 Bacteria 12808
242 Ga0395901_0008516 3300038443 Bacteria 10360
243 Ga0395901_0010249 3300038443 Bacteria 9494
244 Ga0395901_0031330 3300038443 Bacteria 5484
245 Ga0395901_0032173 3300038443 Bacteria 5413
246 Ga0395901_0070564 3300038443 Bacteria 3640
247 Ga0395901_0110473 3300038443 Bacteria 2886
248 Ga0395901_0189528 3300038443 Bacteria 2157
249 Ga0395901_0210378 3300038443 Bacteria 2036
250 Ga0395901_0320321 3300038443 Bacteria 1604
251 Ga0395901_0882593 3300038443 Unclassified 877
252 Ga0436365_1463753 3300039437 Bacteria 1306
253 Ga0436360_0873850 3300039438 Bacteria 2991
254 Ga0439431_0042527 3300041997 Bacteria 1161
255 Ga0439457_031014 3300042014 Bacteria 1185
256 Ga0450894_022134 3300042131 Unclassified 861
257 Ga0466961_0046268 3300044693 Bacteria 2783
258 Ga0466961_0209024 3300044693 Bacteria 1205
259 Ga0466963_0003087 3300044694 Bacteria 9442
260 Ga0466963_0004327 3300044694 Bacteria 8242
261 Ga0466963_0012459 3300044694 Bacteria 5205
262 Ga0466963_0031883 3300044694 Bacteria 3408
263 Ga0466963_0064876 3300044694 Bacteria 2447
264 Ga0466963_0143931 3300044694 Bacteria 1653
265 Ga0466963_0238880 3300044694 Unclassified 1274
266 Ga0466964_0013203 3300044706 Bacteria 3132
267 Ga0466964_0027106 3300044706 Unclassified 2247
268 Ga0466964_0061443 3300044706 Bacteria 1564
269 Ga0466971_0017217 3300044719 Bacteria 3195
270 Ga0466971_0035329 3300044719 Bacteria 2240
271 Ga0466968_0098308 3300044735 Unclassified 1304
272 Ga0466968_0108299 3300044735 Unclassified 1247
273 Ga0466970_0223431 3300044765 Bacteria 1051
274 Ga0466957_0010391 3300044842 Bacteria 5341
275 Ga0466957_0141197 3300044842 Unclassified 1552
276 Ga0466959_0015963 3300045049 Bacteria 5480
277 Ga0466959_0051930 3300045049 Bacteria 3004
278 Ga0466959_0101240 3300045049 Bacteria 2062
279 Ga0466959_0128160 3300045049 Bacteria 1800
280 Ga0451576_0000002 3300045051 Bacteria 1670975
281 Ga0466958_0015595 3300045836 Bacteria 4357
282 Ga0466958_0024767 3300045836 Bacteria 3532
283 Ga0466958_0073685 3300045836 Bacteria 2092
284 Ga0466958_0281896 3300045836 Bacteria 1065
285 Ga0466967_0009592 3300045976 Bacteria 7194
286 Ga0466967_0009747 3300045976 Bacteria 7157
287 Ga0466967_0025233 3300045976 Bacteria 4899
288 Ga0466967_0041167 3300045976 Bacteria 3981
289 Ga0466967_0049369 3300045976 Bacteria 3680
290 Ga0466967_0069271 3300045976 Bacteria 3152
291 Ga0466967_0091551 3300045976 Bacteria 2764
292 Ga0466967_0092214 3300045976 Bacteria 2754
293 Ga0466967_0160239 3300045976 Bacteria 2111
294 Ga0466967_0273599 3300045976 Bacteria 1619
295 Ga0466967_0349033 3300045976 Bacteria 1432
296 Ga0466967_0442995 3300045976 Bacteria 1269
297 Ga0466967_0513453 3300045976 Bacteria 1177
298 Ga0495592_0127106 3300046454 Bacteria 1787
299 Ga0495629_0002364 3300046459 Bacteria 14519
300 Ga0495629_0150238 3300046459 Bacteria 1619
301 Ga0495629_0193292 3300046459 Bacteria 1408
302 Ga0495641_0001141 3300046461 Bacteria 22883
303 Ga0495641_0033837 3300046461 Bacteria 2422
304 Ga0495641_0043527 3300046461 Bacteria 2076
305 Ga0495641_0048241 3300046461 Bacteria 1953
306 Ga0495641_0130240 3300046461 Bacteria 1123
307 Ga0495651_0004075 3300046462 Bacteria 11176
308 Ga0495653_0017908 3300046463 Bacteria 5759
309 Ga0495653_0037056 3300046463 Bacteria 3836
310 Ga0495582_0000219 3300046473 Bacteria 31735
311 Ga0495582_0262286 3300046473 Bacteria 991
312 Ga0495662_0005886 3300046476 Bacteria 6130
313 Ga0495585_0133623 3300046492 Bacteria 1304
314 Ga0495594_0180367 3300046499 Bacteria 1202
315 Ga0495608_0018108 3300046511 Bacteria 4864
316 Ga0495608_0108505 3300046511 Bacteria 1785
317 Ga0495618_0094566 3300046514 Bacteria 1911
318 Ga0495628_0040271 3300046516 Bacteria 3734
319 Ga0495628_0079756 3300046516 Bacteria 2545
320 Ga0495628_0139852 3300046516 Unclassified 1848
321 Ga0495630_0020061 3300046517 Bacteria 4923
322 Ga0495630_0025302 3300046517 Bacteria 4387
323 Ga0495630_0030253 3300046517 Bacteria 4027
324 Ga0495630_0164415 3300046517 Bacteria 1689
325 Ga0495644_0084960 3300046523 Bacteria 1193
326 Ga0495652_0300923 3300046529 Bacteria 1166
327 Ga0495665_0003758 3300046531 Bacteria 8216
328 Ga0495640_0088796 3300046533 Bacteria 2042
329 Ga0495586_0008736 3300046535 Bacteria 5393
330 Ga0495667_0011789 3300046559 Bacteria 5922
331 Ga0495667_0063906 3300046559 Bacteria 2408
332 Ga0495667_0171658 3300046559 Bacteria 1393
333 Ga0495656_0081715 3300046615 Bacteria 1459
334 Ga0495634_0007256 3300046642 Bacteria 8353
335 Ga0495634_0021302 3300046642 Bacteria 4585
336 Ga0495634_0036195 3300046642 Bacteria 3377
337 Ga0495635_0016943 3300046663 Bacteria 5090
338 Ga0495635_0051459 3300046663 Bacteria 2838
339 Ga0495635_0361061 3300046663 Bacteria 968
340 Ga0495659_0032099 3300046664 Bacteria 1836
341 Ga0495657_0017573 3300046675 Bacteria 5188
342 Ga0495657_0037742 3300046675 Bacteria 3327
343 Ga0495657_0058039 3300046675 Bacteria 2571
344 Ga0495657_0212154 3300046675 Unclassified 1177
345 Ga0495623_0174171 3300046679 Bacteria 1255
346 Ga0495647_0057823 3300046681 Bacteria 1523
347 Ga0495658_0000020 3300046683 Bacteria 87200
348 Ga0495658_0012588 3300046683 Bacteria 4290
349 Ga0495613_0010585 3300046689 Bacteria 6840
350 Ga0495613_0049479 3300046689 Bacteria 3102
351 Ga0495624_0008910 3300046690 Bacteria 6974
352 Ga0495624_0088152 3300046690 Bacteria 1916
353 Ga0495600_0045013 3300046809 Bacteria 2879
354 Ga0495581_0001595 3300047315 Bacteria 12659
355 Ga0495604_0028887 3300047317 Bacteria 4412
356 Ga0495604_0164835 3300047317 Bacteria 1563
357 Ga0495604_0320895 3300047317 Bacteria 1035
358 Ga0495674_0002446 3300047319 Bacteria 18147
359 Ga0495674_0031450 3300047319 Bacteria 4821
360 Ga0495674_0036584 3300047319 Bacteria 4418
361 Ga0495674_0043407 3300047319 Bacteria 4002
362 Ga0495674_0074216 3300047319 Bacteria 2930
363 Ga0495676_0000726 3300047321 Bacteria 27488
364 Ga0495676_0047792 3300047321 Bacteria 3456
365 Ga0495676_0114235 3300047321 Bacteria 1976
366 Ga0495680_0001503 3300047322 Bacteria 25013
367 Ga0495680_0004979 3300047322 Bacteria 12557
368 Ga0495680_0022731 3300047322 Bacteria 5224
369 Ga0495680_0084672 3300047322 Unclassified 2389
370 Ga0495684_0006909 3300047471 Bacteria 8811
371 Ga0495684_0012368 3300047471 Bacteria 6583
372 Ga0495684_0036835 3300047471 Bacteria 3751
373 Ga0495593_0143525 3300047673 Bacteria 1209
374 Ga0495602_0023769 3300048088 Bacteria 5963
375 Ga0495614_0036681 3300048089 Bacteria 2104
376 Ga0496100_0007425 3300048903 Bacteria 6047
377 Ga0496100_0008330 3300048903 Bacteria 5779
378 Ga0496100_0066493 3300048903 Bacteria 2391
379 Ga0496100_0077925 3300048903 Bacteria 2230
380 Ga0496101_0000413 3300048904 Bacteria 27636
381 Ga0496101_0007159 3300048904 Bacteria 7213
382 Ga0496101_0032548 3300048904 Bacteria 3671
383 Ga0496101_0035008 3300048904 Bacteria 3550
384 Ga0496101_0096426 3300048904 Bacteria 2207
385 Ga0496102_0032403 3300048905 Bacteria 4694
386 Ga0496102_0238035 3300048905 Bacteria 1717
387 Ga0496102_0624697 3300048905 Unclassified 1000
388 Ga0496103_0014809 3300048906 Bacteria 4637
389 Ga0496103_0179602 3300048906 Bacteria 1360
390 Ga0496104_0001399 3300048907 Bacteria 20880
391 Ga0496104_0040839 3300048907 Bacteria 4349
392 Ga0496104_0078927 3300048907 Bacteria 3137
393 Ga0496104_0275407 3300048907 Bacteria 1596
394 Ga0496104_0482925 3300048907 Bacteria 1150
395 Ga0496105_0001789 3300048908 Bacteria 15361
396 Ga0496105_0012636 3300048908 Bacteria 6687
397 Ga0496105_0069749 3300048908 Bacteria 2905
398 Ga0496105_0081964 3300048908 Bacteria 2665
399 Ga0496106_0004239 3300048909 Bacteria 10676
400 Ga0496106_0014536 3300048909 Bacteria 5816
401 Ga0496107_0003990 3300048910 Bacteria 9939
402 Ga0496107_0007174 3300048910 Bacteria 7679
403 Ga0496107_0008527 3300048910 Bacteria 7095
404 Ga0496108_0004101 3300048911 Bacteria 11699
405 Ga0496108_0009126 3300048911 Bacteria 8027
406 Ga0496108_0500727 3300048911 Bacteria 1061
407 Ga0496109_0003277 3300048912 Bacteria 13512
408 Ga0496109_0026518 3300048912 Bacteria 5168
409 Ga0496109_0589868 3300048912 Bacteria 1047
410 Ga0496110_0056417 3300048913 Bacteria 3457
411 Ga0496110_0092320 3300048913 Bacteria 2709
412 Ga0496112_0007497 3300048915 Bacteria 9687
413 Ga0496112_0015396 3300048915 Bacteria 7137
414 Ga0496112_0038436 3300048915 Bacteria 4673
415 Ga0496112_0056619 3300048915 Bacteria 3859
416 Ga0496112_0099824 3300048915 Bacteria 2873
417 Ga0496112_0211998 3300048915 Bacteria 1894
418 Ga0496112_0618610 3300048915 Bacteria 1014
419 Ga0496113_0022328 3300048916 Bacteria 4474
420 Ga0496113_0061170 3300048916 Bacteria 2841
421 Ga0496113_0083587 3300048916 Bacteria 2450
422 Ga0496113_0292369 3300048916 Bacteria 1304
423 Ga0496114_0001014 3300048917 Bacteria 21080
424 Ga0496114_0015823 3300048917 Bacteria 6070
425 Ga0496114_0017072 3300048917 Bacteria 5855
426 Ga0496114_0047120 3300048917 Bacteria 3584
427 Ga0496114_0101082 3300048917 Bacteria 2461
428 Ga0496114_0141764 3300048917 Bacteria 2081
429 Ga0496114_0243981 3300048917 Bacteria 1580
430 Ga0496115_0000905 3300048918 Bacteria 21521
431 Ga0496115_0075680 3300048918 Bacteria 2735
432 Ga0496115_0229251 3300048918 Bacteria 1532
433 Ga0496115_0255096 3300048918 Bacteria 1443
434 Ga0496115_0509495 3300048918 Bacteria 966
435 Ga0501034_0072955 3300049571 Bacteria 3441
436 Ga0501047_0014373 3300049581 Bacteria 7527
437 Ga0501067_0113298 3300049583 Bacteria 1508
438 Ga0501069_0064275 3300049585 Bacteria 2051
439 Ga0501069_0184529 3300049585 Bacteria 1206
440 Ga0501070_0000228 3300049586 Bacteria 52799
441 Ga0501070_0046697 3300049586 Bacteria 3601
442 Ga0501070_0086882 3300049586 Bacteria 2589
443 Ga0501070_0260740 3300049586 Bacteria 1417
444 Ga0501223_003073 3300049663 Bacteria 3646
445 Ga0501083_0338130 3300049744 Bacteria 979
446 Ga0501035_0432064 3300049822 Bacteria 1092
447 nmdc:mga0yw44_17977_c1 3300050492 Bacteria 3862
448 nmdc:mga05p37_370416_c1 3300050507 Bacteria 1681
449 nmdc:mga08y16_160897_c1 3300050511 Bacteria 2333
450 nmdc:mga0n895_38467_c1 3300050512 Bacteria 4635
451 nmdc:mga0n895_655362_c1 3300050512 Bacteria 1048
452 nmdc:mga0rr50_45515_c1 3300050513 Bacteria 3226
453 nmdc:mga0a205_28434_c2 3300050515 Bacteria 3916
454 Ga0495601_0007822 3300053077 Bacteria 6289
455 Ga0495601_0073265 3300053077 Unclassified 2189
456 Ga0495595_0053094 3300053084 Bacteria 1882
457 Ga0495619_0007146 3300053085 Bacteria 7070
458 Ga0495619_0015801 3300053085 Bacteria 4779
459 Ga0495619_0016567 3300053085 Bacteria 4666
460 Ga0466962_0015684 3300061719 Bacteria 3652
461 2524004469 2523533629 Bacteria 2982326
462 2839990233 2839989709 Bacteria 3773432
463 2842904348 2842903701 Bacteria 6986368
464 Ga0070707_100117630
465 rootH1_10278812
466 Ga0070658_10211998
467 Ga0070683_100013066
468 Ga0070683_100035630
469 Ga0070683_100194515
470 Ga0070683_100340831
471 Ga0070683_100366635
472 Ga0070680_100001740
473 Ga0070680_100028646
474 Ga0070680_100043595
475 Ga0070680_100371406
476 Ga0070682_100181405
477 Ga0068868_100429731
478 Ga0070660_100000838
479 Ga0070660_100004651
480 Ga0070660_100022622
481 Ga0070660_100087688
482 Ga0070661_100054241
483 Ga0070661_100086058
484 Ga0070671_100142005
485 Ga0070659_100096384
486 Ga0070667_100393008
487 Ga0070709_10100875
488 Ga0070714_100470482
489 Ga0070713_100051879
490 Ga0070713_100155817
491 Ga0070713_100300688
492 Ga0070713_100504673
493 Ga0070711_100025946
494 Ga0070711_100248934
495 Ga0070711_100314571
496 Ga0070694_100087250
497 Ga0070708_100033907
498 Ga0070708_100085803
499 Ga0070681_10000130
500 Ga0070681_10003736
501 Ga0070681_10004350
502 Ga0070681_10104811
503 Ga0070681_10120204
504 Ga0070681_10123734
505 Ga0070706_100015919
506 Ga0070707_100004757
507 Ga0070698_100021238
508 Ga0070698_100291132
509 Ga0070679_100015446
510 Ga0070679_100019347
511 Ga0070679_100203519
512 Ga0070684_100001412
513 Ga0070684_100088985
514 Ga0070684_100127562
515 Ga0070684_100151125
516 Ga0068853_100593469
517 Ga0070665_100109129
518 Ga0068855_100007768
519 Ga0068855_100052032
520 Ga0068855_100052814
521 Ga0068855_100084972
522 Ga0068855_100126286
523 Ga0068855_100127576
524 Ga0068857_100128503
525 Ga0068857_100296692
526 Ga0081455_10170095
527 Ga0081455_10200679
528 Ga0070717_10082566
529 Ga0070717_10280776
530 Ga0075365_10004605
531 Ga0070712_100013817
532 Ga0097621_100282266
533 Ga0068871_100383914
534 Ga0075428_100607373
535 Ga0075433_10012284
536 Ga0075435_100026940
537 Ga0105240_10014721
538 Ga0105240_10384892
539 Ga0111539_10010446
540 Ga0105245_10316464
541 Ga0114129_10405927
542 Ga0114129_10497068
543 Ga0105241_10175716
544 Ga0105242_10029747
545 Ga0105242_10047142
546 Ga0105242_10194840
547 Ga0105237_10164959
548 Ga0105238_10116963
549 Ga0105239_10144395
550 Ga0157370_10011524
551 Ga0157370_10014156
552 Ga0157370_10029452
553 Ga0157370_10030785
554 Ga0157370_10236044
555 Ga0157369_10000274
556 Ga0157369_10012696
557 Ga0157369_10072131
558 Ga0157369_10134496
559 Ga0157369_10167499
560 Ga0157369_10266788
561 Ga0157374_10299145
562 Ga0157372_10055102
563 Ga0157372_10113631
564 Ga0157372_10134849
565 Ga0157372_10283898
566 Ga0157375_10040089
567 Ga0157380_10003893
568 Ga0182008_10014308
569 Ga0182008_10023404
570 Ga0182008_10076467
571 Ga0182007_10012160
572 Ga0182007_10048896
573 Ga0206356_10273602
574 Ga0206354_11064135
575 Ga0206353_10459516
576 Ga0206353_11095007
577 Ga0213871_10014356
578 Ga0207705_10010059
579 Ga0207705_10182690
580 Ga0207684_10014952
581 Ga0207707_10007369
582 Ga0207707_10023280
583 Ga0207707_10383135
584 Ga0207695_10111482
585 Ga0207695_10422966
586 Ga0207671_10201172
587 Ga0207693_10001636
588 Ga0207693_10034024
589 Ga0207693_10056128
590 Ga0207663_10177955
591 Ga0207660_10029806
592 Ga0207660_10036525
593 Ga0207657_10000976
594 Ga0207657_10002512
595 Ga0207657_10016038
596 Ga0207657_10021635
597 Ga0207657_10080712
598 Ga0207649_10025750
599 Ga0207649_10295281
600 Ga0207652_10021027
601 Ga0207652_10043134
602 Ga0207652_10078827
603 Ga0207652_10187262
604 Ga0207652_10381529
605 Ga0207646_10267481
606 Ga0207694_10209310
607 Ga0207694_10250840
608 Ga0207700_10050128
609 Ga0207664_10069157
610 Ga0207686_10045066
611 Ga0207686_10045631
612 Ga0207686_10084479
613 Ga0207686_10093364
614 Ga0207665_10069350
615 Ga0207661_10024732
616 Ga0207661_10115131
617 Ga0207661_10158975
618 Ga0207661_10270776
619 Ga0207667_10071038
620 Ga0207667_10092134
621 Ga0207667_10256009
622 Ga0207658_10303397
623 Ga0207678_10045607
624 Ga0207678_10105589
625 Ga0207702_10367984
626 Ga0207674_10200170
627 Ga0207674_10203900
628 Ga0207683_10510463
629 Ga0207698_10035958
630 Ga0207698_10335292
631 Ga0207428_10048776
632 Ga0268266_10115069
633 Ga0268266_10386076
634 Ga0268265_10079650
635 Ga0265338_10082052
636 Ga0265338_10099663
637 Ga0265338_10185346
638 Ga0316177_1044313
639 Ga0316176_1043240
640 Ga0316181_1130119
641 Ga0316182_1154965
642 Ga0265320_10019125
643 Ga0265327_10025245
644 Ga0265327_10052251
645 Ga0307408_100000389
646 Ga0307408_100197453
647 Ga0265313_10050288
648 Ga0307412_10018240
649 Ga0307412_10069233
650 Ga0307416_100180252
651 Ga0307414_10015326
652 Ga0307414_10035800
653 Ga0307414_10197855
654 Ga0373944_0052690
655 Ga0373945_0005439
656 Ga0373945_0014519
657 Ga0373943_0000321
658 Ga0373943_0016359
659 Ga0373946_0013685
660 Ga0373935_0015054
661 Ga0373935_0045537
662 Ga0373935_0233600
663 Ga0373927_0158333
664 Ga0373947_0001733
665 Ga0373947_0019472
666 Ga0373947_0126393
667 Ga0373937_0062305
668 Ga0373937_0155484
669 Ga0373925_0008675
670 Ga0373925_0037423
671 Ga0395899_0017632
672 Ga0395899_0021861
673 Ga0395899_0083360
674 Ga0395899_0094478
675 Ga0395899_0270162
676 Ga0395900_0001712
677 Ga0395900_0006471
678 Ga0395900_0031612
679 Ga0395900_0090784
680 Ga0395900_0145434
681 Ga0395900_0323308
682 Ga0395900_0426545
683 Ga0395900_0580761
684 Ga0395898_0001935
685 Ga0395898_0002702
686 Ga0395898_0007872
687 Ga0395898_0029423
688 Ga0395898_0038231
689 Ga0395898_0041401
690 Ga0395898_0081187
691 Ga0395898_0119714
692 Ga0395898_0276966
693 Ga0395898_0363301
694 Ga0395905_0002251
695 Ga0395905_0004857
696 Ga0395905_0006548
697 Ga0395905_0008968
698 Ga0395905_0028354
699 Ga0395905_0031773
700 Ga0395905_0217422
701 Ga0395905_0384717
702 Ga0395901_0004308
703 Ga0395901_0005287
704 Ga0395901_0005519
705 Ga0395901_0008516
706 Ga0395901_0010249
707 Ga0395901_0031330
708 Ga0395901_0032173
709 Ga0395901_0070564
710 Ga0395901_0110473
711 Ga0395901_0189528
712 Ga0395901_0210378
713 Ga0395901_0320321
714 Ga0395901_0882593
715 Ga0436365_1463753
716 Ga0436360_0873850
717 Ga0439431_0042527
718 Ga0439457_031014
719 Ga0450894_022134
720 Ga0466961_0046268
721 Ga0466961_0209024
722 Ga0466963_0003087
723 Ga0466963_0004327
724 Ga0466963_0012459
725 Ga0466963_0031883
726 Ga0466963_0064876
727 Ga0466963_0143931
728 Ga0466963_0238880
729 Ga0466964_0013203
730 Ga0466964_0027106
731 Ga0466964_0061443
732 Ga0466971_0017217
733 Ga0466971_0035329
734 Ga0466968_0098308
735 Ga0466968_0108299
736 Ga0466970_0223431
737 Ga0466957_0010391
738 Ga0466957_0141197
739 Ga0466959_0015963
740 Ga0466959_0051930
741 Ga0466959_0101240
742 Ga0466959_0128160
743 Ga0451576_0000002
744 Ga0466958_0015595
745 Ga0466958_0024767
746 Ga0466958_0073685
747 Ga0466958_0281896
748 Ga0466967_0009592
749 Ga0466967_0009747
750 Ga0466967_0025233
751 Ga0466967_0041167
752 Ga0466967_0049369
753 Ga0466967_0069271
754 Ga0466967_0091551
755 Ga0466967_0092214
756 Ga0466967_0160239
757 Ga0466967_0273599
758 Ga0466967_0349033
759 Ga0466967_0442995
760 Ga0466967_0513453
761 Ga0495592_0127106
762 Ga0495629_0002364
763 Ga0495629_0150238
764 Ga0495629_0193292
765 Ga0495641_0001141
766 Ga0495641_0033837
767 Ga0495641_0043527
768 Ga0495641_0048241
769 Ga0495641_0130240
770 Ga0495651_0004075
771 Ga0495653_0017908
772 Ga0495653_0037056
773 Ga0495582_0000219
774 Ga0495582_0262286
775 Ga0495662_0005886
776 Ga0495585_0133623
777 Ga0495594_0180367
778 Ga0495608_0018108
779 Ga0495608_0108505
780 Ga0495618_0094566
781 Ga0495628_0040271
782 Ga0495628_0079756
783 Ga0495628_0139852
784 Ga0495630_0020061
785 Ga0495630_0025302
786 Ga0495630_0030253
787 Ga0495630_0164415
788 Ga0495644_0084960
789 Ga0495652_0300923
790 Ga0495665_0003758
791 Ga0495640_0088796
792 Ga0495586_0008736
793 Ga0495667_0011789
794 Ga0495667_0063906
795 Ga0495667_0171658
796 Ga0495656_0081715
797 Ga0495634_0007256
798 Ga0495634_0021302
799 Ga0495634_0036195
800 Ga0495635_0016943
801 Ga0495635_0051459
802 Ga0495635_0361061
803 Ga0495659_0032099
804 Ga0495657_0017573
805 Ga0495657_0037742
806 Ga0495657_0058039
807 Ga0495657_0212154
808 Ga0495623_0174171
809 Ga0495647_0057823
810 Ga0495658_0000020
811 Ga0495658_0012588
812 Ga0495613_0010585
813 Ga0495613_0049479
814 Ga0495624_0008910
815 Ga0495624_0088152
816 Ga0495600_0045013
817 Ga0495581_0001595
818 Ga0495604_0028887
819 Ga0495604_0164835
820 Ga0495604_0320895
821 Ga0495674_0002446
822 Ga0495674_0031450
823 Ga0495674_0036584
824 Ga0495674_0043407
825 Ga0495674_0074216
826 Ga0495676_0000726
827 Ga0495676_0047792
828 Ga0495676_0114235
829 Ga0495680_0001503
830 Ga0495680_0004979
831 Ga0495680_0022731
832 Ga0495680_0084672
833 Ga0495684_0006909
834 Ga0495684_0012368
835 Ga0495684_0036835
836 Ga0495593_0143525
837 Ga0495602_0023769
838 Ga0495614_0036681
839 Ga0496100_0007425
840 Ga0496100_0008330
841 Ga0496100_0066493
842 Ga0496100_0077925
843 Ga0496101_0000413
844 Ga0496101_0007159
845 Ga0496101_0032548
846 Ga0496101_0035008
847 Ga0496101_0096426
848 Ga0496102_0032403
849 Ga0496102_0238035
850 Ga0496102_0624697
851 Ga0496103_0014809
852 Ga0496103_0179602
853 Ga0496104_0001399
854 Ga0496104_0040839
855 Ga0496104_0078927
856 Ga0496104_0275407
857 Ga0496104_0482925
858 Ga0496105_0001789
859 Ga0496105_0012636
860 Ga0496105_0069749
861 Ga0496105_0081964
862 Ga0496106_0004239
863 Ga0496106_0014536
864 Ga0496107_0003990
865 Ga0496107_0007174
866 Ga0496107_0008527
867 Ga0496108_0004101
868 Ga0496108_0009126
869 Ga0496108_0500727
870 Ga0496109_0003277
871 Ga0496109_0026518
872 Ga0496109_0589868
873 Ga0496110_0056417
874 Ga0496110_0092320
875 Ga0496112_0007497
876 Ga0496112_0015396
877 Ga0496112_0038436
878 Ga0496112_0056619
879 Ga0496112_0099824
880 Ga0496112_0211998
881 Ga0496112_0618610
882 Ga0496113_0022328
883 Ga0496113_0061170
884 Ga0496113_0083587
885 Ga0496113_0292369
886 Ga0496114_0001014
887 Ga0496114_0015823
888 Ga0496114_0017072
889 Ga0496114_0047120
890 Ga0496114_0101082
891 Ga0496114_0141764
892 Ga0496114_0243981
893 Ga0496115_0000905
894 Ga0496115_0075680
895 Ga0496115_0229251
896 Ga0496115_0255096
897 Ga0496115_0509495
898 Ga0501034_0072955
899 Ga0501047_0014373
900 Ga0501067_0113298
901 Ga0501069_0064275
902 Ga0501069_0184529
903 Ga0501070_0000228
904 Ga0501070_0046697
905 Ga0501070_0086882
906 Ga0501070_0260740
907 Ga0501223_003073
908 Ga0501083_0338130
909 Ga0501035_0432064
910 nmdc:mga0yw44_17977_c1
911 nmdc:mga05p37_370416_c1
912 nmdc:mga08y16_160897_c1
913 nmdc:mga0n895_38467_c1
914 nmdc:mga0n895_655362_c1
915 nmdc:mga0rr50_45515_c1
916 nmdc:mga0a205_28434_c2
917 Ga0495601_0007822
918 Ga0495601_0073265
919 Ga0495595_0053094
920 Ga0495619_0007146
921 Ga0495619_0015801
922 Ga0495619_0016567
923 Ga0466962_0015684
924 2524004469
925 2839990233
926 2842904348

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

76

281

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahh-assembly1.cif.gz_A opua inhibited inward-facing, sbd docked 0.8303 70 264
7ahc-assembly1.cif.gz_B opua apo inward-facing 0.7954 67 264
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.7644 24 265
4jbw-assembly2.cif.gz_I crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.7562 67 266
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.7426 25 263
ID Description Score Start End Superfamily
af_P9WG09_26_296_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9266 15 266 1.10.3720.10
af_P9WG11_24_299_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9179 12 266 1.10.3720.10
af_Q2FYP8_79_307_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9177 67 271 1.10.3720.10
af_P07654_38_293_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9054 30 264 1.10.3720.10
af_Q58419_14_276_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.88 18 264 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A538JHT3-F1-model_v4 Phosphate transport system permease protein PstA 0.9543 7 276 GO:0005315
GO:0005886
GO:0035435
AF-A0A2T7YWL0-F1-model_v4 deleted 0.9484 64 272
AF-A0A7G1I7T9-F1-model_v4 Phosphate transport system permease protein PstA 0.9471 62 275 GO:0005315
GO:0005886
GO:0035435
AF-A0A7J3HAY6-F1-model_v4 ABC transporter permease subunit 0.9468 64 268 GO:0005886
GO:0055085
AF-A0A535CHS1-F1-model_v4 Phosphate transport system permease protein PstA 0.9426 67 272 GO:0005315
GO:0005886
GO:0035435

Map