F449090

General Info

Members Datasets Scaffolds Average Seq Length
463 256 926 155

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100591450|Ga0075428_1005914502
Length 178
Sequence MRQPLSPAPSAPHSKPVGIGEKRRYLEDYAVGQKFRSGRLRIDEERIKQFAAEFDPQPFHLDAEAARHTIFGGLAASGWHTAAVTMRLLVESDLKPAGGIVGAGADEFRWPRPVRPGDELRIESEVIDVRPSRSRPDQGLIKVRTTTLNQNDEAVQIVVANLVVPRRRSAPDGQESKP

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
153 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
154 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
155 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
156 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
157 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
158 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
159 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
160 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
165 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
166 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
167 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
168 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
169 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
173 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
174 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
175 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
198 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
209 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
213 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
214 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
217 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
218 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
219 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
225 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
226 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
227 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
250 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
251 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
254 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
255 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
256 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.08
Nodule 0
Rhizoplane 1.3
Rhizosphere 97.62
Stem 0
Stem Tuber 0
Unclassified 4.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100591450 3300006844 Unclassified 1185
2 MBSR1b_contig_8456420 2162886012 Bacteria 839
3 JGI25407J50210_10091381 3300003373 Bacteria 753
4 Ga0065707_10411249 3300005295 Bacteria 841
5 Ga0070658_10202551 3300005327 Bacteria 1675
6 Ga0070690_100003281 3300005330 Bacteria 8841
7 Ga0070690_100050171 3300005330 Bacteria 2662
8 Ga0068869_100015522 3300005334 Bacteria 5112
9 Ga0070680_100007726 3300005336 Bacteria 8196
10 Ga0070680_100029182 3300005336 Bacteria 4430
11 Ga0070682_100005569 3300005337 Bacteria 7015
12 Ga0068868_100002449 3300005338 Bacteria 12874
13 Ga0070660_100002546 3300005339 Bacteria 12492
14 Ga0070689_100001036 3300005340 Bacteria 17435
15 Ga0070691_10001194 3300005341 Bacteria 10888
16 Ga0070691_10014492 3300005341 Plasmid 3618
17 Ga0070687_100007407 3300005343 Bacteria 4571
18 Ga0070661_100308272 3300005344 Bacteria 1234
19 Ga0070692_10101509 3300005345 Bacteria 1577
20 Ga0070668_100140200 3300005347 Bacteria 1948
21 Ga0070668_100297219 3300005347 Bacteria 1353
22 Ga0070669_100133995 3300005353 Bacteria 1904
23 Ga0070669_101140563 3300005353 Bacteria 672
24 Ga0070675_100266619 3300005354 Bacteria 1502
25 Ga0070671_100007607 3300005355 Bacteria 8665
26 Ga0070671_100009240 3300005355 Bacteria 7919
27 Ga0070673_100257247 3300005364 Bacteria 1524
28 Ga0070673_100672383 3300005364 Bacteria 949
29 Ga0070688_100130814 3300005365 Bacteria 1693
30 Ga0070688_100298734 3300005365 Bacteria 1163
31 Ga0070659_100294687 3300005366 Bacteria 1351
32 Ga0070667_100472900 3300005367 Bacteria 1147
33 Ga0070703_10271008 3300005406 Bacteria 696
34 Ga0070714_100187662 3300005435 Bacteria 1885
35 Ga0070714_100786248 3300005435 Bacteria 921
36 Ga0070701_10023691 3300005438 Bacteria 2960
37 Ga0070705_100000265 3300005440 Bacteria 31468
38 Ga0070705_100055347 3300005440 Bacteria 2331
39 Ga0070700_100001093 3300005441 Bacteria 13412
40 Ga0070700_100079632 3300005441 Bacteria 2112
41 Ga0070694_100000487 3300005444 Bacteria 21731
42 Ga0070694_100090473 3300005444 Bacteria 2146
43 Ga0070663_100013837 3300005455 Bacteria 5161
44 Ga0070662_100000493 3300005457 Bacteria 23501
45 Ga0070662_100325570 3300005457 Bacteria 1254
46 Ga0070681_10083200 3300005458 Bacteria 3154
47 Ga0070681_10097342 3300005458 Bacteria 2890
48 Ga0068867_100000776 3300005459 Bacteria 21576
49 Ga0068867_101464808 3300005459 Bacteria 635
50 Ga0070685_10556037 3300005466 Bacteria 820
51 Ga0070685_10571203 3300005466 Bacteria 810
52 Ga0070706_100072837 3300005467 Bacteria 3179
53 Ga0070706_100964302 3300005467 Bacteria 787
54 Ga0070707_100032351 3300005468 Bacteria 4983
55 Ga0070679_100072422 3300005530 Bacteria 3438
56 Ga0070679_100215523 3300005530 Bacteria 1882
57 Ga0070697_100118856 3300005536 Bacteria 2209
58 Ga0068853_100434840 3300005539 Bacteria 1232
59 Ga0068853_101377135 3300005539 Bacteria 682
60 Ga0070672_100058248 3300005543 Bacteria 3035
61 Ga0070672_100879190 3300005543 Bacteria 791
62 Ga0070686_100029834 3300005544 Bacteria 3322
63 Ga0070695_100001882 3300005545 Bacteria 11865
64 Ga0070695_100016157 3300005545 Bacteria 4514
65 Ga0070695_100564966 3300005545 Bacteria 888
66 Ga0070696_100004350 3300005546 Bacteria 9440
67 Ga0070696_100024574 3300005546 Bacteria 4096
68 Ga0070693_100000572 3300005547 Bacteria 16351
69 Ga0070665_100031086 3300005548 Bacteria 5374
70 Ga0070665_102179583 3300005548 Bacteria 558
71 Ga0070704_100000099 3300005549 Bacteria 30058
72 Ga0068855_100026129 3300005563 Bacteria 6985
73 Ga0070664_100010298 3300005564 Bacteria 7588
74 Ga0068857_100584784 3300005577 Bacteria 1054
75 Ga0068854_100043254 3300005578 Bacteria 3192
76 Ga0068854_100436292 3300005578 Bacteria 1091
77 Ga0068856_100000282 3300005614 Bacteria 55434
78 Ga0070702_100001957 3300005615 Bacteria 8671
79 Ga0068859_100082863 3300005617 Bacteria 3249
80 Ga0068864_100103410 3300005618 Bacteria 2529
81 Ga0068866_10006713 3300005718 Bacteria 4798
82 Ga0068861_100001259 3300005719 Bacteria 15803
83 Ga0068861_100565435 3300005719 Bacteria 1038
84 Ga0068861_100710180 3300005719 Bacteria 935
85 Ga0068861_101547861 3300005719 Bacteria 652
86 Ga0068861_102430920 3300005719 Bacteria 527
87 Ga0068851_10209928 3300005834 Bacteria 1090
88 Ga0068851_10273855 3300005834 Unclassified 963
89 Ga0068863_100877440 3300005841 Bacteria 897
90 Ga0068858_100031268 3300005842 Bacteria 4942
91 Ga0068860_100013709 3300005843 Bacteria 7948
92 Ga0068860_100099156 3300005843 Bacteria 2779
93 Ga0068860_100162465 3300005843 Bacteria 2154
94 Ga0068862_100017924 3300005844 Bacteria 5897
95 Ga0068862_100119896 3300005844 Bacteria 2318
96 Ga0070717_10409896 3300006028 Bacteria 1218
97 Ga0075432_10010240 3300006058 Bacteria 3178
98 Ga0097621_100001204 3300006237 Bacteria 17926
99 Ga0068871_100010165 3300006358 Bacteria 6852
100 Ga0068871_100462438 3300006358 Bacteria 1139
101 Ga0075428_100032862 3300006844 Bacteria 5729
102 Ga0075428_100260438 3300006844 Bacteria 1867
103 Ga0075428_100435106 3300006844 Bacteria 1405
104 Ga0075428_101543730 3300006844 Bacteria 695
105 Ga0075430_100050270 3300006846 Bacteria 3516
106 Ga0075430_100322324 3300006846 Bacteria 1277
107 Ga0075430_100976343 3300006846 Bacteria 698
108 Ga0075431_100080500 3300006847 Bacteria 3363
109 Ga0075431_100093088 3300006847 Unclassified 3111
110 Ga0075433_10003704 3300006852 Bacteria 11828
111 Ga0075433_10008069 3300006852 Bacteria 8382
112 Ga0075433_10020439 3300006852 Bacteria 5536
113 Ga0075433_10023008 3300006852 Bacteria 5241
114 Ga0075433_10382087 3300006852 Bacteria 1243
115 Ga0075434_100002979 3300006871 Bacteria 15067
116 Ga0075434_100007729 3300006871 Bacteria 9955
117 Ga0075434_100008146 3300006871 Bacteria 9717
118 Ga0075434_100700376 3300006871 Bacteria 1030
119 Ga0075429_100017721 3300006880 Bacteria 6158
120 Ga0075429_100020013 3300006880 Bacteria 5802
121 Ga0075429_100093092 3300006880 Unclassified 2628
122 Ga0075429_100281434 3300006880 Bacteria 1457
123 Ga0075429_100722429 3300006880 Bacteria 872
124 Ga0068865_100018229 3300006881 Bacteria 4528
125 Ga0068865_100320624 3300006881 Bacteria 1246
126 Ga0068865_100453454 3300006881 Bacteria 1061
127 Ga0068865_101638990 3300006881 Bacteria 579
128 Ga0075436_100009554 3300006914 Bacteria 6639
129 Ga0075436_100017772 3300006914 Bacteria 4870
130 Ga0075436_100074593 3300006914 Bacteria 2349
131 Ga0097620_100082866 3300006931 Bacteria 3249
132 Ga0075435_100001684 3300007076 Bacteria 14358
133 Ga0075435_100001787 3300007076 Bacteria 13994
134 Ga0075435_100048536 3300007076 Bacteria 3411
135 Ga0075435_100087312 3300007076 Bacteria 2570
136 Ga0075435_100090945 3300007076 Bacteria 2518
137 Ga0099794_10035311 3300007265 Bacteria 2359
138 Ga0099794_10064543 3300007265 Unclassified 1784
139 Ga0099794_10111407 3300007265 Bacteria 1371
140 Ga0105250_10041879 3300009092 Bacteria 1835
141 Ga0105240_11087687 3300009093 Bacteria 851
142 Ga0111539_10000098 3300009094 Bacteria 91568
143 Ga0111539_10035256 3300009094 Bacteria 6059
144 Ga0111539_10049758 3300009094 Bacteria 4996
145 Ga0111539_10157930 3300009094 Bacteria 2653
146 Ga0111539_10185503 3300009094 Bacteria 2429
147 Ga0111539_12206929 3300009094 Bacteria 639
148 Ga0105245_10009606 3300009098 Bacteria 8437
149 Ga0105245_11753129 3300009098 Unclassified 673
150 Ga0114129_10007097 3300009147 Bacteria 15942
151 Ga0114129_10019005 3300009147 Bacteria 9789
152 Ga0114129_10040990 3300009147 Bacteria 6525
153 Ga0114129_10042922 3300009147 Bacteria 6364
154 Ga0114129_10176291 3300009147 Unclassified 2912
155 Ga0114129_10208749 3300009147 Bacteria 2641
156 Ga0114129_10258309 3300009147 Bacteria 2336
157 Ga0114129_10481593 3300009147 Unclassified 1623
158 Ga0114129_11120635 3300009147 Bacteria 984
159 Ga0114129_11728731 3300009147 Bacteria 763
160 Ga0105243_10001402 3300009148 Bacteria 21324
161 Ga0105241_10038608 3300009174 Bacteria 3600
162 Ga0105241_10503487 3300009174 Bacteria 1080
163 Ga0105242_10214882 3300009176 Bacteria 1715
164 Ga0105248_10192202 3300009177 Bacteria 2300
165 Ga0105249_10195401 3300009553 Bacteria 1977
166 Ga0105239_10143292 3300010375 Bacteria 2664
167 Ga0105239_10164166 3300010375 Bacteria 2483
168 Ga0105246_10399305 3300011119 Bacteria 1141
169 Ga0105246_10877057 3300011119 Bacteria 803
170 Ga0157321_1013342 3300012487 Bacteria 668
171 Ga0157373_10001080 3300013100 Bacteria 20998
172 Ga0157371_10004911 3300013102 Bacteria 11488
173 Ga0157369_10045209 3300013105 Bacteria 4791
174 Ga0157378_10004165 3300013297 Bacteria 12768
175 Ga0157378_10033970 3300013297 Bacteria 4511
176 Ga0157378_10584399 3300013297 Bacteria 1126
177 Ga0163162_10094778 3300013306 Bacteria 3072
178 Ga0163162_10421955 3300013306 Bacteria 1466
179 Ga0163162_10663253 3300013306 Bacteria 1166
180 Ga0163162_11163326 3300013306 Bacteria 875
181 Ga0157372_10001613 3300013307 Bacteria 24490
182 Ga0157375_10430403 3300013308 Bacteria 1485
183 Ga0157375_10557341 3300013308 Bacteria 1307
184 Ga0157375_12606099 3300013308 Bacteria 604
185 Ga0163163_10000012 3300014325 Bacteria 257369
186 Ga0163163_10134272 3300014325 Bacteria 2515
187 Ga0157380_10703155 3300014326 Bacteria 1016
188 Ga0157379_10002483 3300014968 Bacteria 15444
189 Ga0157376_11708525 3300014969 Unclassified 665
190 Ga0163161_10519165 3300017792 Unclassified 972
191 Ga0207696_1075770 3300025711 Bacteria 932
192 Ga0207653_10023047 3300025885 Bacteria 1981
193 Ga0207642_10013597 3300025899 Bacteria 2974
194 Ga0207647_10470337 3300025904 Bacteria 703
195 Ga0207643_10076206 3300025908 Bacteria 1937
196 Ga0207654_10655277 3300025911 Bacteria 752
197 Ga0207707_10155972 3300025912 Bacteria 1997
198 Ga0207707_10189340 3300025912 Bacteria 1795
199 Ga0207707_10497906 3300025912 Bacteria 1039
200 Ga0207707_11098015 3300025912 Bacteria 648
201 Ga0207660_10236731 3300025917 Bacteria 1437
202 Ga0207662_10000922 3300025918 Bacteria 13615
203 Ga0207657_10001778 3300025919 Bacteria 23266
204 Ga0207649_10011705 3300025920 Bacteria 4847
205 Ga0207652_10143411 3300025921 Bacteria 2136
206 Ga0207652_10261734 3300025921 Bacteria 1560
207 Ga0207652_10612954 3300025921 Bacteria 975
208 Ga0207652_10752995 3300025921 Bacteria 867
209 Ga0207646_10200016 3300025922 Bacteria 1805
210 Ga0207646_10813519 3300025922 Bacteria 832
211 Ga0207681_10806985 3300025923 Bacteria 784
212 Ga0207659_10032623 3300025926 Bacteria 3577
213 Ga0207687_10018684 3300025927 Bacteria 4580
214 Ga0207700_10248885 3300025928 Bacteria 1518
215 Ga0207644_10032895 3300025931 Bacteria 3621
216 Ga0207644_10156938 3300025931 Bacteria 1765
217 Ga0207690_10003592 3300025932 Bacteria 9239
218 Ga0207706_10000202 3300025933 Bacteria 65888
219 Ga0207686_10130454 3300025934 Bacteria 1723
220 Ga0207709_10044626 3300025935 Bacteria 2680
221 Ga0207670_10054978 3300025936 Bacteria 2688
222 Ga0207704_10000733 3300025938 Bacteria 14428
223 Ga0207704_10413121 3300025938 Bacteria 1068
224 Ga0207704_10587828 3300025938 Bacteria 910
225 Ga0207665_10525713 3300025939 Bacteria 917
226 Ga0207691_10018474 3300025940 Bacteria 6607
227 Ga0207691_10674156 3300025940 Bacteria 873
228 Ga0207691_10879826 3300025940 Bacteria 750
229 Ga0207711_10067234 3300025941 Bacteria 3102
230 Ga0207711_10131790 3300025941 Bacteria 2242
231 Ga0207689_10000736 3300025942 Bacteria 31515
232 Ga0207689_10230516 3300025942 Bacteria 1530
233 Ga0207689_11148672 3300025942 Bacteria 654
234 Ga0207679_12170638 3300025945 Bacteria 504
235 Ga0207667_10000879 3300025949 Bacteria 38336
236 Ga0207667_10109989 3300025949 Bacteria 2842
237 Ga0207651_10335291 3300025960 Bacteria 1269
238 Ga0207651_10576180 3300025960 Bacteria 981
239 Ga0207712_10180676 3300025961 Bacteria 1657
240 Ga0207668_10606627 3300025972 Bacteria 954
241 Ga0207640_10013174 3300025981 Bacteria 4732
242 Ga0207640_10417821 3300025981 Bacteria 1097
243 Ga0207677_10116448 3300026023 Bacteria 2001
244 Ga0207677_10147038 3300026023 Bacteria 1812
245 Ga0207703_10147747 3300026035 Bacteria 2046
246 Ga0207703_10546800 3300026035 Unclassified 1091
247 Ga0207639_10144825 3300026041 Bacteria 1984
248 Ga0207708_10000310 3300026075 Bacteria 38519
249 Ga0207708_10032050 3300026075 Plasmid 3991
250 Ga0207702_10006682 3300026078 Bacteria 9914
251 Ga0207702_10309686 3300026078 Bacteria 1501
252 Ga0207648_10001026 3300026089 Bacteria 31434
253 Ga0207648_10071037 3300026089 Bacteria 3034
254 Ga0207648_10939570 3300026089 Bacteria 809
255 Ga0207648_11720443 3300026089 Bacteria 589
256 Ga0207676_10165220 3300026095 Bacteria 1922
257 Ga0207676_10938726 3300026095 Bacteria 850
258 Ga0207675_100002828 3300026118 Bacteria 17075
259 Ga0207675_100613071 3300026118 Bacteria 1092
260 Ga0207675_100646685 3300026118 Bacteria 1063
261 Ga0207675_101693911 3300026118 Bacteria 652
262 Ga0207683_10212417 3300026121 Bacteria 1761
263 Ga0207683_10398905 3300026121 Bacteria 1265
264 Ga0209588_1038485 3300027671 Bacteria 1541
265 Ga0209588_1096176 3300027671 Unclassified 954
266 Ga0207428_10000432 3300027907 Bacteria 51578
267 Ga0207428_10004091 3300027907 Bacteria 13975
268 Ga0207428_10131814 3300027907 Bacteria 1912
269 Ga0268266_10072288 3300028379 Bacteria 2991
270 Ga0268265_10008996 3300028380 Bacteria 6755
271 Ga0268264_10088174 3300028381 Bacteria 2669
272 Ga0268264_10177554 3300028381 Bacteria 1931
273 Ga0268264_10395377 3300028381 Bacteria 1327
274 Ga0265327_10074816 3300031251 Bacteria 1686
275 Ga0265314_10001108 3300031711 Bacteria 31108
276 Ga0373948_0009548 3300034817 Bacteria 1675
277 Ga0373959_0112718 3300034820 Bacteria 658
278 Ga0373926_0030694 3300035083 Bacteria 1893
279 Ga0373926_0106502 3300035083 Bacteria 1051
280 Ga0373928_0069287 3300035084 Bacteria 868
281 Ga0373928_0158515 3300035084 Bacteria 631
282 Ga0373929_0013500 3300035085 Bacteria 1566
283 Ga0373940_0000194 3300035088 Bacteria 8354
284 Ga0373940_0021274 3300035088 Bacteria 1656
285 Ga0373940_0110042 3300035088 Bacteria 845
286 Ga0373944_0016239 3300035089 Bacteria 2096
287 Ga0373944_0071874 3300035089 Bacteria 1128
288 Ga0373949_0009867 3300035090 Bacteria 2089
289 Ga0373952_0016063 3300035092 Bacteria 1517
290 Ga0373923_0000063 3300035111 Bacteria 17233
291 Ga0373923_0346289 3300035111 Bacteria 709
292 Ga0373932_0005875 3300035112 Bacteria 2889
293 Ga0373932_0036040 3300035112 Bacteria 1402
294 Ga0373932_0057961 3300035112 Unclassified 1169
295 Ga0373932_0127179 3300035112 Bacteria 855
296 Ga0373936_0006084 3300035113 Bacteria 4546
297 Ga0373936_0008116 3300035113 Bacteria 3949
298 Ga0373939_0009370 3300035114 Bacteria 2426
299 Ga0373939_0017030 3300035114 Bacteria 1925
300 Ga0373945_0004933 3300035116 Bacteria 4254
301 Ga0373945_0094856 3300035116 Bacteria 1160
302 Ga0373953_0440289 3300035117 Bacteria 575
303 Ga0373954_0010670 3300035118 Bacteria 4059
304 Ga0373957_0146677 3300035120 Bacteria 967
305 Ga0373957_0202294 3300035120 Bacteria 828
306 Ga0373960_0004090 3300035121 Bacteria 3334
307 Ga0373943_0009048 3300035170 Bacteria 4464
308 Ga0373943_0014292 3300035170 Bacteria 3592
309 Ga0373943_0073428 3300035170 Unclassified 1737
310 Ga0373955_0000977 3300035172 Bacteria 12146
311 Ga0373955_0014922 3300035172 Bacteria 3792
312 Ga0373942_0003292 3300035207 Bacteria 3803
313 Ga0373961_0007543 3300035241 Bacteria 2634
314 Ga0373962_0006616 3300035242 Bacteria 2809
315 Ga0373924_0018631 3300035410 Bacteria 2678
316 Ga0373924_0155888 3300035410 Bacteria 1000
317 Ga0373931_0003605 3300035691 Bacteria 6991
318 Ga0373931_0025329 3300035691 Bacteria 3013
319 Ga0373931_0077944 3300035691 Bacteria 1822
320 Ga0373931_0153694 3300035691 Bacteria 1343
321 Ga0373935_0000027 3300035692 Bacteria 58804
322 Ga0373935_0005277 3300035692 Bacteria 7605
323 Ga0373935_0290210 3300035692 Bacteria 1154
324 Ga0373927_0009595 3300035695 Bacteria 6492
325 Ga0373933_0006256 3300035724 Bacteria 6480
326 Ga0373947_0074513 3300035725 Bacteria 2088
327 Ga0373947_0078277 3300035725 Bacteria 2041
328 Ga0373937_0000058 3300036401 Bacteria 99025
329 Ga0373925_0000036 3300037068 Bacteria 143388
330 Ga0436360_0180199 3300039438 Bacteria 843
331 Ga0451577_0151174 3300042876 Unclassified 2089
332 Ga0453683_0599854 3300044673 Bacteria 718
333 Ga0453684_0192863 3300044712 Unclassified 2382
334 Ga0451576_0001638 3300045051 Bacteria 37426
335 Ga0451576_0004815 3300045051 Bacteria 17290
336 Ga0451576_0036794 3300045051 Bacteria 5186
337 Ga0451576_0323021 3300045051 Bacteria 1615
338 Ga0451576_1762247 3300045051 Bacteria 641
339 Ga0495592_0000018 3300046454 Bacteria 140962
340 Ga0495592_0012492 3300046454 Bacteria 6453
341 Ga0495603_0050402 3300046455 Bacteria 2476
342 Ga0495590_0033321 3300046457 Bacteria 1801
343 Ga0495629_0040823 3300046459 Bacteria 3264
344 Ga0495651_0000568 3300046462 Bacteria 28603
345 Ga0495651_0047145 3300046462 Bacteria 3334
346 Ga0495653_0000069 3300046463 Bacteria 89715
347 Ga0495653_0098339 3300046463 Bacteria 2125
348 Ga0495580_0045670 3300046472 Bacteria 3110
349 Ga0495662_0033565 3300046476 Bacteria 2479
350 Ga0495664_0000010 3300046477 Bacteria 268381
351 Ga0495608_0000008 3300046511 Bacteria 268629
352 Ga0495608_0027958 3300046511 Bacteria 3834
353 Ga0495618_0000002 3300046514 Bacteria 271353
354 Ga0495628_0000009 3300046516 Bacteria 237611
355 Ga0495628_0292448 3300046516 Bacteria 1207
356 Ga0495652_0000011 3300046529 Bacteria 255329
357 Ga0495652_0116347 3300046529 Bacteria 2141
358 Ga0495665_0068653 3300046531 Bacteria 1869
359 Ga0495640_0000009 3300046533 Bacteria 217086
360 Ga0495586_0084677 3300046535 Bacteria 1745
361 Ga0495587_0000006 3300046536 Bacteria 310070
362 Ga0495587_0100348 3300046536 Bacteria 1668
363 Ga0495621_0371352 3300046539 Bacteria 603
364 Ga0495645_0000010 3300046543 Bacteria 238337
365 Ga0495645_0001344 3300046543 Bacteria 16611
366 Ga0495667_0000005 3300046559 Bacteria 268252
367 Ga0495656_0276407 3300046615 Bacteria 855
368 Ga0495634_0000055 3300046642 Bacteria 89761
369 Ga0495625_0363727 3300046660 Bacteria 911
370 Ga0495635_0000008 3300046663 Bacteria 268349
371 Ga0495635_0048245 3300046663 Bacteria 2936
372 Ga0495588_0050904 3300046674 Bacteria 2132
373 Ga0495657_0000856 3300046675 Bacteria 26832
374 Ga0495657_0132780 3300046675 Bacteria 1558
375 Ga0495599_0000007 3300046678 Bacteria 236638
376 Ga0495623_0000004 3300046679 Bacteria 142249
377 Ga0495623_0103298 3300046679 Bacteria 1734
378 Ga0495646_0000094 3300046680 Bacteria 43394
379 Ga0495647_0000340 3300046681 Bacteria 13129
380 Ga0495658_0070979 3300046683 Bacteria 2022
381 Ga0495613_0034086 3300046689 Bacteria 3781
382 Ga0495613_0603785 3300046689 Bacteria 730
383 Ga0495600_0000001 3300046809 Bacteria 214870
384 Ga0495600_0131356 3300046809 Bacteria 1628
385 Ga0495581_0064969 3300047315 Bacteria 2109
386 Ga0495604_0000012 3300047317 Bacteria 268341
387 Ga0495604_0063568 3300047317 Bacteria 2815
388 Ga0495674_0000011 3300047319 Bacteria 270911
389 Ga0495680_0000045 3300047322 Bacteria 96890
390 Ga0495675_0000538 3300047444 Bacteria 24571
391 Ga0495684_0000014 3300047471 Bacteria 172111
392 Ga0495684_0118825 3300047471 Bacteria 1992
393 Ga0495593_0000568 3300047673 Bacteria 20984
394 Ga0495602_0000019 3300048088 Bacteria 170922
395 Ga0495602_0353389 3300048088 Bacteria 1060
396 Ga0496100_0443136 3300048903 Unclassified 995
397 Ga0496102_0048524 3300048905 Bacteria 3860
398 Ga0496103_0163946 3300048906 Bacteria 1426
399 Ga0496106_0004468 3300048909 Bacteria 10372
400 Ga0496107_0652830 3300048910 Bacteria 775
401 Ga0496114_0853140 3300048917 Bacteria 791
402 Ga0501038_0704625 3300049574 Bacteria 756
403 Ga0501035_0039386 3300049822 Bacteria 4277
404 Ga0501044_0962863 3300049823 Bacteria 726
405 Ga0501045_0494091 3300049824 Bacteria 909
406 nmdc:mga03683_272535_c1 3300050489 Bacteria 789
407 nmdc:mga05p37_139945_c1 3300050507 Bacteria 2966
408 nmdc:mga05p37_1473588_c1 3300050507 Bacteria 680
409 nmdc:mga05p37_170833_c1 3300050507 Bacteria 2651
410 nmdc:mga05p37_196064_c1 3300050507 Bacteria 2449
411 nmdc:mga05p37_235176_c1 3300050507 Bacteria 1862
412 nmdc:mga05p37_251967_c1 3300050507 Unclassified 2117
413 nmdc:mga05p37_462814_c1 3300050507 Unclassified 1465
414 nmdc:mga05p37_524081_c1 3300050507 Bacteria 1355
415 nmdc:mga05p37_99111_c1 3300050507 Bacteria 3590
416 nmdc:mga09592_1232_c1 3300050508 Bacteria 20495
417 nmdc:mga09592_21978_c1 3300050508 Bacteria 5263
418 nmdc:mga09592_296169_c1 3300050508 Bacteria 1403
419 nmdc:mga09592_520061_c1 3300050508 Unclassified 1024
420 nmdc:mga0qj67_34589_c1 3300050509 Bacteria 3948
421 nmdc:mga0qj67_480588_c1 3300050509 Bacteria 999
422 nmdc:mga0qj67_719562_c1 3300050509 Bacteria 793
423 nmdc:mga06r32_1158480_c1 3300050510 Bacteria 721
424 nmdc:mga06r32_1184951_c1 3300050510 Bacteria 711
425 nmdc:mga06r32_605004_c1 3300050510 Bacteria 1067
426 nmdc:mga08y16_12672_c1 3300050511 Bacteria 8870
427 nmdc:mga08y16_216_c1 3300050511 Bacteria 51710
428 nmdc:mga08y16_7617_c1 3300050511 Bacteria 11331
429 nmdc:mga0n895_12421_c1 3300050512 Bacteria 7640
430 nmdc:mga0n895_180658_c1 3300050512 Bacteria 2141
431 nmdc:mga0n895_186773_c1 3300050512 Bacteria 2104
432 nmdc:mga0n895_21214_c1 3300050512 Bacteria 6070
433 nmdc:mga0n895_4593_c1 3300050512 Bacteria 11375
434 nmdc:mga0n895_532304_c1 3300050512 Unclassified 1182
435 nmdc:mga0n895_729331_c1 3300050512 Bacteria 985
436 nmdc:mga0rr50_109984_c2 3300050513 Bacteria 1845
437 nmdc:mga0rr50_123892_c1 3300050513 Bacteria 2061
438 nmdc:mga0rr50_138042_c1 3300050513 Bacteria 1959
439 nmdc:mga0rr50_22977_c1 3300050513 Bacteria 4290
440 nmdc:mga0rr50_54825_c1 3300050513 Bacteria 2972
441 nmdc:mga0rr50_553075_c1 3300050513 Bacteria 980
442 nmdc:mga0rr50_83943_c1 3300050513 Bacteria 2464
443 nmdc:mga08x19_205436_c1 3300050514 Bacteria 1351
444 nmdc:mga08x19_52471_c1 3300050514 Bacteria 2623
445 nmdc:mga08x19_56431_c1 3300050514 Bacteria 2535
446 nmdc:mga0a205_103568_c1 3300050515 Bacteria 2745
447 nmdc:mga0a205_17288_c2 3300050515 Bacteria 6230
448 nmdc:mga0a205_200391_c1 3300050515 Bacteria 1887
449 nmdc:mga0a205_2900_c1 3300050515 Bacteria 15175
450 nmdc:mga0a205_397128_c1 3300050515 Bacteria 1243
451 nmdc:mga0a205_42266_c1 3300050515 Bacteria 4391
452 nmdc:mga0a205_444131_c1 3300050515 Bacteria 1158
453 nmdc:mga0a205_53767_c1 3300050515 Bacteria 3887
454 Ga0495601_0000009 3300053077 Bacteria 270622
455 Ga0495612_0000021 3300053078 Bacteria 130528
456 Ga0495595_0000060 3300053084 Bacteria 56423
457 Ga0495595_0223294 3300053084 Bacteria 940
458 Ga0495619_0000012 3300053085 Bacteria 268349
459 Ga0495619_0010953 3300053085 Bacteria 5706
460 Ga0500643_112999 3300053087 Bacteria 733
461 Ga0500641_0055967 3300053096 Bacteria 1634
462 Ga0500595_006442 3300053119 Bacteria 4979
463 Ga0500636_0196134 3300053177 Bacteria 1072
464 Ga0075428_100591450
465 MBSR1b_contig_8456420
466 JGI25407J50210_10091381
467 Ga0065707_10411249
468 Ga0070658_10202551
469 Ga0070690_100003281
470 Ga0070690_100050171
471 Ga0068869_100015522
472 Ga0070680_100007726
473 Ga0070680_100029182
474 Ga0070682_100005569
475 Ga0068868_100002449
476 Ga0070660_100002546
477 Ga0070689_100001036
478 Ga0070691_10001194
479 Ga0070691_10014492
480 Ga0070687_100007407
481 Ga0070661_100308272
482 Ga0070692_10101509
483 Ga0070668_100140200
484 Ga0070668_100297219
485 Ga0070669_100133995
486 Ga0070669_101140563
487 Ga0070675_100266619
488 Ga0070671_100007607
489 Ga0070671_100009240
490 Ga0070673_100257247
491 Ga0070673_100672383
492 Ga0070688_100130814
493 Ga0070688_100298734
494 Ga0070659_100294687
495 Ga0070667_100472900
496 Ga0070703_10271008
497 Ga0070714_100187662
498 Ga0070714_100786248
499 Ga0070701_10023691
500 Ga0070705_100000265
501 Ga0070705_100055347
502 Ga0070700_100001093
503 Ga0070700_100079632
504 Ga0070694_100000487
505 Ga0070694_100090473
506 Ga0070663_100013837
507 Ga0070662_100000493
508 Ga0070662_100325570
509 Ga0070681_10083200
510 Ga0070681_10097342
511 Ga0068867_100000776
512 Ga0068867_101464808
513 Ga0070685_10556037
514 Ga0070685_10571203
515 Ga0070706_100072837
516 Ga0070706_100964302
517 Ga0070707_100032351
518 Ga0070679_100072422
519 Ga0070679_100215523
520 Ga0070697_100118856
521 Ga0068853_100434840
522 Ga0068853_101377135
523 Ga0070672_100058248
524 Ga0070672_100879190
525 Ga0070686_100029834
526 Ga0070695_100001882
527 Ga0070695_100016157
528 Ga0070695_100564966
529 Ga0070696_100004350
530 Ga0070696_100024574
531 Ga0070693_100000572
532 Ga0070665_100031086
533 Ga0070665_102179583
534 Ga0070704_100000099
535 Ga0068855_100026129
536 Ga0070664_100010298
537 Ga0068857_100584784
538 Ga0068854_100043254
539 Ga0068854_100436292
540 Ga0068856_100000282
541 Ga0070702_100001957
542 Ga0068859_100082863
543 Ga0068864_100103410
544 Ga0068866_10006713
545 Ga0068861_100001259
546 Ga0068861_100565435
547 Ga0068861_100710180
548 Ga0068861_101547861
549 Ga0068861_102430920
550 Ga0068851_10209928
551 Ga0068851_10273855
552 Ga0068863_100877440
553 Ga0068858_100031268
554 Ga0068860_100013709
555 Ga0068860_100099156
556 Ga0068860_100162465
557 Ga0068862_100017924
558 Ga0068862_100119896
559 Ga0070717_10409896
560 Ga0075432_10010240
561 Ga0097621_100001204
562 Ga0068871_100010165
563 Ga0068871_100462438
564 Ga0075428_100032862
565 Ga0075428_100260438
566 Ga0075428_100435106
567 Ga0075428_101543730
568 Ga0075430_100050270
569 Ga0075430_100322324
570 Ga0075430_100976343
571 Ga0075431_100080500
572 Ga0075431_100093088
573 Ga0075433_10003704
574 Ga0075433_10008069
575 Ga0075433_10020439
576 Ga0075433_10023008
577 Ga0075433_10382087
578 Ga0075434_100002979
579 Ga0075434_100007729
580 Ga0075434_100008146
581 Ga0075434_100700376
582 Ga0075429_100017721
583 Ga0075429_100020013
584 Ga0075429_100093092
585 Ga0075429_100281434
586 Ga0075429_100722429
587 Ga0068865_100018229
588 Ga0068865_100320624
589 Ga0068865_100453454
590 Ga0068865_101638990
591 Ga0075436_100009554
592 Ga0075436_100017772
593 Ga0075436_100074593
594 Ga0097620_100082866
595 Ga0075435_100001684
596 Ga0075435_100001787
597 Ga0075435_100048536
598 Ga0075435_100087312
599 Ga0075435_100090945
600 Ga0099794_10035311
601 Ga0099794_10064543
602 Ga0099794_10111407
603 Ga0105250_10041879
604 Ga0105240_11087687
605 Ga0111539_10000098
606 Ga0111539_10035256
607 Ga0111539_10049758
608 Ga0111539_10157930
609 Ga0111539_10185503
610 Ga0111539_12206929
611 Ga0105245_10009606
612 Ga0105245_11753129
613 Ga0114129_10007097
614 Ga0114129_10019005
615 Ga0114129_10040990
616 Ga0114129_10042922
617 Ga0114129_10176291
618 Ga0114129_10208749
619 Ga0114129_10258309
620 Ga0114129_10481593
621 Ga0114129_11120635
622 Ga0114129_11728731
623 Ga0105243_10001402
624 Ga0105241_10038608
625 Ga0105241_10503487
626 Ga0105242_10214882
627 Ga0105248_10192202
628 Ga0105249_10195401
629 Ga0105239_10143292
630 Ga0105239_10164166
631 Ga0105246_10399305
632 Ga0105246_10877057
633 Ga0157321_1013342
634 Ga0157373_10001080
635 Ga0157371_10004911
636 Ga0157369_10045209
637 Ga0157378_10004165
638 Ga0157378_10033970
639 Ga0157378_10584399
640 Ga0163162_10094778
641 Ga0163162_10421955
642 Ga0163162_10663253
643 Ga0163162_11163326
644 Ga0157372_10001613
645 Ga0157375_10430403
646 Ga0157375_10557341
647 Ga0157375_12606099
648 Ga0163163_10000012
649 Ga0163163_10134272
650 Ga0157380_10703155
651 Ga0157379_10002483
652 Ga0157376_11708525
653 Ga0163161_10519165
654 Ga0207696_1075770
655 Ga0207653_10023047
656 Ga0207642_10013597
657 Ga0207647_10470337
658 Ga0207643_10076206
659 Ga0207654_10655277
660 Ga0207707_10155972
661 Ga0207707_10189340
662 Ga0207707_10497906
663 Ga0207707_11098015
664 Ga0207660_10236731
665 Ga0207662_10000922
666 Ga0207657_10001778
667 Ga0207649_10011705
668 Ga0207652_10143411
669 Ga0207652_10261734
670 Ga0207652_10612954
671 Ga0207652_10752995
672 Ga0207646_10200016
673 Ga0207646_10813519
674 Ga0207681_10806985
675 Ga0207659_10032623
676 Ga0207687_10018684
677 Ga0207700_10248885
678 Ga0207644_10032895
679 Ga0207644_10156938
680 Ga0207690_10003592
681 Ga0207706_10000202
682 Ga0207686_10130454
683 Ga0207709_10044626
684 Ga0207670_10054978
685 Ga0207704_10000733
686 Ga0207704_10413121
687 Ga0207704_10587828
688 Ga0207665_10525713
689 Ga0207691_10018474
690 Ga0207691_10674156
691 Ga0207691_10879826
692 Ga0207711_10067234
693 Ga0207711_10131790
694 Ga0207689_10000736
695 Ga0207689_10230516
696 Ga0207689_11148672
697 Ga0207679_12170638
698 Ga0207667_10000879
699 Ga0207667_10109989
700 Ga0207651_10335291
701 Ga0207651_10576180
702 Ga0207712_10180676
703 Ga0207668_10606627
704 Ga0207640_10013174
705 Ga0207640_10417821
706 Ga0207677_10116448
707 Ga0207677_10147038
708 Ga0207703_10147747
709 Ga0207703_10546800
710 Ga0207639_10144825
711 Ga0207708_10000310
712 Ga0207708_10032050
713 Ga0207702_10006682
714 Ga0207702_10309686
715 Ga0207648_10001026
716 Ga0207648_10071037
717 Ga0207648_10939570
718 Ga0207648_11720443
719 Ga0207676_10165220
720 Ga0207676_10938726
721 Ga0207675_100002828
722 Ga0207675_100613071
723 Ga0207675_100646685
724 Ga0207675_101693911
725 Ga0207683_10212417
726 Ga0207683_10398905
727 Ga0209588_1038485
728 Ga0209588_1096176
729 Ga0207428_10000432
730 Ga0207428_10004091
731 Ga0207428_10131814
732 Ga0268266_10072288
733 Ga0268265_10008996
734 Ga0268264_10088174
735 Ga0268264_10177554
736 Ga0268264_10395377
737 Ga0265327_10074816
738 Ga0265314_10001108
739 Ga0373948_0009548
740 Ga0373959_0112718
741 Ga0373926_0030694
742 Ga0373926_0106502
743 Ga0373928_0069287
744 Ga0373928_0158515
745 Ga0373929_0013500
746 Ga0373940_0000194
747 Ga0373940_0021274
748 Ga0373940_0110042
749 Ga0373944_0016239
750 Ga0373944_0071874
751 Ga0373949_0009867
752 Ga0373952_0016063
753 Ga0373923_0000063
754 Ga0373923_0346289
755 Ga0373932_0005875
756 Ga0373932_0036040
757 Ga0373932_0057961
758 Ga0373932_0127179
759 Ga0373936_0006084
760 Ga0373936_0008116
761 Ga0373939_0009370
762 Ga0373939_0017030
763 Ga0373945_0004933
764 Ga0373945_0094856
765 Ga0373953_0440289
766 Ga0373954_0010670
767 Ga0373957_0146677
768 Ga0373957_0202294
769 Ga0373960_0004090
770 Ga0373943_0009048
771 Ga0373943_0014292
772 Ga0373943_0073428
773 Ga0373955_0000977
774 Ga0373955_0014922
775 Ga0373942_0003292
776 Ga0373961_0007543
777 Ga0373962_0006616
778 Ga0373924_0018631
779 Ga0373924_0155888
780 Ga0373931_0003605
781 Ga0373931_0025329
782 Ga0373931_0077944
783 Ga0373931_0153694
784 Ga0373935_0000027
785 Ga0373935_0005277
786 Ga0373935_0290210
787 Ga0373927_0009595
788 Ga0373933_0006256
789 Ga0373947_0074513
790 Ga0373947_0078277
791 Ga0373937_0000058
792 Ga0373925_0000036
793 Ga0436360_0180199
794 Ga0451577_0151174
795 Ga0453683_0599854
796 Ga0453684_0192863
797 Ga0451576_0001638
798 Ga0451576_0004815
799 Ga0451576_0036794
800 Ga0451576_0323021
801 Ga0451576_1762247
802 Ga0495592_0000018
803 Ga0495592_0012492
804 Ga0495603_0050402
805 Ga0495590_0033321
806 Ga0495629_0040823
807 Ga0495651_0000568
808 Ga0495651_0047145
809 Ga0495653_0000069
810 Ga0495653_0098339
811 Ga0495580_0045670
812 Ga0495662_0033565
813 Ga0495664_0000010
814 Ga0495608_0000008
815 Ga0495608_0027958
816 Ga0495618_0000002
817 Ga0495628_0000009
818 Ga0495628_0292448
819 Ga0495652_0000011
820 Ga0495652_0116347
821 Ga0495665_0068653
822 Ga0495640_0000009
823 Ga0495586_0084677
824 Ga0495587_0000006
825 Ga0495587_0100348
826 Ga0495621_0371352
827 Ga0495645_0000010
828 Ga0495645_0001344
829 Ga0495667_0000005
830 Ga0495656_0276407
831 Ga0495634_0000055
832 Ga0495625_0363727
833 Ga0495635_0000008
834 Ga0495635_0048245
835 Ga0495588_0050904
836 Ga0495657_0000856
837 Ga0495657_0132780
838 Ga0495599_0000007
839 Ga0495623_0000004
840 Ga0495623_0103298
841 Ga0495646_0000094
842 Ga0495647_0000340
843 Ga0495658_0070979
844 Ga0495613_0034086
845 Ga0495613_0603785
846 Ga0495600_0000001
847 Ga0495600_0131356
848 Ga0495581_0064969
849 Ga0495604_0000012
850 Ga0495604_0063568
851 Ga0495674_0000011
852 Ga0495680_0000045
853 Ga0495675_0000538
854 Ga0495684_0000014
855 Ga0495684_0118825
856 Ga0495593_0000568
857 Ga0495602_0000019
858 Ga0495602_0353389
859 Ga0496100_0443136
860 Ga0496102_0048524
861 Ga0496103_0163946
862 Ga0496106_0004468
863 Ga0496107_0652830
864 Ga0496114_0853140
865 Ga0501038_0704625
866 Ga0501035_0039386
867 Ga0501044_0962863
868 Ga0501045_0494091
869 nmdc:mga03683_272535_c1
870 nmdc:mga05p37_139945_c1
871 nmdc:mga05p37_1473588_c1
872 nmdc:mga05p37_170833_c1
873 nmdc:mga05p37_196064_c1
874 nmdc:mga05p37_235176_c1
875 nmdc:mga05p37_251967_c1
876 nmdc:mga05p37_462814_c1
877 nmdc:mga05p37_524081_c1
878 nmdc:mga05p37_99111_c1
879 nmdc:mga09592_1232_c1
880 nmdc:mga09592_21978_c1
881 nmdc:mga09592_296169_c1
882 nmdc:mga09592_520061_c1
883 nmdc:mga0qj67_34589_c1
884 nmdc:mga0qj67_480588_c1
885 nmdc:mga0qj67_719562_c1
886 nmdc:mga06r32_1158480_c1
887 nmdc:mga06r32_1184951_c1
888 nmdc:mga06r32_605004_c1
889 nmdc:mga08y16_12672_c1
890 nmdc:mga08y16_216_c1
891 nmdc:mga08y16_7617_c1
892 nmdc:mga0n895_12421_c1
893 nmdc:mga0n895_180658_c1
894 nmdc:mga0n895_186773_c1
895 nmdc:mga0n895_21214_c1
896 nmdc:mga0n895_4593_c1
897 nmdc:mga0n895_532304_c1
898 nmdc:mga0n895_729331_c1
899 nmdc:mga0rr50_109984_c2
900 nmdc:mga0rr50_123892_c1
901 nmdc:mga0rr50_138042_c1
902 nmdc:mga0rr50_22977_c1
903 nmdc:mga0rr50_54825_c1
904 nmdc:mga0rr50_553075_c1
905 nmdc:mga0rr50_83943_c1
906 nmdc:mga08x19_205436_c1
907 nmdc:mga08x19_52471_c1
908 nmdc:mga08x19_56431_c1
909 nmdc:mga0a205_103568_c1
910 nmdc:mga0a205_17288_c2
911 nmdc:mga0a205_200391_c1
912 nmdc:mga0a205_2900_c1
913 nmdc:mga0a205_397128_c1
914 nmdc:mga0a205_42266_c1
915 nmdc:mga0a205_444131_c1
916 nmdc:mga0a205_53767_c1
917 Ga0495601_0000009
918 Ga0495612_0000021
919 Ga0495595_0000060
920 Ga0495595_0223294
921 Ga0495619_0000012
922 Ga0495619_0010953
923 Ga0500643_112999
924 Ga0500641_0055967
925 Ga0500595_006442
926 Ga0500636_0196134

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

29

158

0.89

PF01575

MaoC_dehydratas

MaoC like domain

27

149

0.88

PF19315

MC_hydratase

Mesaconyl-CoA hydratase

15

178

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3exz-assembly1.cif.gz_A crystal structure of the maoc-like dehydratase from rhodospirillum rubrum. northeast structural genomics consortium target rrr103a. 0.9581 4 148
3exz-assembly1.cif.gz_A crystal structure of the maoc-like dehydratase from rhodospirillum rubrum. northeast structural genomics consortium target rrr103a. 0.9391 4 148
1q6w-assembly2.cif.gz_C x-ray structure of monoamine oxidase regulatory protein from archaeoglobus fulgius 0.8605 2 147
4ffu-assembly1.cif.gz_D crystal structure of putative maoc-like (monoamine oxidase-like) protein, similar to nodn from sinorhizo bium meliloti 1021 0.8592 1 148
4ffu-assembly1.cif.gz_D crystal structure of putative maoc-like (monoamine oxidase-like) protein, similar to nodn from sinorhizo bium meliloti 1021 0.8486 1 148
ID Description Score Start End Superfamily
3exzC00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9634 4 146 3.10.129.10
3exzC00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9503 4 146 3.10.129.10
4ffuI00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8847 1 148 3.10.129.10
af_P77455_520_674_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8811 3 145 3.10.129.10
af_I6Y9H2_24_180_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8728 2 147 3.10.129.10
ID Description Score Start End GO Terms
AF-X6FVK7-F1-model_v4 MaoC family dehydratase 0.9781 21 147
AF-A0A840URG7-F1-model_v4 Acyl dehydratase 0.9769 1 150
AF-A0A537BWS2-F1-model_v4 MaoC family dehydratase 0.9746 1 147
AF-A0A4R7QKU9-F1-model_v4 deleted 0.973 1 147
AF-A0A6S6ZFJ1-F1-model_v4 MaoC-like domain-containing protein 0.9717 1 148

Map