F449109
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 463 | 244 | 463 | 82 |
Family's Representative Sequence
| Representative Sequence | 3300013306|Ga0163162_12704703|Ga0163162_127047031 |
| Length | 93 |
| Sequence | MLTSPPSRRTTMPLYLDVHNVKGGVSAKDVADAHMKDLKEQTHHGVNYIRYWVDEKAGKIFCLVDAPTKEAAHTVHREAHGLVADEIYEVQEG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 2 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 3 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 180 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 181 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 185 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 186 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 189 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 190 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 191 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 192 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 193 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 194 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 195 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 196 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 197 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 198 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 199 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 200 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 201 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 202 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 203 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 204 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 217 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 218 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 219 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 220 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 223 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 224 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 225 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 226 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 227 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 228 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 229 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 230 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 233 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 234 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 236 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.49 |
| Metatranscriptomes | 1.51 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.43 |
| Nodule | 0 |
| Rhizoplane | 9.5 |
| Rhizosphere | 88.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10020853 | 3300002067 | Unclassified | 2005 |
| 2 | Ga0058859_11270189 | 3300004798 | Unclassified | 537 |
| 3 | Ga0058861_11710926 | 3300004800 | Unclassified | 633 |
| 4 | Ga0058862_10008947 | 3300004803 | Unclassified | 545 |
| 5 | Ga0065712_10283164 | 3300005290 | Unclassified | 891 |
| 6 | Ga0065712_10573527 | 3300005290 | Bacteria | 605 |
| 7 | Ga0065715_10164626 | 3300005293 | Bacteria | 1597 |
| 8 | Ga0065707_10302798 | 3300005295 | Bacteria | 1001 |
| 9 | Ga0070658_10096271 | 3300005327 | Bacteria | 2444 |
| 10 | Ga0070658_10790553 | 3300005327 | Bacteria | 824 |
| 11 | Ga0070658_10871368 | 3300005327 | Bacteria | 783 |
| 12 | Ga0070676_10685634 | 3300005328 | Unclassified | 747 |
| 13 | Ga0070683_100006027 | 3300005329 | Bacteria | 10160 |
| 14 | Ga0070683_100010042 | 3300005329 | Bacteria | 8121 |
| 15 | Ga0070683_100125463 | 3300005329 | Bacteria | 2427 |
| 16 | Ga0070683_100212923 | 3300005329 | Bacteria | 1836 |
| 17 | Ga0070683_100418567 | 3300005329 | Bacteria | 1278 |
| 18 | Ga0070690_100126228 | 3300005330 | Bacteria | 1723 |
| 19 | Ga0070690_100536832 | 3300005330 | Unclassified | 880 |
| 20 | Ga0070670_100001650 | 3300005331 | Bacteria | 18076 |
| 21 | Ga0068869_100001541 | 3300005334 | Bacteria | 13698 |
| 22 | Ga0070666_10860857 | 3300005335 | Unclassified | 669 |
| 23 | Ga0070680_100027097 | 3300005336 | Bacteria | 4588 |
| 24 | Ga0070680_100104441 | 3300005336 | Unclassified | 2354 |
| 25 | Ga0070680_100385897 | 3300005336 | Bacteria | 1193 |
| 26 | Ga0070682_100003515 | 3300005337 | Bacteria | 8669 |
| 27 | Ga0070682_100948978 | 3300005337 | Unclassified | 710 |
| 28 | Ga0068868_100104297 | 3300005338 | Bacteria | 2298 |
| 29 | Ga0068868_101279769 | 3300005338 | Bacteria | 680 |
| 30 | Ga0070660_100024694 | 3300005339 | Bacteria | 4461 |
| 31 | Ga0070660_100030166 | 3300005339 | Bacteria | 4067 |
| 32 | Ga0070689_100117627 | 3300005340 | Bacteria | 2120 |
| 33 | Ga0070689_100195876 | 3300005340 | Unclassified | 1647 |
| 34 | Ga0070689_101458086 | 3300005340 | Bacteria | 619 |
| 35 | Ga0070687_100053069 | 3300005343 | Bacteria | 2107 |
| 36 | Ga0070687_100443944 | 3300005343 | Unclassified | 861 |
| 37 | Ga0070687_100560294 | 3300005343 | Bacteria | 779 |
| 38 | Ga0070687_100870100 | 3300005343 | Unclassified | 644 |
| 39 | Ga0070661_100001319 | 3300005344 | Bacteria | 17390 |
| 40 | Ga0070661_101735839 | 3300005344 | Bacteria | 529 |
| 41 | Ga0070692_10010465 | 3300005345 | Bacteria | 4222 |
| 42 | Ga0070692_10010486 | 3300005345 | Bacteria | 4219 |
| 43 | Ga0070668_100166301 | 3300005347 | Bacteria | 1793 |
| 44 | Ga0070668_100420497 | 3300005347 | Bacteria | 1144 |
| 45 | Ga0070669_100126606 | 3300005353 | Bacteria | 1955 |
| 46 | Ga0070675_100024459 | 3300005354 | Bacteria | 4836 |
| 47 | Ga0070671_100345757 | 3300005355 | Bacteria | 1269 |
| 48 | Ga0070671_100527772 | 3300005355 | Unclassified | 1017 |
| 49 | Ga0070671_100645472 | 3300005355 | Bacteria | 916 |
| 50 | Ga0070673_100025570 | 3300005364 | Bacteria | 4348 |
| 51 | Ga0070673_101404938 | 3300005364 | Unclassified | 657 |
| 52 | Ga0070688_100698786 | 3300005365 | Unclassified | 785 |
| 53 | Ga0070659_100000532 | 3300005366 | Bacteria | 27819 |
| 54 | Ga0070659_100835715 | 3300005366 | Bacteria | 802 |
| 55 | Ga0070667_100145539 | 3300005367 | Bacteria | 2078 |
| 56 | Ga0070703_10081147 | 3300005406 | Bacteria | 1105 |
| 57 | Ga0070714_102287423 | 3300005435 | Unclassified | 526 |
| 58 | Ga0070713_100216534 | 3300005436 | Unclassified | 1736 |
| 59 | Ga0070713_101454880 | 3300005436 | Bacteria | 665 |
| 60 | Ga0070713_102470691 | 3300005436 | Bacteria | 502 |
| 61 | Ga0070701_10812704 | 3300005438 | Bacteria | 639 |
| 62 | Ga0070701_11023423 | 3300005438 | Bacteria | 577 |
| 63 | Ga0070705_100384600 | 3300005440 | Unclassified | 1034 |
| 64 | Ga0070694_100066912 | 3300005444 | Bacteria | 2465 |
| 65 | Ga0070708_101832105 | 3300005445 | Bacteria | 563 |
| 66 | Ga0070708_102087704 | 3300005445 | Bacteria | 524 |
| 67 | Ga0070663_100197312 | 3300005455 | Bacteria | 1569 |
| 68 | Ga0070663_101448443 | 3300005455 | Bacteria | 609 |
| 69 | Ga0070678_101174397 | 3300005456 | Bacteria | 711 |
| 70 | Ga0070662_100044956 | 3300005457 | Bacteria | 3166 |
| 71 | Ga0070662_101679896 | 3300005457 | Unclassified | 548 |
| 72 | Ga0070681_10231694 | 3300005458 | Bacteria | 1761 |
| 73 | Ga0068867_101486694 | 3300005459 | Bacteria | 630 |
| 74 | Ga0070707_100222750 | 3300005468 | Bacteria | 1837 |
| 75 | Ga0070707_100575524 | 3300005468 | Unclassified | 1088 |
| 76 | Ga0070707_102293474 | 3300005468 | Unclassified | 507 |
| 77 | Ga0070699_100407579 | 3300005518 | Bacteria | 1230 |
| 78 | Ga0070679_100033762 | 3300005530 | Bacteria | 5066 |
| 79 | Ga0070679_101270041 | 3300005530 | Bacteria | 682 |
| 80 | Ga0070679_101930706 | 3300005530 | Bacteria | 539 |
| 81 | Ga0070684_100015201 | 3300005535 | Bacteria | 6260 |
| 82 | Ga0070684_100127630 | 3300005535 | Bacteria | 2292 |
| 83 | Ga0070684_100269590 | 3300005535 | Bacteria | 1558 |
| 84 | Ga0070684_101745851 | 3300005535 | Bacteria | 587 |
| 85 | Ga0070684_101982002 | 3300005535 | Bacteria | 549 |
| 86 | Ga0070697_100209684 | 3300005536 | Bacteria | 1658 |
| 87 | Ga0068853_100021271 | 3300005539 | Bacteria | 5406 |
| 88 | Ga0070672_100004783 | 3300005543 | Bacteria | 8887 |
| 89 | Ga0070672_101307427 | 3300005543 | Unclassified | 647 |
| 90 | Ga0070686_100143040 | 3300005544 | Unclassified | 1667 |
| 91 | Ga0070695_100105874 | 3300005545 | Bacteria | 1901 |
| 92 | Ga0070695_100208732 | 3300005545 | Bacteria | 1400 |
| 93 | Ga0070695_100285663 | 3300005545 | Bacteria | 1214 |
| 94 | Ga0070695_100950792 | 3300005545 | Bacteria | 696 |
| 95 | Ga0070693_100033249 | 3300005547 | Bacteria | 2844 |
| 96 | Ga0070693_101193269 | 3300005547 | Bacteria | 584 |
| 97 | Ga0070665_100153583 | 3300005548 | Bacteria | 2304 |
| 98 | Ga0070665_100886242 | 3300005548 | Bacteria | 905 |
| 99 | Ga0070704_100088542 | 3300005549 | Bacteria | 2300 |
| 100 | Ga0070704_101652840 | 3300005549 | Bacteria | 591 |
| 101 | Ga0068855_100152037 | 3300005563 | Bacteria | 2632 |
| 102 | Ga0070664_100062862 | 3300005564 | Bacteria | 3165 |
| 103 | Ga0070664_100072886 | 3300005564 | Bacteria | 2946 |
| 104 | Ga0070664_100579538 | 3300005564 | Bacteria | 1039 |
| 105 | Ga0068857_100239870 | 3300005577 | Bacteria | 1659 |
| 106 | Ga0068854_101273800 | 3300005578 | Bacteria | 661 |
| 107 | Ga0068856_100019110 | 3300005614 | Bacteria | 6651 |
| 108 | Ga0070702_100087235 | 3300005615 | Bacteria | 1884 |
| 109 | Ga0070702_101198728 | 3300005615 | Bacteria | 612 |
| 110 | Ga0068852_100008867 | 3300005616 | Bacteria | 7440 |
| 111 | Ga0068852_100370595 | 3300005616 | Bacteria | 1403 |
| 112 | Ga0068859_100016601 | 3300005617 | Bacteria | 7392 |
| 113 | Ga0068859_103050430 | 3300005617 | Bacteria | 511 |
| 114 | Ga0068864_100006225 | 3300005618 | Bacteria | 9790 |
| 115 | Ga0068864_100482376 | 3300005618 | Bacteria | 1190 |
| 116 | Ga0068864_101587465 | 3300005618 | Bacteria | 658 |
| 117 | Ga0068866_10106057 | 3300005718 | Bacteria | 1559 |
| 118 | Ga0068861_100234415 | 3300005719 | Bacteria | 1558 |
| 119 | Ga0068861_100765408 | 3300005719 | Bacteria | 903 |
| 120 | Ga0068861_101476274 | 3300005719 | Unclassified | 666 |
| 121 | Ga0068851_10021424 | 3300005834 | Bacteria | 3138 |
| 122 | Ga0068870_10083571 | 3300005840 | Bacteria | 1770 |
| 123 | Ga0068870_10169098 | 3300005840 | Bacteria | 1303 |
| 124 | Ga0068863_100005505 | 3300005841 | Bacteria | 12455 |
| 125 | Ga0068858_100094243 | 3300005842 | Bacteria | 2789 |
| 126 | Ga0068858_100863394 | 3300005842 | Bacteria | 884 |
| 127 | Ga0068860_100020654 | 3300005843 | Bacteria | 6380 |
| 128 | Ga0068860_101227569 | 3300005843 | Bacteria | 770 |
| 129 | Ga0068862_102556254 | 3300005844 | Unclassified | 522 |
| 130 | Ga0075365_10098589 | 3300006038 | Bacteria | 1999 |
| 131 | Ga0070716_100077342 | 3300006173 | Bacteria | 1975 |
| 132 | Ga0070712_100529768 | 3300006175 | Bacteria | 990 |
| 133 | Ga0097621_100193660 | 3300006237 | Bacteria | 1762 |
| 134 | Ga0068871_100077085 | 3300006358 | Bacteria | 2754 |
| 135 | Ga0075428_101903574 | 3300006844 | Bacteria | 618 |
| 136 | Ga0075430_100470919 | 3300006846 | Bacteria | 1037 |
| 137 | Ga0075433_11373984 | 3300006852 | Bacteria | 611 |
| 138 | Ga0075434_100614040 | 3300006871 | Bacteria | 1106 |
| 139 | Ga0075434_101918957 | 3300006871 | Unclassified | 598 |
| 140 | Ga0068865_100225611 | 3300006881 | Bacteria | 1467 |
| 141 | Ga0068865_100467022 | 3300006881 | Bacteria | 1046 |
| 142 | Ga0097620_100016601 | 3300006931 | Bacteria | 7392 |
| 143 | Ga0097620_103049100 | 3300006931 | Bacteria | 511 |
| 144 | Ga0099794_10019928 | 3300007265 | Bacteria | 3030 |
| 145 | Ga0111539_10051785 | 3300009094 | Bacteria | 4888 |
| 146 | Ga0111539_10295965 | 3300009094 | Bacteria | 1883 |
| 147 | Ga0105245_10004115 | 3300009098 | Bacteria | 12914 |
| 148 | Ga0105245_10024248 | 3300009098 | Bacteria | 5327 |
| 149 | Ga0105245_10059904 | 3300009098 | Bacteria | 3429 |
| 150 | Ga0105245_10707108 | 3300009098 | Unclassified | 1041 |
| 151 | Ga0105245_11043110 | 3300009098 | Bacteria | 863 |
| 152 | Ga0105245_11186140 | 3300009098 | Bacteria | 811 |
| 153 | Ga0105245_11876499 | 3300009098 | Bacteria | 652 |
| 154 | Ga0105247_10153010 | 3300009101 | Bacteria | 1521 |
| 155 | Ga0105247_10982794 | 3300009101 | Bacteria | 658 |
| 156 | Ga0105247_11655946 | 3300009101 | Unclassified | 527 |
| 157 | Ga0114129_10889677 | 3300009147 | Unclassified | 1129 |
| 158 | Ga0105243_10023619 | 3300009148 | Bacteria | 4684 |
| 159 | Ga0105241_10003107 | 3300009174 | Bacteria | 12355 |
| 160 | Ga0105242_10026035 | 3300009176 | Unclassified | 4633 |
| 161 | Ga0105242_10182527 | 3300009176 | Bacteria | 1852 |
| 162 | Ga0105242_10192544 | 3300009176 | Bacteria | 1806 |
| 163 | Ga0105242_10412234 | 3300009176 | Bacteria | 1264 |
| 164 | Ga0105242_11745645 | 3300009176 | Bacteria | 660 |
| 165 | Ga0105242_12102614 | 3300009176 | Bacteria | 608 |
| 166 | Ga0105248_10109141 | 3300009177 | Bacteria | 3120 |
| 167 | Ga0105248_10112991 | 3300009177 | Bacteria | 3063 |
| 168 | Ga0105248_10133496 | 3300009177 | Bacteria | 2800 |
| 169 | Ga0105237_11801493 | 3300009545 | Bacteria | 620 |
| 170 | Ga0105238_10546128 | 3300009551 | Unclassified | 1163 |
| 171 | Ga0105238_10655140 | 3300009551 | Bacteria | 1060 |
| 172 | Ga0105238_10981744 | 3300009551 | Bacteria | 865 |
| 173 | Ga0105249_11326207 | 3300009553 | Bacteria | 791 |
| 174 | Ga0099796_10149206 | 3300010159 | Bacteria | 919 |
| 175 | Ga0105239_10135725 | 3300010375 | Bacteria | 2739 |
| 176 | Ga0105239_12029537 | 3300010375 | Bacteria | 668 |
| 177 | Ga0105239_12253275 | 3300010375 | Unclassified | 634 |
| 178 | Ga0105239_12501170 | 3300010375 | Bacteria | 602 |
| 179 | Ga0105246_10003081 | 3300011119 | Bacteria | 10129 |
| 180 | Ga0105246_10674076 | 3300011119 | Bacteria | 903 |
| 181 | Ga0157373_10005183 | 3300013100 | Bacteria | 9793 |
| 182 | Ga0157371_10050431 | 3300013102 | Bacteria | 2957 |
| 183 | Ga0157371_10383737 | 3300013102 | Bacteria | 1026 |
| 184 | Ga0157370_10713586 | 3300013104 | Bacteria | 915 |
| 185 | Ga0157369_10185971 | 3300013105 | Bacteria | 2185 |
| 186 | Ga0157369_10367956 | 3300013105 | Bacteria | 1492 |
| 187 | Ga0157369_11862064 | 3300013105 | Bacteria | 611 |
| 188 | Ga0157374_10004045 | 3300013296 | Bacteria | 12317 |
| 189 | Ga0157374_10515331 | 3300013296 | Bacteria | 1201 |
| 190 | Ga0157374_11582350 | 3300013296 | Bacteria | 679 |
| 191 | Ga0157378_10290001 | 3300013297 | Bacteria | 1580 |
| 192 | Ga0157378_10514767 | 3300013297 | Unclassified | 1197 |
| 193 | Ga0157378_13065674 | 3300013297 | Bacteria | 519 |
| 194 | Ga0163162_12704703 | 3300013306 | Bacteria | 571 |
| 195 | Ga0157372_10147730 | 3300013307 | Unclassified | 2711 |
| 196 | Ga0157372_10276433 | 3300013307 | Bacteria | 1952 |
| 197 | Ga0157372_10545770 | 3300013307 | Bacteria | 1351 |
| 198 | Ga0157372_10922269 | 3300013307 | Bacteria | 1013 |
| 199 | Ga0157372_11521063 | 3300013307 | Bacteria | 771 |
| 200 | Ga0157372_12083247 | 3300013307 | Bacteria | 652 |
| 201 | Ga0157375_10789706 | 3300013308 | Bacteria | 1099 |
| 202 | Ga0157375_11247769 | 3300013308 | Bacteria | 873 |
| 203 | Ga0157375_13241110 | 3300013308 | Bacteria | 543 |
| 204 | Ga0163163_10033845 | 3300014325 | Bacteria | 4946 |
| 205 | Ga0163163_10077161 | 3300014325 | Bacteria | 3327 |
| 206 | Ga0163163_10463226 | 3300014325 | Bacteria | 1328 |
| 207 | Ga0157380_10031349 | 3300014326 | Bacteria | 4081 |
| 208 | Ga0157380_10488473 | 3300014326 | Bacteria | 1193 |
| 209 | Ga0182008_10145829 | 3300014497 | Bacteria | 1186 |
| 210 | Ga0157377_10001379 | 3300014745 | Bacteria | 10459 |
| 211 | Ga0157377_10005923 | 3300014745 | Bacteria | 5785 |
| 212 | Ga0157379_10108566 | 3300014968 | Bacteria | 2492 |
| 213 | Ga0157379_10755460 | 3300014968 | Bacteria | 916 |
| 214 | Ga0157379_12488812 | 3300014968 | Unclassified | 517 |
| 215 | Ga0157376_10090810 | 3300014969 | Unclassified | 2644 |
| 216 | Ga0206356_10305594 | 3300020070 | Unclassified | 824 |
| 217 | Ga0206356_11777551 | 3300020070 | Bacteria | 557 |
| 218 | Ga0206354_10694300 | 3300020081 | Unclassified | 518 |
| 219 | Ga0224712_10137691 | 3300022467 | Bacteria | 1072 |
| 220 | Ga0207653_10325855 | 3300025885 | Bacteria | 598 |
| 221 | Ga0207692_11010988 | 3300025898 | Bacteria | 549 |
| 222 | Ga0207710_10324558 | 3300025900 | Bacteria | 781 |
| 223 | Ga0207710_10723265 | 3300025900 | Bacteria | 522 |
| 224 | Ga0207680_10154818 | 3300025903 | Bacteria | 1531 |
| 225 | Ga0207647_10014246 | 3300025904 | Bacteria | 5486 |
| 226 | Ga0207647_10237147 | 3300025904 | Bacteria | 1048 |
| 227 | Ga0207647_10306306 | 3300025904 | Unclassified | 904 |
| 228 | Ga0207647_10735700 | 3300025904 | Bacteria | 535 |
| 229 | Ga0207643_10250473 | 3300025908 | Unclassified | 1091 |
| 230 | Ga0207705_10077966 | 3300025909 | Bacteria | 2411 |
| 231 | Ga0207705_10655266 | 3300025909 | Bacteria | 816 |
| 232 | Ga0207705_11523967 | 3300025909 | Bacteria | 506 |
| 233 | Ga0207684_10799532 | 3300025910 | Bacteria | 797 |
| 234 | Ga0207684_10894660 | 3300025910 | Bacteria | 746 |
| 235 | Ga0207654_10017080 | 3300025911 | Bacteria | 3789 |
| 236 | Ga0207707_10342245 | 3300025912 | Bacteria | 1289 |
| 237 | Ga0207707_10702520 | 3300025912 | Unclassified | 849 |
| 238 | Ga0207707_10777443 | 3300025912 | Bacteria | 799 |
| 239 | Ga0207693_10330823 | 3300025915 | Bacteria | 1193 |
| 240 | Ga0207663_10431529 | 3300025916 | Bacteria | 1013 |
| 241 | Ga0207663_10517678 | 3300025916 | Bacteria | 929 |
| 242 | Ga0207660_10129897 | 3300025917 | Bacteria | 1916 |
| 243 | Ga0207660_10856721 | 3300025917 | Bacteria | 742 |
| 244 | Ga0207662_10009275 | 3300025918 | Bacteria | 5407 |
| 245 | Ga0207662_10067775 | 3300025918 | Unclassified | 2153 |
| 246 | Ga0207662_10235372 | 3300025918 | Bacteria | 1197 |
| 247 | Ga0207662_10260948 | 3300025918 | Unclassified | 1140 |
| 248 | Ga0207657_10035490 | 3300025919 | Bacteria | 4470 |
| 249 | Ga0207657_10131841 | 3300025919 | Unclassified | 2048 |
| 250 | Ga0207657_10225359 | 3300025919 | Bacteria | 1501 |
| 251 | Ga0207649_10085363 | 3300025920 | Bacteria | 2054 |
| 252 | Ga0207649_10465119 | 3300025920 | Bacteria | 957 |
| 253 | Ga0207652_10005938 | 3300025921 | Bacteria | 9877 |
| 254 | Ga0207646_10063512 | 3300025922 | Bacteria | 3297 |
| 255 | Ga0207646_11846491 | 3300025922 | Bacteria | 516 |
| 256 | Ga0207681_10115431 | 3300025923 | Bacteria | 1960 |
| 257 | Ga0207681_11011635 | 3300025923 | Bacteria | 697 |
| 258 | Ga0207694_10319655 | 3300025924 | Bacteria | 1281 |
| 259 | Ga0207650_10006914 | 3300025925 | Bacteria | 7734 |
| 260 | Ga0207659_10012675 | 3300025926 | Bacteria | 5376 |
| 261 | Ga0207687_10017026 | 3300025927 | Bacteria | 4778 |
| 262 | Ga0207687_10120777 | 3300025927 | Bacteria | 1959 |
| 263 | Ga0207687_10136486 | 3300025927 | Bacteria | 1856 |
| 264 | Ga0207687_10153968 | 3300025927 | Bacteria | 1757 |
| 265 | Ga0207687_10537403 | 3300025927 | Bacteria | 979 |
| 266 | Ga0207687_10817308 | 3300025927 | Bacteria | 795 |
| 267 | Ga0207687_11012708 | 3300025927 | Bacteria | 712 |
| 268 | Ga0207687_11136137 | 3300025927 | Bacteria | 671 |
| 269 | Ga0207700_11808037 | 3300025928 | Bacteria | 537 |
| 270 | Ga0207644_10349095 | 3300025931 | Bacteria | 1201 |
| 271 | Ga0207644_10391078 | 3300025931 | Bacteria | 1135 |
| 272 | Ga0207644_10950460 | 3300025931 | Bacteria | 721 |
| 273 | Ga0207690_10007108 | 3300025932 | Bacteria | 6651 |
| 274 | Ga0207690_11566030 | 3300025932 | Bacteria | 551 |
| 275 | Ga0207706_10005278 | 3300025933 | Bacteria | 12049 |
| 276 | Ga0207706_10256218 | 3300025933 | Bacteria | 1528 |
| 277 | Ga0207706_10891628 | 3300025933 | Bacteria | 752 |
| 278 | Ga0207686_10116726 | 3300025934 | Bacteria | 1810 |
| 279 | Ga0207686_10178716 | 3300025934 | Bacteria | 1503 |
| 280 | Ga0207686_10229578 | 3300025934 | Unclassified | 1345 |
| 281 | Ga0207686_10243367 | 3300025934 | Bacteria | 1310 |
| 282 | Ga0207709_10381464 | 3300025935 | Bacteria | 1073 |
| 283 | Ga0207670_10116550 | 3300025936 | Bacteria | 1934 |
| 284 | Ga0207670_10580867 | 3300025936 | Bacteria | 918 |
| 285 | Ga0207669_10968472 | 3300025937 | Bacteria | 714 |
| 286 | Ga0207704_10401581 | 3300025938 | Bacteria | 1082 |
| 287 | Ga0207665_10218127 | 3300025939 | Bacteria | 1397 |
| 288 | Ga0207691_10003012 | 3300025940 | Bacteria | 16442 |
| 289 | Ga0207691_10482991 | 3300025940 | Bacteria | 1053 |
| 290 | Ga0207711_10037950 | 3300025941 | Bacteria | 4096 |
| 291 | Ga0207711_11017783 | 3300025941 | Unclassified | 768 |
| 292 | Ga0207689_10002837 | 3300025942 | Bacteria | 15987 |
| 293 | Ga0207689_10518060 | 3300025942 | Bacteria | 1000 |
| 294 | Ga0207661_10009529 | 3300025944 | Bacteria | 6971 |
| 295 | Ga0207661_10441350 | 3300025944 | Bacteria | 1185 |
| 296 | Ga0207661_10462200 | 3300025944 | Bacteria | 1157 |
| 297 | Ga0207661_10486911 | 3300025944 | Bacteria | 1126 |
| 298 | Ga0207661_10571705 | 3300025944 | Bacteria | 1036 |
| 299 | Ga0207679_10002036 | 3300025945 | Bacteria | 12538 |
| 300 | Ga0207679_10107844 | 3300025945 | Bacteria | 2192 |
| 301 | Ga0207679_10368465 | 3300025945 | Bacteria | 1257 |
| 302 | Ga0207679_11437631 | 3300025945 | Unclassified | 633 |
| 303 | Ga0207667_10068360 | 3300025949 | Bacteria | 3700 |
| 304 | Ga0207651_10296696 | 3300025960 | Unclassified | 1342 |
| 305 | Ga0207712_10448771 | 3300025961 | Bacteria | 1093 |
| 306 | Ga0207640_11113850 | 3300025981 | Bacteria | 699 |
| 307 | Ga0207658_10029329 | 3300025986 | Unclassified | 3885 |
| 308 | Ga0207677_10053071 | 3300026023 | Bacteria | 2757 |
| 309 | Ga0207677_10854379 | 3300026023 | Bacteria | 818 |
| 310 | Ga0207703_10063221 | 3300026035 | Bacteria | 3034 |
| 311 | Ga0207703_11055235 | 3300026035 | Unclassified | 780 |
| 312 | Ga0207639_10395211 | 3300026041 | Bacteria | 1244 |
| 313 | Ga0207639_11270305 | 3300026041 | Unclassified | 691 |
| 314 | Ga0207678_10228934 | 3300026067 | Bacteria | 1592 |
| 315 | Ga0207678_10399308 | 3300026067 | Bacteria | 1190 |
| 316 | Ga0207708_10001216 | 3300026075 | Bacteria | 19447 |
| 317 | Ga0207702_10019900 | 3300026078 | Bacteria | 5560 |
| 318 | Ga0207702_12085338 | 3300026078 | Unclassified | 557 |
| 319 | Ga0207641_10029996 | 3300026088 | Bacteria | 4501 |
| 320 | Ga0207641_10861065 | 3300026088 | Bacteria | 899 |
| 321 | Ga0207676_10010699 | 3300026095 | Bacteria | 6541 |
| 322 | Ga0207676_10085360 | 3300026095 | Bacteria | 2576 |
| 323 | Ga0207676_10739396 | 3300026095 | Bacteria | 956 |
| 324 | Ga0207676_11795107 | 3300026095 | Bacteria | 612 |
| 325 | Ga0207674_10003606 | 3300026116 | Bacteria | 18875 |
| 326 | Ga0207674_10636536 | 3300026116 | Bacteria | 1030 |
| 327 | Ga0207674_11000647 | 3300026116 | Bacteria | 805 |
| 328 | Ga0207675_100038790 | 3300026118 | Bacteria | 4445 |
| 329 | Ga0207675_100468887 | 3300026118 | Bacteria | 1250 |
| 330 | Ga0207675_100863643 | 3300026118 | Bacteria | 920 |
| 331 | Ga0207683_10298219 | 3300026121 | Bacteria | 1475 |
| 332 | Ga0207698_10016763 | 3300026142 | Bacteria | 4950 |
| 333 | Ga0207698_10391197 | 3300026142 | Bacteria | 1326 |
| 334 | Ga0207698_10673310 | 3300026142 | Bacteria | 1027 |
| 335 | Ga0210000_1026640 | 3300027462 | Bacteria | 897 |
| 336 | Ga0209999_1117244 | 3300027543 | Bacteria | 521 |
| 337 | Ga0209983_1168717 | 3300027665 | Unclassified | 502 |
| 338 | Ga0209588_1101975 | 3300027671 | Bacteria | 923 |
| 339 | Ga0207428_10231124 | 3300027907 | Bacteria | 1384 |
| 340 | Ga0207428_10558762 | 3300027907 | Bacteria | 827 |
| 341 | Ga0268266_10091701 | 3300028379 | Bacteria | 2665 |
| 342 | Ga0268266_11063302 | 3300028379 | Bacteria | 783 |
| 343 | Ga0268265_11166937 | 3300028380 | Bacteria | 767 |
| 344 | Ga0268264_10026611 | 3300028381 | Unclassified | 4727 |
| 345 | Ga0307413_11057233 | 3300031824 | Bacteria | 699 |
| 346 | Ga0307410_10442054 | 3300031852 | Bacteria | 1059 |
| 347 | Ga0307407_10151600 | 3300031903 | Bacteria | 1507 |
| 348 | Ga0307409_100147958 | 3300031995 | Bacteria | 2034 |
| 349 | Ga0307416_100039737 | 3300032002 | Bacteria | 3647 |
| 350 | Ga0307415_100027089 | 3300032126 | Bacteria | 3627 |
| 351 | Ga0373961_0314845 | 3300035241 | Unclassified | 582 |
| 352 | Ga0373931_0210256 | 3300035691 | Bacteria | 1166 |
| 353 | Ga0373937_0942645 | 3300036401 | Unclassified | 812 |
| 354 | Ga0436365_0762781 | 3300039437 | Bacteria | 2419 |
| 355 | Ga0436363_0411944 | 3300039450 | Bacteria | 804 |
| 356 | Ga0451847_0640495 | 3300041503 | Bacteria | 550 |
| 357 | Ga0451855_0900340 | 3300041511 | Bacteria | 915 |
| 358 | Ga0451577_1108488 | 3300042876 | Bacteria | 708 |
| 359 | Ga0466961_0195414 | 3300044693 | Bacteria | 1253 |
| 360 | Ga0466961_0481660 | 3300044693 | Bacteria | 750 |
| 361 | Ga0466963_0056055 | 3300044694 | Bacteria | 2622 |
| 362 | Ga0466963_0131814 | 3300044694 | Bacteria | 1727 |
| 363 | Ga0466963_0154006 | 3300044694 | Bacteria | 1597 |
| 364 | Ga0466963_0228733 | 3300044694 | Bacteria | 1303 |
| 365 | Ga0466963_0368016 | 3300044694 | Bacteria | 1013 |
| 366 | Ga0466963_0728938 | 3300044694 | Unclassified | 699 |
| 367 | Ga0466963_1103694 | 3300044694 | Bacteria | 558 |
| 368 | Ga0466964_0688428 | 3300044706 | Bacteria | 569 |
| 369 | Ga0466971_0027958 | 3300044719 | Bacteria | 2525 |
| 370 | Ga0466971_0215362 | 3300044719 | Bacteria | 909 |
| 371 | Ga0466970_0573257 | 3300044765 | Bacteria | 653 |
| 372 | Ga0466957_0207807 | 3300044842 | Bacteria | 1288 |
| 373 | Ga0466957_0362452 | 3300044842 | Bacteria | 985 |
| 374 | Ga0466957_0417689 | 3300044842 | Bacteria | 920 |
| 375 | Ga0466960_0019883 | 3300044901 | Bacteria | 2965 |
| 376 | Ga0466960_0039445 | 3300044901 | Bacteria | 2228 |
| 377 | Ga0466959_0381482 | 3300045049 | Bacteria | 959 |
| 378 | Ga0451576_1026596 | 3300045051 | Bacteria | 864 |
| 379 | Ga0466958_0247466 | 3300045836 | Bacteria | 1140 |
| 380 | Ga0466958_0857545 | 3300045836 | Bacteria | 592 |
| 381 | Ga0466967_0004734 | 3300045976 | Bacteria | 9255 |
| 382 | Ga0466967_0044906 | 3300045976 | Bacteria | 3837 |
| 383 | Ga0466967_0055716 | 3300045976 | Bacteria | 3483 |
| 384 | Ga0466967_0322681 | 3300045976 | Bacteria | 1489 |
| 385 | Ga0466967_0537579 | 3300045976 | Bacteria | 1149 |
| 386 | Ga0466967_0899096 | 3300045976 | Bacteria | 880 |
| 387 | Ga0466967_0974869 | 3300045976 | Bacteria | 844 |
| 388 | Ga0466967_1029901 | 3300045976 | Bacteria | 820 |
| 389 | Ga0495629_0019837 | 3300046459 | Bacteria | 4798 |
| 390 | Ga0495582_0008895 | 3300046473 | Bacteria | 5541 |
| 391 | Ga0495665_0062028 | 3300046531 | Unclassified | 1974 |
| 392 | Ga0495586_0623299 | 3300046535 | Bacteria | 623 |
| 393 | Ga0495645_0691426 | 3300046543 | Bacteria | 620 |
| 394 | Ga0495635_0239686 | 3300046663 | Bacteria | 1224 |
| 395 | Ga0495658_0116357 | 3300046683 | Unclassified | 1612 |
| 396 | Ga0495581_0004249 | 3300047315 | Bacteria | 8260 |
| 397 | Ga0495674_0923142 | 3300047319 | Bacteria | 673 |
| 398 | Ga0495674_1189858 | 3300047319 | Unclassified | 576 |
| 399 | Ga0495675_0183509 | 3300047444 | Bacteria | 1280 |
| 400 | Ga0496100_0274382 | 3300048903 | Bacteria | 1255 |
| 401 | Ga0496101_0127200 | 3300048904 | Bacteria | 1932 |
| 402 | Ga0496102_0165675 | 3300048905 | Bacteria | 2080 |
| 403 | Ga0496102_0203386 | 3300048905 | Bacteria | 1867 |
| 404 | Ga0496102_0283992 | 3300048905 | Bacteria | 1560 |
| 405 | Ga0496102_0497497 | 3300048905 | Bacteria | 1141 |
| 406 | Ga0496102_0762835 | 3300048905 | Unclassified | 890 |
| 407 | Ga0496102_1442849 | 3300048905 | Bacteria | 607 |
| 408 | Ga0496104_0279981 | 3300048907 | Bacteria | 1581 |
| 409 | Ga0496104_0616102 | 3300048907 | Bacteria | 995 |
| 410 | Ga0496105_0341959 | 3300048908 | Bacteria | 1196 |
| 411 | Ga0496105_0365114 | 3300048908 | Bacteria | 1151 |
| 412 | Ga0496105_1332281 | 3300048908 | Bacteria | 523 |
| 413 | Ga0496107_0458971 | 3300048910 | Bacteria | 946 |
| 414 | Ga0496107_1120467 | 3300048910 | Bacteria | 568 |
| 415 | Ga0496108_0006084 | 3300048911 | Bacteria | 9758 |
| 416 | Ga0496108_0124717 | 3300048911 | Bacteria | 2210 |
| 417 | Ga0496108_0248811 | 3300048911 | Bacteria | 1546 |
| 418 | Ga0496108_0291037 | 3300048911 | Bacteria | 1422 |
| 419 | Ga0496108_0794833 | 3300048911 | Bacteria | 816 |
| 420 | Ga0496109_0062932 | 3300048912 | Bacteria | 3393 |
| 421 | Ga0496109_0130287 | 3300048912 | Unclassified | 2347 |
| 422 | Ga0496109_0284600 | 3300048912 | Bacteria | 1558 |
| 423 | Ga0496109_0434408 | 3300048912 | Bacteria | 1240 |
| 424 | Ga0496110_0017171 | 3300048913 | Bacteria | 6051 |
| 425 | Ga0496110_0251604 | 3300048913 | Bacteria | 1608 |
| 426 | Ga0496110_0554433 | 3300048913 | Bacteria | 1044 |
| 427 | Ga0496111_0033505 | 3300048914 | Bacteria | 3664 |
| 428 | Ga0496111_0040213 | 3300048914 | Unclassified | 3354 |
| 429 | Ga0496111_0510515 | 3300048914 | Bacteria | 884 |
| 430 | Ga0496111_0853531 | 3300048914 | Bacteria | 657 |
| 431 | Ga0496112_0044862 | 3300048915 | Bacteria | 4332 |
| 432 | Ga0496112_0273918 | 3300048915 | Bacteria | 1636 |
| 433 | Ga0496113_0016808 | 3300048916 | Bacteria | 5062 |
| 434 | Ga0496113_0110795 | 3300048916 | Bacteria | 2136 |
| 435 | Ga0496113_0628591 | 3300048916 | Bacteria | 859 |
| 436 | Ga0496114_0010259 | 3300048917 | Bacteria | 7454 |
| 437 | Ga0496114_0073710 | 3300048917 | Bacteria | 2873 |
| 438 | Ga0496114_0099235 | 3300048917 | Bacteria | 2484 |
| 439 | Ga0496114_0117167 | 3300048917 | Bacteria | 2288 |
| 440 | Ga0496114_0144883 | 3300048917 | Bacteria | 2059 |
| 441 | Ga0496114_0673670 | 3300048917 | Bacteria | 908 |
| 442 | Ga0496115_0037682 | 3300048918 | Bacteria | 3832 |
| 443 | Ga0496115_0718693 | 3300048918 | Bacteria | 784 |
| 444 | Ga0496121_0486599 | 3300048924 | Unclassified | 787 |
| 445 | Ga0496126_0705106 | 3300048929 | Bacteria | 784 |
| 446 | Ga0501031_0925851 | 3300049568 | Bacteria | 558 |
| 447 | Ga0501076_0044089 | 3300049592 | Bacteria | 3517 |
| 448 | Ga0501076_0294114 | 3300049592 | Bacteria | 1331 |
| 449 | Ga0501227_066426 | 3300049665 | Bacteria | 931 |
| 450 | Ga0501239_070017 | 3300049672 | Bacteria | 544 |
| 451 | Ga0501035_0394759 | 3300049822 | Unclassified | 1152 |
| 452 | nmdc:mga00v17_833742_c1 | 3300050491 | Bacteria | 586 |
| 453 | nmdc:mga05p37_1091226_c1 | 3300050507 | Bacteria | 837 |
| 454 | nmdc:mga05p37_1620837_c1 | 3300050507 | Bacteria | 636 |
| 455 | nmdc:mga09592_1000153_c1 | 3300050508 | Unclassified | 699 |
| 456 | nmdc:mga0qj67_672588_c1 | 3300050509 | Bacteria | 825 |
| 457 | nmdc:mga08y16_100833_c1 | 3300050511 | Bacteria | 3006 |
| 458 | nmdc:mga08y16_813146_c1 | 3300050511 | Bacteria | 927 |
| 459 | Ga0495601_0134447 | 3300053077 | Bacteria | 1612 |
| 460 | Ga0495595_0737134 | 3300053084 | Bacteria | 505 |
| 461 | Ga0495619_0922335 | 3300053085 | Bacteria | 587 |
| 462 | Ga0501084_0776806 | 3300054114 | Unclassified | 807 |
| 463 | Ga0590075_116437 | 3300059424 | Bacteria | 699 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009098 | Ga0105245_10024248 | Ga0105245_100242485 | 76 |
| 2 | 3300013102 | Ga0157371_10383737 | Ga0157371_103837372 | 76 |
| 3 | 3300013105 | Ga0157369_11862064 | Ga0157369_118620641 | 76 |
| 4 | 3300013307 | Ga0157372_10276433 | Ga0157372_102764333 | 76 |
| 5 | 3300013308 | Ga0157375_10789706 | Ga0157375_107897062 | 76 |
| 6 | 3300022467 | Ga0224712_10137691 | Ga0224712_101376912 | 76 |
| 7 | 3300025922 | Ga0207646_10063512 | Ga0207646_100635122 | 76 |
| 8 | 3300048908 | Ga0496105_0365114 | Ga0496105_0365114_534_767 | 76 |
| 9 | 3300048911 | Ga0496108_0006084 | Ga0496108_0006084_5072_5305 | 76 |
| 10 | 3300048912 | Ga0496109_0062932 | Ga0496109_0062932_932_1165 | 76 |
| 11 | 3300048914 | Ga0496111_0853531 | Ga0496111_0853531_189_422 | 76 |
| 12 | 3300048917 | Ga0496114_0144883 | Ga0496114_0144883_1358_1591 | 76 |
| 13 | 3300049592 | Ga0501076_0044089 | Ga0501076_0044089_2735_2974 | 77 |
| 14 | 3300006846 | Ga0075430_100470919 | Ga0075430_1004709192 | 78 |
| 15 | 3300025937 | Ga0207669_10968472 | Ga0207669_109684722 | 78 |
| 16 | 3300026116 | Ga0207674_10636536 | Ga0207674_106365362 | 78 |
| 17 | 3300045976 | Ga0466967_0004734 | Ga0466967_0004734_1943_2182 | 78 |
| 18 | 3300045976 | Ga0466967_0055716 | Ga0466967_0055716_244_483 | 78 |
| 19 | 3300046535 | Ga0495586_0623299 | Ga0495586_0623299_11_250 | 78 |
| 20 | 3300048910 | Ga0496107_1120467 | Ga0496107_1120467_64_303 | 78 |
| 21 | 3300048911 | Ga0496108_0248811 | Ga0496108_0248811_34_273 | 78 |
| 22 | 3300048912 | Ga0496109_0284600 | Ga0496109_0284600_1271_1510 | 78 |
| 23 | 3300048913 | Ga0496110_0251604 | Ga0496110_0251604_1337_1576 | 78 |
| 24 | 3300048917 | Ga0496114_0099235 | Ga0496114_0099235_1475_1714 | 78 |
| 25 | 3300050509 | nmdc:mga0qj67_672588_c1 | nmdc:mga0qj67_672588_c1_401_640 | 78 |
| 26 | 3300050511 | nmdc:mga08y16_100833_c1 | nmdc:mga08y16_100833_c1_2729_2968 | 78 |
| 27 | 3300050511 | nmdc:mga08y16_813146_c1 | nmdc:mga08y16_813146_c1_149_388 | 78 |
| 28 | 3300005535 | Ga0070684_101745851 | Ga0070684_1017458511 | 80 |
| 29 | 3300010375 | Ga0105239_12029537 | Ga0105239_120295371 | 80 |
| 30 | 3300025927 | Ga0207687_10017026 | Ga0207687_100170263 | 80 |
| 31 | 3300026023 | Ga0207677_10854379 | Ga0207677_108543792 | 80 |
| 32 | 3300026078 | Ga0207702_12085338 | Ga0207702_120853382 | 80 |
| 33 | 3300026142 | Ga0207698_10391197 | Ga0207698_103911973 | 80 |
| 34 | 3300036401 | Ga0373937_0942645 | Ga0373937_0942645_332_577 | 80 |
| 35 | 3300004798 | Ga0058859_11270189 | Ga0058859_112701891 | 81 |
| 36 | 3300004800 | Ga0058861_11710926 | Ga0058861_117109261 | 81 |
| 37 | 3300004803 | Ga0058862_10008947 | Ga0058862_100089471 | 81 |
| 38 | 3300005290 | Ga0065712_10283164 | Ga0065712_102831642 | 81 |
| 39 | 3300005328 | Ga0070676_10685634 | Ga0070676_106856341 | 81 |
| 40 | 3300005329 | Ga0070683_100006027 | Ga0070683_1000060273 | 81 |
| 41 | 3300005329 | Ga0070683_100212923 | Ga0070683_1002129231 | 81 |
| 42 | 3300005329 | Ga0070683_100418567 | Ga0070683_1004185672 | 81 |
| 43 | 3300005330 | Ga0070690_100126228 | Ga0070690_1001262281 | 81 |
| 44 | 3300005330 | Ga0070690_100536832 | Ga0070690_1005368322 | 81 |
| 45 | 3300005331 | Ga0070670_100001650 | Ga0070670_1000016505 | 81 |
| 46 | 3300005334 | Ga0068869_100001541 | Ga0068869_1000015417 | 81 |
| 47 | 3300005335 | Ga0070666_10860857 | Ga0070666_108608571 | 81 |
| 48 | 3300005336 | Ga0070680_100104441 | Ga0070680_1001044412 | 81 |
| 49 | 3300005337 | Ga0070682_100003515 | Ga0070682_1000035152 | 81 |
| 50 | 3300005338 | Ga0068868_100104297 | Ga0068868_1001042972 | 81 |
| 51 | 3300005339 | Ga0070660_100024694 | Ga0070660_1000246942 | 81 |
| 52 | 3300005340 | Ga0070689_100195876 | Ga0070689_1001958762 | 81 |
| 53 | 3300005343 | Ga0070687_100443944 | Ga0070687_1004439442 | 81 |
| 54 | 3300005343 | Ga0070687_100870100 | Ga0070687_1008701001 | 81 |
| 55 | 3300005344 | Ga0070661_100001319 | Ga0070661_1000013192 | 81 |
| 56 | 3300005345 | Ga0070692_10010465 | Ga0070692_100104654 | 81 |
| 57 | 3300005354 | Ga0070675_100024459 | Ga0070675_1000244595 | 81 |
| 58 | 3300005355 | Ga0070671_100345757 | Ga0070671_1003457572 | 81 |
| 59 | 3300005355 | Ga0070671_100527772 | Ga0070671_1005277722 | 81 |
| 60 | 3300005364 | Ga0070673_100025570 | Ga0070673_1000255702 | 81 |
| 61 | 3300005364 | Ga0070673_101404938 | Ga0070673_1014049381 | 81 |
| 62 | 3300005365 | Ga0070688_100698786 | Ga0070688_1006987862 | 81 |
| 63 | 3300005366 | Ga0070659_100000532 | Ga0070659_10000053211 | 81 |
| 64 | 3300005367 | Ga0070667_100145539 | Ga0070667_1001455392 | 81 |
| 65 | 3300005436 | Ga0070713_100216534 | Ga0070713_1002165341 | 81 |
| 66 | 3300005436 | Ga0070713_101454880 | Ga0070713_1014548801 | 81 |
| 67 | 3300005438 | Ga0070701_11023423 | Ga0070701_110234232 | 81 |
| 68 | 3300005440 | Ga0070705_100384600 | Ga0070705_1003846002 | 81 |
| 69 | 3300005455 | Ga0070663_100197312 | Ga0070663_1001973121 | 81 |
| 70 | 3300005457 | Ga0070662_100044956 | Ga0070662_1000449562 | 81 |
| 71 | 3300005458 | Ga0070681_10231694 | Ga0070681_102316942 | 81 |
| 72 | 3300005468 | Ga0070707_102293474 | Ga0070707_1022934741 | 81 |
| 73 | 3300005530 | Ga0070679_100033762 | Ga0070679_1000337625 | 81 |
| 74 | 3300005535 | Ga0070684_100015201 | Ga0070684_1000152016 | 81 |
| 75 | 3300005535 | Ga0070684_100127630 | Ga0070684_1001276302 | 81 |
| 76 | 3300005535 | Ga0070684_101982002 | Ga0070684_1019820021 | 81 |
| 77 | 3300005539 | Ga0068853_100021271 | Ga0068853_1000212716 | 81 |
| 78 | 3300005543 | Ga0070672_101307427 | Ga0070672_1013074272 | 81 |
| 79 | 3300005544 | Ga0070686_100143040 | Ga0070686_1001430401 | 81 |
| 80 | 3300005545 | Ga0070695_100285663 | Ga0070695_1002856632 | 81 |
| 81 | 3300005547 | Ga0070693_100033249 | Ga0070693_1000332492 | 81 |
| 82 | 3300005563 | Ga0068855_100152037 | Ga0068855_1001520373 | 81 |
| 83 | 3300005564 | Ga0070664_100062862 | Ga0070664_1000628622 | 81 |
| 84 | 3300005564 | Ga0070664_100072886 | Ga0070664_1000728862 | 81 |
| 85 | 3300005577 | Ga0068857_100239870 | Ga0068857_1002398702 | 81 |
| 86 | 3300005614 | Ga0068856_100019110 | Ga0068856_1000191107 | 81 |
| 87 | 3300005615 | Ga0070702_100087235 | Ga0070702_1000872352 | 81 |
| 88 | 3300005616 | Ga0068852_100008867 | Ga0068852_1000088674 | 81 |
| 89 | 3300005617 | Ga0068859_100016601 | Ga0068859_1000166014 | 81 |
| 90 | 3300005618 | Ga0068864_100006225 | Ga0068864_10000622511 | 81 |
| 91 | 3300005719 | Ga0068861_101476274 | Ga0068861_1014762741 | 81 |
| 92 | 3300005834 | Ga0068851_10021424 | Ga0068851_100214242 | 81 |
| 93 | 3300005840 | Ga0068870_10083571 | Ga0068870_100835712 | 81 |
| 94 | 3300005841 | Ga0068863_100005505 | Ga0068863_1000055052 | 81 |
| 95 | 3300005842 | Ga0068858_100094243 | Ga0068858_1000942432 | 81 |
| 96 | 3300005843 | Ga0068860_100020654 | Ga0068860_1000206545 | 81 |
| 97 | 3300005844 | Ga0068862_102556254 | Ga0068862_1025562542 | 81 |
| 98 | 3300006237 | Ga0097621_100193660 | Ga0097621_1001936602 | 81 |
| 99 | 3300006358 | Ga0068871_100077085 | Ga0068871_1000770853 | 81 |
| 100 | 3300006852 | Ga0075433_11373984 | Ga0075433_113739842 | 81 |
| 101 | 3300006871 | Ga0075434_101918957 | Ga0075434_1019189572 | 81 |
| 102 | 3300006931 | Ga0097620_100016601 | Ga0097620_1000166014 | 81 |
| 103 | 3300009098 | Ga0105245_10004115 | Ga0105245_100041152 | 81 |
| 104 | 3300009098 | Ga0105245_10707108 | Ga0105245_107071082 | 81 |
| 105 | 3300009101 | Ga0105247_10153010 | Ga0105247_101530102 | 81 |
| 106 | 3300009101 | Ga0105247_11655946 | Ga0105247_116559462 | 81 |
| 107 | 3300009174 | Ga0105241_10003107 | Ga0105241_100031073 | 81 |
| 108 | 3300009176 | Ga0105242_10026035 | Ga0105242_100260352 | 81 |
| 109 | 3300009176 | Ga0105242_10182527 | Ga0105242_101825272 | 81 |
| 110 | 3300009176 | Ga0105242_12102614 | Ga0105242_121026142 | 81 |
| 111 | 3300009177 | Ga0105248_10109141 | Ga0105248_101091412 | 81 |
| 112 | 3300009177 | Ga0105248_10112991 | Ga0105248_101129913 | 81 |
| 113 | 3300009551 | Ga0105238_10546128 | Ga0105238_105461282 | 81 |
| 114 | 3300010375 | Ga0105239_10135725 | Ga0105239_101357253 | 81 |
| 115 | 3300010375 | Ga0105239_12253275 | Ga0105239_122532752 | 81 |
| 116 | 3300011119 | Ga0105246_10003081 | Ga0105246_100030816 | 81 |
| 117 | 3300013100 | Ga0157373_10005183 | Ga0157373_100051836 | 81 |
| 118 | 3300013102 | Ga0157371_10050431 | Ga0157371_100504313 | 81 |
| 119 | 3300013104 | Ga0157370_10713586 | Ga0157370_107135862 | 81 |
| 120 | 3300013105 | Ga0157369_10367956 | Ga0157369_103679563 | 81 |
| 121 | 3300013296 | Ga0157374_10004045 | Ga0157374_100040454 | 81 |
| 122 | 3300013297 | Ga0157378_10290001 | Ga0157378_102900012 | 81 |
| 123 | 3300013297 | Ga0157378_10514767 | Ga0157378_105147671 | 81 |
| 124 | 3300013306 | Ga0163162_12704703 | Ga0163162_127047031 | 81 |
| 125 | 3300013307 | Ga0157372_10147730 | Ga0157372_101477303 | 81 |
| 126 | 3300013307 | Ga0157372_10545770 | Ga0157372_105457702 | 81 |
| 127 | 3300014325 | Ga0163163_10077161 | Ga0163163_100771612 | 81 |
| 128 | 3300014325 | Ga0163163_10463226 | Ga0163163_104632262 | 81 |
| 129 | 3300014745 | Ga0157377_10001379 | Ga0157377_100013797 | 81 |
| 130 | 3300014968 | Ga0157379_10108566 | Ga0157379_101085662 | 81 |
| 131 | 3300014968 | Ga0157379_12488812 | Ga0157379_124888121 | 81 |
| 132 | 3300014969 | Ga0157376_10090810 | Ga0157376_100908102 | 81 |
| 133 | 3300020070 | Ga0206356_10305594 | Ga0206356_103055941 | 81 |
| 134 | 3300020081 | Ga0206354_10694300 | Ga0206354_106943001 | 81 |
| 135 | 3300025900 | Ga0207710_10324558 | Ga0207710_103245582 | 81 |
| 136 | 3300025903 | Ga0207680_10154818 | Ga0207680_101548181 | 81 |
| 137 | 3300025904 | Ga0207647_10306306 | Ga0207647_103063062 | 81 |
| 138 | 3300025908 | Ga0207643_10250473 | Ga0207643_102504732 | 81 |
| 139 | 3300025911 | Ga0207654_10017080 | Ga0207654_100170804 | 81 |
| 140 | 3300025912 | Ga0207707_10342245 | Ga0207707_103422452 | 81 |
| 141 | 3300025917 | Ga0207660_10129897 | Ga0207660_101298972 | 81 |
| 142 | 3300025918 | Ga0207662_10067775 | Ga0207662_100677751 | 81 |
| 143 | 3300025918 | Ga0207662_10235372 | Ga0207662_102353722 | 81 |
| 144 | 3300025919 | Ga0207657_10131841 | Ga0207657_101318412 | 81 |
| 145 | 3300025920 | Ga0207649_10085363 | Ga0207649_100853632 | 81 |
| 146 | 3300025921 | Ga0207652_10005938 | Ga0207652_100059382 | 81 |
| 147 | 3300025924 | Ga0207694_10319655 | Ga0207694_103196552 | 81 |
| 148 | 3300025925 | Ga0207650_10006914 | Ga0207650_100069144 | 81 |
| 149 | 3300025926 | Ga0207659_10012675 | Ga0207659_100126754 | 81 |
| 150 | 3300025927 | Ga0207687_10136486 | Ga0207687_101364862 | 81 |
| 151 | 3300025927 | Ga0207687_10153968 | Ga0207687_101539682 | 81 |
| 152 | 3300025928 | Ga0207700_11808037 | Ga0207700_118080371 | 81 |
| 153 | 3300025931 | Ga0207644_10349095 | Ga0207644_103490952 | 81 |
| 154 | 3300025931 | Ga0207644_10391078 | Ga0207644_103910782 | 81 |
| 155 | 3300025932 | Ga0207690_10007108 | Ga0207690_100071083 | 81 |
| 156 | 3300025933 | Ga0207706_10005278 | Ga0207706_100052783 | 81 |
| 157 | 3300025934 | Ga0207686_10178716 | Ga0207686_101787163 | 81 |
| 158 | 3300025934 | Ga0207686_10229578 | Ga0207686_102295782 | 81 |
| 159 | 3300025936 | Ga0207670_10580867 | Ga0207670_105808671 | 81 |
| 160 | 3300025941 | Ga0207711_10037950 | Ga0207711_100379504 | 81 |
| 161 | 3300025941 | Ga0207711_11017783 | Ga0207711_110177832 | 81 |
| 162 | 3300025942 | Ga0207689_10002837 | Ga0207689_1000283718 | 81 |
| 163 | 3300025944 | Ga0207661_10009529 | Ga0207661_100095294 | 81 |
| 164 | 3300025944 | Ga0207661_10462200 | Ga0207661_104622001 | 81 |
| 165 | 3300025944 | Ga0207661_10571705 | Ga0207661_105717052 | 81 |
| 166 | 3300025945 | Ga0207679_10002036 | Ga0207679_1000203614 | 81 |
| 167 | 3300025945 | Ga0207679_10107844 | Ga0207679_101078442 | 81 |
| 168 | 3300025949 | Ga0207667_10068360 | Ga0207667_100683602 | 81 |
| 169 | 3300025960 | Ga0207651_10296696 | Ga0207651_102966962 | 81 |
| 170 | 3300025981 | Ga0207640_11113850 | Ga0207640_111138501 | 81 |
| 171 | 3300025986 | Ga0207658_10029329 | Ga0207658_100293292 | 81 |
| 172 | 3300026023 | Ga0207677_10053071 | Ga0207677_100530712 | 81 |
| 173 | 3300026035 | Ga0207703_10063221 | Ga0207703_100632212 | 81 |
| 174 | 3300026035 | Ga0207703_11055235 | Ga0207703_110552351 | 81 |
| 175 | 3300026041 | Ga0207639_10395211 | Ga0207639_103952112 | 81 |
| 176 | 3300026067 | Ga0207678_10228934 | Ga0207678_102289342 | 81 |
| 177 | 3300026078 | Ga0207702_10019900 | Ga0207702_100199002 | 81 |
| 178 | 3300026088 | Ga0207641_10029996 | Ga0207641_100299964 | 81 |
| 179 | 3300026095 | Ga0207676_10010699 | Ga0207676_100106992 | 81 |
| 180 | 3300026095 | Ga0207676_10085360 | Ga0207676_100853603 | 81 |
| 181 | 3300026116 | Ga0207674_10003606 | Ga0207674_1000360619 | 81 |
| 182 | 3300026142 | Ga0207698_10016763 | Ga0207698_100167635 | 81 |
| 183 | 3300028381 | Ga0268264_10026611 | Ga0268264_100266112 | 81 |
| 184 | 3300035691 | Ga0373931_0210256 | Ga0373931_0210256_545_793 | 81 |
| 185 | 3300041503 | Ga0451847_0640495 | Ga0451847_0640495_205_453 | 81 |
| 186 | 3300046459 | Ga0495629_0019837 | Ga0495629_0019837_4188_4436 | 81 |
| 187 | 3300046473 | Ga0495582_0008895 | Ga0495582_0008895_4624_4872 | 81 |
| 188 | 3300046531 | Ga0495665_0062028 | Ga0495665_0062028_599_847 | 81 |
| 189 | 3300046683 | Ga0495658_0116357 | Ga0495658_0116357_654_902 | 81 |
| 190 | 3300047315 | Ga0495581_0004249 | Ga0495581_0004249_7016_7264 | 81 |
| 191 | 3300047319 | Ga0495674_1189858 | Ga0495674_1189858_51_299 | 81 |
| 192 | 3300047444 | Ga0495675_0183509 | Ga0495675_0183509_601_849 | 81 |
| 193 | 3300048915 | Ga0496112_0273918 | Ga0496112_0273918_1168_1416 | 81 |
| 194 | 3300048916 | Ga0496113_0110795 | Ga0496113_0110795_719_967 | 81 |
| 195 | 3300053077 | Ga0495601_0134447 | Ga0495601_0134447_382_630 | 81 |
| 196 | 3300053084 | Ga0495595_0737134 | Ga0495595_0737134_113_361 | 81 |
| 197 | 3300053085 | Ga0495619_0922335 | Ga0495619_0922335_148_396 | 81 |
| 198 | 3300002067 | JGI24735J21928_10020853 | JGI24735J21928_100208531 | 82 |
| 199 | 3300005290 | Ga0065712_10573527 | Ga0065712_105735272 | 82 |
| 200 | 3300005293 | Ga0065715_10164626 | Ga0065715_101646262 | 82 |
| 201 | 3300005295 | Ga0065707_10302798 | Ga0065707_103027982 | 82 |
| 202 | 3300005327 | Ga0070658_10096271 | Ga0070658_100962712 | 82 |
| 203 | 3300005327 | Ga0070658_10790553 | Ga0070658_107905531 | 82 |
| 204 | 3300005327 | Ga0070658_10871368 | Ga0070658_108713682 | 82 |
| 205 | 3300005329 | Ga0070683_100010042 | Ga0070683_1000100425 | 82 |
| 206 | 3300005329 | Ga0070683_100125463 | Ga0070683_1001254631 | 82 |
| 207 | 3300005336 | Ga0070680_100027097 | Ga0070680_1000270977 | 82 |
| 208 | 3300005336 | Ga0070680_100385897 | Ga0070680_1003858972 | 82 |
| 209 | 3300005337 | Ga0070682_100948978 | Ga0070682_1009489781 | 82 |
| 210 | 3300005338 | Ga0068868_101279769 | Ga0068868_1012797692 | 82 |
| 211 | 3300005339 | Ga0070660_100030166 | Ga0070660_1000301662 | 82 |
| 212 | 3300005340 | Ga0070689_100117627 | Ga0070689_1001176273 | 82 |
| 213 | 3300005340 | Ga0070689_101458086 | Ga0070689_1014580861 | 82 |
| 214 | 3300005343 | Ga0070687_100053069 | Ga0070687_1000530693 | 82 |
| 215 | 3300005343 | Ga0070687_100560294 | Ga0070687_1005602941 | 82 |
| 216 | 3300005344 | Ga0070661_101735839 | Ga0070661_1017358391 | 82 |
| 217 | 3300005345 | Ga0070692_10010486 | Ga0070692_100104862 | 82 |
| 218 | 3300005347 | Ga0070668_100166301 | Ga0070668_1001663012 | 82 |
| 219 | 3300005347 | Ga0070668_100420497 | Ga0070668_1004204972 | 82 |
| 220 | 3300005353 | Ga0070669_100126606 | Ga0070669_1001266062 | 82 |
| 221 | 3300005355 | Ga0070671_100645472 | Ga0070671_1006454722 | 82 |
| 222 | 3300005366 | Ga0070659_100835715 | Ga0070659_1008357151 | 82 |
| 223 | 3300005406 | Ga0070703_10081147 | Ga0070703_100811472 | 82 |
| 224 | 3300005435 | Ga0070714_102287423 | Ga0070714_1022874231 | 82 |
| 225 | 3300005436 | Ga0070713_102470691 | Ga0070713_1024706911 | 82 |
| 226 | 3300005438 | Ga0070701_10812704 | Ga0070701_108127041 | 82 |
| 227 | 3300005444 | Ga0070694_100066912 | Ga0070694_1000669123 | 82 |
| 228 | 3300005445 | Ga0070708_101832105 | Ga0070708_1018321051 | 82 |
| 229 | 3300005445 | Ga0070708_102087704 | Ga0070708_1020877042 | 82 |
| 230 | 3300005455 | Ga0070663_101448443 | Ga0070663_1014484432 | 82 |
| 231 | 3300005456 | Ga0070678_101174397 | Ga0070678_1011743972 | 82 |
| 232 | 3300005457 | Ga0070662_101679896 | Ga0070662_1016798962 | 82 |
| 233 | 3300005459 | Ga0068867_101486694 | Ga0068867_1014866941 | 82 |
| 234 | 3300005468 | Ga0070707_100222750 | Ga0070707_1002227503 | 82 |
| 235 | 3300005468 | Ga0070707_100575524 | Ga0070707_1005755242 | 82 |
| 236 | 3300005518 | Ga0070699_100407579 | Ga0070699_1004075792 | 82 |
| 237 | 3300005530 | Ga0070679_101270041 | Ga0070679_1012700411 | 82 |
| 238 | 3300005530 | Ga0070679_101930706 | Ga0070679_1019307061 | 82 |
| 239 | 3300005535 | Ga0070684_100269590 | Ga0070684_1002695902 | 82 |
| 240 | 3300005536 | Ga0070697_100209684 | Ga0070697_1002096842 | 82 |
| 241 | 3300005543 | Ga0070672_100004783 | Ga0070672_1000047833 | 82 |
| 242 | 3300005545 | Ga0070695_100105874 | Ga0070695_1001058742 | 82 |
| 243 | 3300005545 | Ga0070695_100208732 | Ga0070695_1002087322 | 82 |
| 244 | 3300005545 | Ga0070695_100950792 | Ga0070695_1009507922 | 82 |
| 245 | 3300005547 | Ga0070693_101193269 | Ga0070693_1011932691 | 82 |
| 246 | 3300005548 | Ga0070665_100153583 | Ga0070665_1001535832 | 82 |
| 247 | 3300005548 | Ga0070665_100886242 | Ga0070665_1008862421 | 82 |
| 248 | 3300005549 | Ga0070704_100088542 | Ga0070704_1000885422 | 82 |
| 249 | 3300005549 | Ga0070704_101652840 | Ga0070704_1016528401 | 82 |
| 250 | 3300005564 | Ga0070664_100579538 | Ga0070664_1005795382 | 82 |
| 251 | 3300005578 | Ga0068854_101273800 | Ga0068854_1012738002 | 82 |
| 252 | 3300005615 | Ga0070702_101198728 | Ga0070702_1011987282 | 82 |
| 253 | 3300005616 | Ga0068852_100370595 | Ga0068852_1003705952 | 82 |
| 254 | 3300005617 | Ga0068859_103050430 | Ga0068859_1030504302 | 82 |
| 255 | 3300005618 | Ga0068864_100482376 | Ga0068864_1004823762 | 82 |
| 256 | 3300005618 | Ga0068864_101587465 | Ga0068864_1015874652 | 82 |
| 257 | 3300005718 | Ga0068866_10106057 | Ga0068866_101060572 | 82 |
| 258 | 3300005719 | Ga0068861_100234415 | Ga0068861_1002344153 | 82 |
| 259 | 3300005719 | Ga0068861_100765408 | Ga0068861_1007654082 | 82 |
| 260 | 3300005840 | Ga0068870_10169098 | Ga0068870_101690982 | 82 |
| 261 | 3300005842 | Ga0068858_100863394 | Ga0068858_1008633942 | 82 |
| 262 | 3300005843 | Ga0068860_101227569 | Ga0068860_1012275692 | 82 |
| 263 | 3300006038 | Ga0075365_10098589 | Ga0075365_100985892 | 82 |
| 264 | 3300006173 | Ga0070716_100077342 | Ga0070716_1000773422 | 82 |
| 265 | 3300006175 | Ga0070712_100529768 | Ga0070712_1005297682 | 82 |
| 266 | 3300006844 | Ga0075428_101903574 | Ga0075428_1019035742 | 82 |
| 267 | 3300006871 | Ga0075434_100614040 | Ga0075434_1006140402 | 82 |
| 268 | 3300006881 | Ga0068865_100225611 | Ga0068865_1002256112 | 82 |
| 269 | 3300006881 | Ga0068865_100467022 | Ga0068865_1004670222 | 82 |
| 270 | 3300006931 | Ga0097620_103049100 | Ga0097620_1030491002 | 82 |
| 271 | 3300007265 | Ga0099794_10019928 | Ga0099794_100199282 | 82 |
| 272 | 3300009094 | Ga0111539_10051785 | Ga0111539_100517852 | 82 |
| 273 | 3300009094 | Ga0111539_10295965 | Ga0111539_102959652 | 82 |
| 274 | 3300009098 | Ga0105245_10059904 | Ga0105245_100599042 | 82 |
| 275 | 3300009098 | Ga0105245_11043110 | Ga0105245_110431102 | 82 |
| 276 | 3300009098 | Ga0105245_11186140 | Ga0105245_111861402 | 82 |
| 277 | 3300009098 | Ga0105245_11876499 | Ga0105245_118764992 | 82 |
| 278 | 3300009101 | Ga0105247_10982794 | Ga0105247_109827942 | 82 |
| 279 | 3300009147 | Ga0114129_10889677 | Ga0114129_108896772 | 82 |
| 280 | 3300009148 | Ga0105243_10023619 | Ga0105243_100236193 | 82 |
| 281 | 3300009176 | Ga0105242_10192544 | Ga0105242_101925443 | 82 |
| 282 | 3300009176 | Ga0105242_10412234 | Ga0105242_104122342 | 82 |
| 283 | 3300009176 | Ga0105242_11745645 | Ga0105242_117456451 | 82 |
| 284 | 3300009177 | Ga0105248_10133496 | Ga0105248_101334962 | 82 |
| 285 | 3300009545 | Ga0105237_11801493 | Ga0105237_118014931 | 82 |
| 286 | 3300009551 | Ga0105238_10655140 | Ga0105238_106551402 | 82 |
| 287 | 3300009551 | Ga0105238_10981744 | Ga0105238_109817442 | 82 |
| 288 | 3300009553 | Ga0105249_11326207 | Ga0105249_113262072 | 82 |
| 289 | 3300010159 | Ga0099796_10149206 | Ga0099796_101492062 | 82 |
| 290 | 3300010375 | Ga0105239_12501170 | Ga0105239_125011702 | 82 |
| 291 | 3300011119 | Ga0105246_10674076 | Ga0105246_106740762 | 82 |
| 292 | 3300013105 | Ga0157369_10185971 | Ga0157369_101859713 | 82 |
| 293 | 3300013296 | Ga0157374_10515331 | Ga0157374_105153312 | 82 |
| 294 | 3300013296 | Ga0157374_11582350 | Ga0157374_115823502 | 82 |
| 295 | 3300013297 | Ga0157378_13065674 | Ga0157378_130656741 | 82 |
| 296 | 3300013307 | Ga0157372_10922269 | Ga0157372_109222692 | 82 |
| 297 | 3300013307 | Ga0157372_11521063 | Ga0157372_115210632 | 82 |
| 298 | 3300013307 | Ga0157372_12083247 | Ga0157372_120832472 | 82 |
| 299 | 3300013308 | Ga0157375_11247769 | Ga0157375_112477692 | 82 |
| 300 | 3300013308 | Ga0157375_13241110 | Ga0157375_132411101 | 82 |
| 301 | 3300014325 | Ga0163163_10033845 | Ga0163163_100338456 | 82 |
| 302 | 3300014326 | Ga0157380_10031349 | Ga0157380_100313492 | 82 |
| 303 | 3300014326 | Ga0157380_10488473 | Ga0157380_104884732 | 82 |
| 304 | 3300014497 | Ga0182008_10145829 | Ga0182008_101458292 | 82 |
| 305 | 3300014745 | Ga0157377_10005923 | Ga0157377_100059235 | 82 |
| 306 | 3300014968 | Ga0157379_10755460 | Ga0157379_107554602 | 82 |
| 307 | 3300020070 | Ga0206356_11777551 | Ga0206356_117775511 | 82 |
| 308 | 3300025885 | Ga0207653_10325855 | Ga0207653_103258552 | 82 |
| 309 | 3300025898 | Ga0207692_11010988 | Ga0207692_110109881 | 82 |
| 310 | 3300025900 | Ga0207710_10723265 | Ga0207710_107232652 | 82 |
| 311 | 3300025904 | Ga0207647_10014246 | Ga0207647_100142467 | 82 |
| 312 | 3300025904 | Ga0207647_10237147 | Ga0207647_102371472 | 82 |
| 313 | 3300025904 | Ga0207647_10735700 | Ga0207647_107357001 | 82 |
| 314 | 3300025909 | Ga0207705_10077966 | Ga0207705_100779664 | 82 |
| 315 | 3300025909 | Ga0207705_10655266 | Ga0207705_106552662 | 82 |
| 316 | 3300025909 | Ga0207705_11523967 | Ga0207705_115239672 | 82 |
| 317 | 3300025910 | Ga0207684_10799532 | Ga0207684_107995322 | 82 |
| 318 | 3300025910 | Ga0207684_10894660 | Ga0207684_108946601 | 82 |
| 319 | 3300025912 | Ga0207707_10702520 | Ga0207707_107025202 | 82 |
| 320 | 3300025912 | Ga0207707_10777443 | Ga0207707_107774432 | 82 |
| 321 | 3300025915 | Ga0207693_10330823 | Ga0207693_103308232 | 82 |
| 322 | 3300025916 | Ga0207663_10431529 | Ga0207663_104315292 | 82 |
| 323 | 3300025916 | Ga0207663_10517678 | Ga0207663_105176781 | 82 |
| 324 | 3300025917 | Ga0207660_10856721 | Ga0207660_108567212 | 82 |
| 325 | 3300025918 | Ga0207662_10009275 | Ga0207662_100092753 | 82 |
| 326 | 3300025918 | Ga0207662_10260948 | Ga0207662_102609482 | 82 |
| 327 | 3300025919 | Ga0207657_10035490 | Ga0207657_100354902 | 82 |
| 328 | 3300025919 | Ga0207657_10225359 | Ga0207657_102253592 | 82 |
| 329 | 3300025920 | Ga0207649_10465119 | Ga0207649_104651192 | 82 |
| 330 | 3300025922 | Ga0207646_11846491 | Ga0207646_118464912 | 82 |
| 331 | 3300025923 | Ga0207681_10115431 | Ga0207681_101154312 | 82 |
| 332 | 3300025923 | Ga0207681_11011635 | Ga0207681_110116351 | 82 |
| 333 | 3300025927 | Ga0207687_10120777 | Ga0207687_101207772 | 82 |
| 334 | 3300025927 | Ga0207687_10537403 | Ga0207687_105374032 | 82 |
| 335 | 3300025927 | Ga0207687_10817308 | Ga0207687_108173081 | 82 |
| 336 | 3300025927 | Ga0207687_11012708 | Ga0207687_110127082 | 82 |
| 337 | 3300025927 | Ga0207687_11136137 | Ga0207687_111361372 | 82 |
| 338 | 3300025931 | Ga0207644_10950460 | Ga0207644_109504602 | 82 |
| 339 | 3300025932 | Ga0207690_11566030 | Ga0207690_115660302 | 82 |
| 340 | 3300025933 | Ga0207706_10256218 | Ga0207706_102562184 | 82 |
| 341 | 3300025933 | Ga0207706_10891628 | Ga0207706_108916282 | 82 |
| 342 | 3300025934 | Ga0207686_10116726 | Ga0207686_101167262 | 82 |
| 343 | 3300025934 | Ga0207686_10243367 | Ga0207686_102433673 | 82 |
| 344 | 3300025935 | Ga0207709_10381464 | Ga0207709_103814642 | 82 |
| 345 | 3300025936 | Ga0207670_10116550 | Ga0207670_101165503 | 82 |
| 346 | 3300025938 | Ga0207704_10401581 | Ga0207704_104015812 | 82 |
| 347 | 3300025939 | Ga0207665_10218127 | Ga0207665_102181272 | 82 |
| 348 | 3300025940 | Ga0207691_10003012 | Ga0207691_100030125 | 82 |
| 349 | 3300025940 | Ga0207691_10482991 | Ga0207691_104829912 | 82 |
| 350 | 3300025942 | Ga0207689_10518060 | Ga0207689_105180602 | 82 |
| 351 | 3300025944 | Ga0207661_10441350 | Ga0207661_104413503 | 82 |
| 352 | 3300025944 | Ga0207661_10486911 | Ga0207661_104869111 | 82 |
| 353 | 3300025945 | Ga0207679_10368465 | Ga0207679_103684652 | 82 |
| 354 | 3300025945 | Ga0207679_11437631 | Ga0207679_114376312 | 82 |
| 355 | 3300025961 | Ga0207712_10448771 | Ga0207712_104487712 | 82 |
| 356 | 3300026041 | Ga0207639_11270305 | Ga0207639_112703051 | 82 |
| 357 | 3300026067 | Ga0207678_10399308 | Ga0207678_103993082 | 82 |
| 358 | 3300026075 | Ga0207708_10001216 | Ga0207708_100012164 | 82 |
| 359 | 3300026088 | Ga0207641_10861065 | Ga0207641_108610651 | 82 |
| 360 | 3300026095 | Ga0207676_10739396 | Ga0207676_107393962 | 82 |
| 361 | 3300026095 | Ga0207676_11795107 | Ga0207676_117951071 | 82 |
| 362 | 3300026116 | Ga0207674_11000647 | Ga0207674_110006472 | 82 |
| 363 | 3300026118 | Ga0207675_100038790 | Ga0207675_1000387901 | 82 |
| 364 | 3300026118 | Ga0207675_100468887 | Ga0207675_1004688872 | 82 |
| 365 | 3300026118 | Ga0207675_100863643 | Ga0207675_1008636432 | 82 |
| 366 | 3300026121 | Ga0207683_10298219 | Ga0207683_102982193 | 82 |
| 367 | 3300026142 | Ga0207698_10673310 | Ga0207698_106733101 | 82 |
| 368 | 3300027462 | Ga0210000_1026640 | Ga0210000_10266402 | 82 |
| 369 | 3300027543 | Ga0209999_1117244 | Ga0209999_11172442 | 82 |
| 370 | 3300027665 | Ga0209983_1168717 | Ga0209983_11687172 | 82 |
| 371 | 3300027671 | Ga0209588_1101975 | Ga0209588_11019752 | 82 |
| 372 | 3300027907 | Ga0207428_10231124 | Ga0207428_102311242 | 82 |
| 373 | 3300027907 | Ga0207428_10558762 | Ga0207428_105587622 | 82 |
| 374 | 3300028379 | Ga0268266_10091701 | Ga0268266_100917012 | 82 |
| 375 | 3300028379 | Ga0268266_11063302 | Ga0268266_110633021 | 82 |
| 376 | 3300028380 | Ga0268265_11166937 | Ga0268265_111669372 | 82 |
| 377 | 3300031824 | Ga0307413_11057233 | Ga0307413_110572331 | 82 |
| 378 | 3300031852 | Ga0307410_10442054 | Ga0307410_104420542 | 82 |
| 379 | 3300031903 | Ga0307407_10151600 | Ga0307407_101516002 | 82 |
| 380 | 3300031995 | Ga0307409_100147958 | Ga0307409_1001479582 | 82 |
| 381 | 3300032002 | Ga0307416_100039737 | Ga0307416_1000397372 | 82 |
| 382 | 3300032126 | Ga0307415_100027089 | Ga0307415_1000270892 | 82 |
| 383 | 3300035241 | Ga0373961_0314845 | Ga0373961_0314845_152_403 | 82 |
| 384 | 3300039437 | Ga0436365_0762781 | Ga0436365_0762781_402_653 | 82 |
| 385 | 3300039450 | Ga0436363_0411944 | Ga0436363_0411944_509_760 | 82 |
| 386 | 3300041511 | Ga0451855_0900340 | Ga0451855_0900340_166_417 | 82 |
| 387 | 3300042876 | Ga0451577_1108488 | Ga0451577_1108488_220_471 | 82 |
| 388 | 3300044693 | Ga0466961_0195414 | Ga0466961_0195414_598_849 | 82 |
| 389 | 3300044693 | Ga0466961_0481660 | Ga0466961_0481660_250_501 | 82 |
| 390 | 3300044694 | Ga0466963_0056055 | Ga0466963_0056055_1413_1664 | 82 |
| 391 | 3300044694 | Ga0466963_0131814 | Ga0466963_0131814_626_877 | 82 |
| 392 | 3300044694 | Ga0466963_0154006 | Ga0466963_0154006_1261_1512 | 82 |
| 393 | 3300044694 | Ga0466963_0228733 | Ga0466963_0228733_790_1041 | 82 |
| 394 | 3300044694 | Ga0466963_0368016 | Ga0466963_0368016_215_466 | 82 |
| 395 | 3300044694 | Ga0466963_0728938 | Ga0466963_0728938_270_518 | 82 |
| 396 | 3300044694 | Ga0466963_1103694 | Ga0466963_1103694_27_275 | 82 |
| 397 | 3300044706 | Ga0466964_0688428 | Ga0466964_0688428_294_545 | 82 |
| 398 | 3300044719 | Ga0466971_0027958 | Ga0466971_0027958_511_762 | 82 |
| 399 | 3300044719 | Ga0466971_0215362 | Ga0466971_0215362_141_392 | 82 |
| 400 | 3300044765 | Ga0466970_0573257 | Ga0466970_0573257_15_266 | 82 |
| 401 | 3300044842 | Ga0466957_0207807 | Ga0466957_0207807_219_470 | 82 |
| 402 | 3300044842 | Ga0466957_0362452 | Ga0466957_0362452_525_776 | 82 |
| 403 | 3300044842 | Ga0466957_0417689 | Ga0466957_0417689_335_586 | 82 |
| 404 | 3300044901 | Ga0466960_0019883 | Ga0466960_0019883_1809_2060 | 82 |
| 405 | 3300044901 | Ga0466960_0039445 | Ga0466960_0039445_373_624 | 82 |
| 406 | 3300045049 | Ga0466959_0381482 | Ga0466959_0381482_682_933 | 82 |
| 407 | 3300045051 | Ga0451576_1026596 | Ga0451576_1026596_310_561 | 82 |
| 408 | 3300045836 | Ga0466958_0247466 | Ga0466958_0247466_655_906 | 82 |
| 409 | 3300045836 | Ga0466958_0857545 | Ga0466958_0857545_187_438 | 82 |
| 410 | 3300045976 | Ga0466967_0044906 | Ga0466967_0044906_2150_2398 | 82 |
| 411 | 3300045976 | Ga0466967_0322681 | Ga0466967_0322681_1215_1466 | 82 |
| 412 | 3300045976 | Ga0466967_0537579 | Ga0466967_0537579_476_727 | 82 |
| 413 | 3300045976 | Ga0466967_0899096 | Ga0466967_0899096_215_466 | 82 |
| 414 | 3300045976 | Ga0466967_0974869 | Ga0466967_0974869_156_407 | 82 |
| 415 | 3300045976 | Ga0466967_1029901 | Ga0466967_1029901_53_304 | 82 |
| 416 | 3300046543 | Ga0495645_0691426 | Ga0495645_0691426_187_438 | 82 |
| 417 | 3300046663 | Ga0495635_0239686 | Ga0495635_0239686_201_452 | 82 |
| 418 | 3300047319 | Ga0495674_0923142 | Ga0495674_0923142_109_360 | 82 |
| 419 | 3300048903 | Ga0496100_0274382 | Ga0496100_0274382_993_1241 | 82 |
| 420 | 3300048904 | Ga0496101_0127200 | Ga0496101_0127200_268_519 | 82 |
| 421 | 3300048905 | Ga0496102_0165675 | Ga0496102_0165675_105_356 | 82 |
| 422 | 3300048905 | Ga0496102_0203386 | Ga0496102_0203386_1105_1356 | 82 |
| 423 | 3300048905 | Ga0496102_0283992 | Ga0496102_0283992_348_596 | 82 |
| 424 | 3300048905 | Ga0496102_0497497 | Ga0496102_0497497_810_1061 | 82 |
| 425 | 3300048905 | Ga0496102_0762835 | Ga0496102_0762835_245_496 | 82 |
| 426 | 3300048905 | Ga0496102_1442849 | Ga0496102_1442849_229_480 | 82 |
| 427 | 3300048907 | Ga0496104_0279981 | Ga0496104_0279981_43_294 | 82 |
| 428 | 3300048907 | Ga0496104_0616102 | Ga0496104_0616102_469_717 | 82 |
| 429 | 3300048908 | Ga0496105_0341959 | Ga0496105_0341959_106_357 | 82 |
| 430 | 3300048908 | Ga0496105_1332281 | Ga0496105_1332281_96_347 | 82 |
| 431 | 3300048910 | Ga0496107_0458971 | Ga0496107_0458971_567_818 | 82 |
| 432 | 3300048911 | Ga0496108_0124717 | Ga0496108_0124717_1388_1639 | 82 |
| 433 | 3300048911 | Ga0496108_0291037 | Ga0496108_0291037_822_1073 | 82 |
| 434 | 3300048911 | Ga0496108_0794833 | Ga0496108_0794833_535_786 | 82 |
| 435 | 3300048912 | Ga0496109_0130287 | Ga0496109_0130287_1367_1618 | 82 |
| 436 | 3300048912 | Ga0496109_0434408 | Ga0496109_0434408_868_1116 | 82 |
| 437 | 3300048913 | Ga0496110_0017171 | Ga0496110_0017171_134_382 | 82 |
| 438 | 3300048913 | Ga0496110_0554433 | Ga0496110_0554433_394_645 | 82 |
| 439 | 3300048914 | Ga0496111_0033505 | Ga0496111_0033505_3008_3259 | 82 |
| 440 | 3300048914 | Ga0496111_0040213 | Ga0496111_0040213_122_373 | 82 |
| 441 | 3300048914 | Ga0496111_0510515 | Ga0496111_0510515_173_421 | 82 |
| 442 | 3300048915 | Ga0496112_0044862 | Ga0496112_0044862_1574_1825 | 82 |
| 443 | 3300048916 | Ga0496113_0016808 | Ga0496113_0016808_2102_2353 | 82 |
| 444 | 3300048916 | Ga0496113_0628591 | Ga0496113_0628591_153_404 | 82 |
| 445 | 3300048917 | Ga0496114_0010259 | Ga0496114_0010259_2806_3057 | 82 |
| 446 | 3300048917 | Ga0496114_0073710 | Ga0496114_0073710_40_291 | 82 |
| 447 | 3300048917 | Ga0496114_0117167 | Ga0496114_0117167_281_532 | 82 |
| 448 | 3300048917 | Ga0496114_0673670 | Ga0496114_0673670_273_524 | 82 |
| 449 | 3300048918 | Ga0496115_0037682 | Ga0496115_0037682_939_1187 | 82 |
| 450 | 3300048918 | Ga0496115_0718693 | Ga0496115_0718693_483_734 | 82 |
| 451 | 3300048924 | Ga0496121_0486599 | Ga0496121_0486599_330_581 | 82 |
| 452 | 3300048929 | Ga0496126_0705106 | Ga0496126_0705106_491_739 | 82 |
| 453 | 3300049568 | Ga0501031_0925851 | Ga0501031_0925851_72_323 | 82 |
| 454 | 3300049592 | Ga0501076_0294114 | Ga0501076_0294114_100_351 | 82 |
| 455 | 3300049665 | Ga0501227_066426 | Ga0501227_066426_441_689 | 82 |
| 456 | 3300049672 | Ga0501239_070017 | Ga0501239_070017_84_332 | 82 |
| 457 | 3300049822 | Ga0501035_0394759 | Ga0501035_0394759_368_616 | 82 |
| 458 | 3300050491 | nmdc:mga00v17_833742_c1 | nmdc:mga00v17_833742_c1_176_427 | 82 |
| 459 | 3300050507 | nmdc:mga05p37_1091226_c1 | nmdc:mga05p37_1091226_c1_527_778 | 82 |
| 460 | 3300050507 | nmdc:mga05p37_1620837_c1 | nmdc:mga05p37_1620837_c1_173_421 | 82 |
| 461 | 3300050508 | nmdc:mga09592_1000153_c1 | nmdc:mga09592_1000153_c1_192_443 | 82 |
| 462 | 3300054114 | Ga0501084_0776806 | Ga0501084_0776806_404_655 | 82 |
| 463 | 3300059424 | Ga0590075_116437 | Ga0590075_116437_196_447 | 82 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4oi3-assembly1.cif.gz_B | crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) | 0.9265 | 3 | 82 |
| 4oi3-assembly1.cif.gz_B | crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) | 0.905 | 3 | 82 |
| 3rhu-assembly1.cif.gz_A | epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins | 0.7936 | 34 | 54 |
| 1v4p-assembly3.cif.gz_C | crystal structure of alanyl-trna synthetase from pyrococcus horikoshii ot3 | 0.7575 | 34 | 56 |
| 2a6o-assembly1.cif.gz_A | crystal structure of the ishp608 transposase in complex with stem-loop dna | 0.681 | 2 | 81 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4oi3B00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer | 0.925 | 4 | 82 | 3.30.70.3090 |
| 4oi3B00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer | 0.9031 | 4 | 82 | 3.30.70.3090 |
| af_Q2G1I7_88_170_3.30.70.3090 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer | 0.7694 | 1 | 78 | 3.30.70.3090 |
| af_Q2G1I7_88_170_3.30.70.3090 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer | 0.7313 | 1 | 78 | 3.30.70.3090 |
| af_Q1ZXR2_492_809_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.7257 | 5 | 53 | 1.10.510.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q4F204-F1-model_v4 | HTH araC/xylS-type domain-containing protein | 0.9987 | 1 | 79 |
GO:0003700
GO:0043565 |
| AF-A0A428K041-F1-model_v4 | DUF4242 domain-containing protein | 0.9973 | 1 | 79 |
GO:0003700
GO:0043565 |
| AF-A0A537JU00-F1-model_v4 | DUF4242 domain-containing protein | 0.9971 | 1 | 79 |
GO:0003700
GO:0004016 GO:0009190 GO:0035556 GO:0043565 |
| AF-A0A110B1H8-F1-model_v4 | AraC-like DNA-binding protein (Transcriptional activator FtrA) | 0.9968 | 1 | 79 |
GO:0003700
GO:0004016 GO:0009190 GO:0035556 GO:0043565 |
| AF-A0A317IU28-F1-model_v4 | Guanylate cyclase domain-containing protein | 0.9954 | 1 | 79 |
GO:0004016
GO:0009190 GO:0035556 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar