F449109

General Info

Members Datasets Scaffolds Average Seq Length
463 244 463 82

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_12704703|Ga0163162_127047031
Length 93
Sequence MLTSPPSRRTTMPLYLDVHNVKGGVSAKDVADAHMKDLKEQTHHGVNYIRYWVDEKAGKIFCLVDAPTKEAAHTVHREAHGLVADEIYEVQEG

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
190 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
191 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
192 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
196 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
197 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
233 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
241 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 1.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 9.5
Rhizosphere 88.55
Stem 0
Stem Tuber 0
Unclassified 1.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10020853 3300002067 Unclassified 2005
2 Ga0058859_11270189 3300004798 Unclassified 537
3 Ga0058861_11710926 3300004800 Unclassified 633
4 Ga0058862_10008947 3300004803 Unclassified 545
5 Ga0065712_10283164 3300005290 Unclassified 891
6 Ga0065712_10573527 3300005290 Bacteria 605
7 Ga0065715_10164626 3300005293 Bacteria 1597
8 Ga0065707_10302798 3300005295 Bacteria 1001
9 Ga0070658_10096271 3300005327 Bacteria 2444
10 Ga0070658_10790553 3300005327 Bacteria 824
11 Ga0070658_10871368 3300005327 Bacteria 783
12 Ga0070676_10685634 3300005328 Unclassified 747
13 Ga0070683_100006027 3300005329 Bacteria 10160
14 Ga0070683_100010042 3300005329 Bacteria 8121
15 Ga0070683_100125463 3300005329 Bacteria 2427
16 Ga0070683_100212923 3300005329 Bacteria 1836
17 Ga0070683_100418567 3300005329 Bacteria 1278
18 Ga0070690_100126228 3300005330 Bacteria 1723
19 Ga0070690_100536832 3300005330 Unclassified 880
20 Ga0070670_100001650 3300005331 Bacteria 18076
21 Ga0068869_100001541 3300005334 Bacteria 13698
22 Ga0070666_10860857 3300005335 Unclassified 669
23 Ga0070680_100027097 3300005336 Bacteria 4588
24 Ga0070680_100104441 3300005336 Unclassified 2354
25 Ga0070680_100385897 3300005336 Bacteria 1193
26 Ga0070682_100003515 3300005337 Bacteria 8669
27 Ga0070682_100948978 3300005337 Unclassified 710
28 Ga0068868_100104297 3300005338 Bacteria 2298
29 Ga0068868_101279769 3300005338 Bacteria 680
30 Ga0070660_100024694 3300005339 Bacteria 4461
31 Ga0070660_100030166 3300005339 Bacteria 4067
32 Ga0070689_100117627 3300005340 Bacteria 2120
33 Ga0070689_100195876 3300005340 Unclassified 1647
34 Ga0070689_101458086 3300005340 Bacteria 619
35 Ga0070687_100053069 3300005343 Bacteria 2107
36 Ga0070687_100443944 3300005343 Unclassified 861
37 Ga0070687_100560294 3300005343 Bacteria 779
38 Ga0070687_100870100 3300005343 Unclassified 644
39 Ga0070661_100001319 3300005344 Bacteria 17390
40 Ga0070661_101735839 3300005344 Bacteria 529
41 Ga0070692_10010465 3300005345 Bacteria 4222
42 Ga0070692_10010486 3300005345 Bacteria 4219
43 Ga0070668_100166301 3300005347 Bacteria 1793
44 Ga0070668_100420497 3300005347 Bacteria 1144
45 Ga0070669_100126606 3300005353 Bacteria 1955
46 Ga0070675_100024459 3300005354 Bacteria 4836
47 Ga0070671_100345757 3300005355 Bacteria 1269
48 Ga0070671_100527772 3300005355 Unclassified 1017
49 Ga0070671_100645472 3300005355 Bacteria 916
50 Ga0070673_100025570 3300005364 Bacteria 4348
51 Ga0070673_101404938 3300005364 Unclassified 657
52 Ga0070688_100698786 3300005365 Unclassified 785
53 Ga0070659_100000532 3300005366 Bacteria 27819
54 Ga0070659_100835715 3300005366 Bacteria 802
55 Ga0070667_100145539 3300005367 Bacteria 2078
56 Ga0070703_10081147 3300005406 Bacteria 1105
57 Ga0070714_102287423 3300005435 Unclassified 526
58 Ga0070713_100216534 3300005436 Unclassified 1736
59 Ga0070713_101454880 3300005436 Bacteria 665
60 Ga0070713_102470691 3300005436 Bacteria 502
61 Ga0070701_10812704 3300005438 Bacteria 639
62 Ga0070701_11023423 3300005438 Bacteria 577
63 Ga0070705_100384600 3300005440 Unclassified 1034
64 Ga0070694_100066912 3300005444 Bacteria 2465
65 Ga0070708_101832105 3300005445 Bacteria 563
66 Ga0070708_102087704 3300005445 Bacteria 524
67 Ga0070663_100197312 3300005455 Bacteria 1569
68 Ga0070663_101448443 3300005455 Bacteria 609
69 Ga0070678_101174397 3300005456 Bacteria 711
70 Ga0070662_100044956 3300005457 Bacteria 3166
71 Ga0070662_101679896 3300005457 Unclassified 548
72 Ga0070681_10231694 3300005458 Bacteria 1761
73 Ga0068867_101486694 3300005459 Bacteria 630
74 Ga0070707_100222750 3300005468 Bacteria 1837
75 Ga0070707_100575524 3300005468 Unclassified 1088
76 Ga0070707_102293474 3300005468 Unclassified 507
77 Ga0070699_100407579 3300005518 Bacteria 1230
78 Ga0070679_100033762 3300005530 Bacteria 5066
79 Ga0070679_101270041 3300005530 Bacteria 682
80 Ga0070679_101930706 3300005530 Bacteria 539
81 Ga0070684_100015201 3300005535 Bacteria 6260
82 Ga0070684_100127630 3300005535 Bacteria 2292
83 Ga0070684_100269590 3300005535 Bacteria 1558
84 Ga0070684_101745851 3300005535 Bacteria 587
85 Ga0070684_101982002 3300005535 Bacteria 549
86 Ga0070697_100209684 3300005536 Bacteria 1658
87 Ga0068853_100021271 3300005539 Bacteria 5406
88 Ga0070672_100004783 3300005543 Bacteria 8887
89 Ga0070672_101307427 3300005543 Unclassified 647
90 Ga0070686_100143040 3300005544 Unclassified 1667
91 Ga0070695_100105874 3300005545 Bacteria 1901
92 Ga0070695_100208732 3300005545 Bacteria 1400
93 Ga0070695_100285663 3300005545 Bacteria 1214
94 Ga0070695_100950792 3300005545 Bacteria 696
95 Ga0070693_100033249 3300005547 Bacteria 2844
96 Ga0070693_101193269 3300005547 Bacteria 584
97 Ga0070665_100153583 3300005548 Bacteria 2304
98 Ga0070665_100886242 3300005548 Bacteria 905
99 Ga0070704_100088542 3300005549 Bacteria 2300
100 Ga0070704_101652840 3300005549 Bacteria 591
101 Ga0068855_100152037 3300005563 Bacteria 2632
102 Ga0070664_100062862 3300005564 Bacteria 3165
103 Ga0070664_100072886 3300005564 Bacteria 2946
104 Ga0070664_100579538 3300005564 Bacteria 1039
105 Ga0068857_100239870 3300005577 Bacteria 1659
106 Ga0068854_101273800 3300005578 Bacteria 661
107 Ga0068856_100019110 3300005614 Bacteria 6651
108 Ga0070702_100087235 3300005615 Bacteria 1884
109 Ga0070702_101198728 3300005615 Bacteria 612
110 Ga0068852_100008867 3300005616 Bacteria 7440
111 Ga0068852_100370595 3300005616 Bacteria 1403
112 Ga0068859_100016601 3300005617 Bacteria 7392
113 Ga0068859_103050430 3300005617 Bacteria 511
114 Ga0068864_100006225 3300005618 Bacteria 9790
115 Ga0068864_100482376 3300005618 Bacteria 1190
116 Ga0068864_101587465 3300005618 Bacteria 658
117 Ga0068866_10106057 3300005718 Bacteria 1559
118 Ga0068861_100234415 3300005719 Bacteria 1558
119 Ga0068861_100765408 3300005719 Bacteria 903
120 Ga0068861_101476274 3300005719 Unclassified 666
121 Ga0068851_10021424 3300005834 Bacteria 3138
122 Ga0068870_10083571 3300005840 Bacteria 1770
123 Ga0068870_10169098 3300005840 Bacteria 1303
124 Ga0068863_100005505 3300005841 Bacteria 12455
125 Ga0068858_100094243 3300005842 Bacteria 2789
126 Ga0068858_100863394 3300005842 Bacteria 884
127 Ga0068860_100020654 3300005843 Bacteria 6380
128 Ga0068860_101227569 3300005843 Bacteria 770
129 Ga0068862_102556254 3300005844 Unclassified 522
130 Ga0075365_10098589 3300006038 Bacteria 1999
131 Ga0070716_100077342 3300006173 Bacteria 1975
132 Ga0070712_100529768 3300006175 Bacteria 990
133 Ga0097621_100193660 3300006237 Bacteria 1762
134 Ga0068871_100077085 3300006358 Bacteria 2754
135 Ga0075428_101903574 3300006844 Bacteria 618
136 Ga0075430_100470919 3300006846 Bacteria 1037
137 Ga0075433_11373984 3300006852 Bacteria 611
138 Ga0075434_100614040 3300006871 Bacteria 1106
139 Ga0075434_101918957 3300006871 Unclassified 598
140 Ga0068865_100225611 3300006881 Bacteria 1467
141 Ga0068865_100467022 3300006881 Bacteria 1046
142 Ga0097620_100016601 3300006931 Bacteria 7392
143 Ga0097620_103049100 3300006931 Bacteria 511
144 Ga0099794_10019928 3300007265 Bacteria 3030
145 Ga0111539_10051785 3300009094 Bacteria 4888
146 Ga0111539_10295965 3300009094 Bacteria 1883
147 Ga0105245_10004115 3300009098 Bacteria 12914
148 Ga0105245_10024248 3300009098 Bacteria 5327
149 Ga0105245_10059904 3300009098 Bacteria 3429
150 Ga0105245_10707108 3300009098 Unclassified 1041
151 Ga0105245_11043110 3300009098 Bacteria 863
152 Ga0105245_11186140 3300009098 Bacteria 811
153 Ga0105245_11876499 3300009098 Bacteria 652
154 Ga0105247_10153010 3300009101 Bacteria 1521
155 Ga0105247_10982794 3300009101 Bacteria 658
156 Ga0105247_11655946 3300009101 Unclassified 527
157 Ga0114129_10889677 3300009147 Unclassified 1129
158 Ga0105243_10023619 3300009148 Bacteria 4684
159 Ga0105241_10003107 3300009174 Bacteria 12355
160 Ga0105242_10026035 3300009176 Unclassified 4633
161 Ga0105242_10182527 3300009176 Bacteria 1852
162 Ga0105242_10192544 3300009176 Bacteria 1806
163 Ga0105242_10412234 3300009176 Bacteria 1264
164 Ga0105242_11745645 3300009176 Bacteria 660
165 Ga0105242_12102614 3300009176 Bacteria 608
166 Ga0105248_10109141 3300009177 Bacteria 3120
167 Ga0105248_10112991 3300009177 Bacteria 3063
168 Ga0105248_10133496 3300009177 Bacteria 2800
169 Ga0105237_11801493 3300009545 Bacteria 620
170 Ga0105238_10546128 3300009551 Unclassified 1163
171 Ga0105238_10655140 3300009551 Bacteria 1060
172 Ga0105238_10981744 3300009551 Bacteria 865
173 Ga0105249_11326207 3300009553 Bacteria 791
174 Ga0099796_10149206 3300010159 Bacteria 919
175 Ga0105239_10135725 3300010375 Bacteria 2739
176 Ga0105239_12029537 3300010375 Bacteria 668
177 Ga0105239_12253275 3300010375 Unclassified 634
178 Ga0105239_12501170 3300010375 Bacteria 602
179 Ga0105246_10003081 3300011119 Bacteria 10129
180 Ga0105246_10674076 3300011119 Bacteria 903
181 Ga0157373_10005183 3300013100 Bacteria 9793
182 Ga0157371_10050431 3300013102 Bacteria 2957
183 Ga0157371_10383737 3300013102 Bacteria 1026
184 Ga0157370_10713586 3300013104 Bacteria 915
185 Ga0157369_10185971 3300013105 Bacteria 2185
186 Ga0157369_10367956 3300013105 Bacteria 1492
187 Ga0157369_11862064 3300013105 Bacteria 611
188 Ga0157374_10004045 3300013296 Bacteria 12317
189 Ga0157374_10515331 3300013296 Bacteria 1201
190 Ga0157374_11582350 3300013296 Bacteria 679
191 Ga0157378_10290001 3300013297 Bacteria 1580
192 Ga0157378_10514767 3300013297 Unclassified 1197
193 Ga0157378_13065674 3300013297 Bacteria 519
194 Ga0163162_12704703 3300013306 Bacteria 571
195 Ga0157372_10147730 3300013307 Unclassified 2711
196 Ga0157372_10276433 3300013307 Bacteria 1952
197 Ga0157372_10545770 3300013307 Bacteria 1351
198 Ga0157372_10922269 3300013307 Bacteria 1013
199 Ga0157372_11521063 3300013307 Bacteria 771
200 Ga0157372_12083247 3300013307 Bacteria 652
201 Ga0157375_10789706 3300013308 Bacteria 1099
202 Ga0157375_11247769 3300013308 Bacteria 873
203 Ga0157375_13241110 3300013308 Bacteria 543
204 Ga0163163_10033845 3300014325 Bacteria 4946
205 Ga0163163_10077161 3300014325 Bacteria 3327
206 Ga0163163_10463226 3300014325 Bacteria 1328
207 Ga0157380_10031349 3300014326 Bacteria 4081
208 Ga0157380_10488473 3300014326 Bacteria 1193
209 Ga0182008_10145829 3300014497 Bacteria 1186
210 Ga0157377_10001379 3300014745 Bacteria 10459
211 Ga0157377_10005923 3300014745 Bacteria 5785
212 Ga0157379_10108566 3300014968 Bacteria 2492
213 Ga0157379_10755460 3300014968 Bacteria 916
214 Ga0157379_12488812 3300014968 Unclassified 517
215 Ga0157376_10090810 3300014969 Unclassified 2644
216 Ga0206356_10305594 3300020070 Unclassified 824
217 Ga0206356_11777551 3300020070 Bacteria 557
218 Ga0206354_10694300 3300020081 Unclassified 518
219 Ga0224712_10137691 3300022467 Bacteria 1072
220 Ga0207653_10325855 3300025885 Bacteria 598
221 Ga0207692_11010988 3300025898 Bacteria 549
222 Ga0207710_10324558 3300025900 Bacteria 781
223 Ga0207710_10723265 3300025900 Bacteria 522
224 Ga0207680_10154818 3300025903 Bacteria 1531
225 Ga0207647_10014246 3300025904 Bacteria 5486
226 Ga0207647_10237147 3300025904 Bacteria 1048
227 Ga0207647_10306306 3300025904 Unclassified 904
228 Ga0207647_10735700 3300025904 Bacteria 535
229 Ga0207643_10250473 3300025908 Unclassified 1091
230 Ga0207705_10077966 3300025909 Bacteria 2411
231 Ga0207705_10655266 3300025909 Bacteria 816
232 Ga0207705_11523967 3300025909 Bacteria 506
233 Ga0207684_10799532 3300025910 Bacteria 797
234 Ga0207684_10894660 3300025910 Bacteria 746
235 Ga0207654_10017080 3300025911 Bacteria 3789
236 Ga0207707_10342245 3300025912 Bacteria 1289
237 Ga0207707_10702520 3300025912 Unclassified 849
238 Ga0207707_10777443 3300025912 Bacteria 799
239 Ga0207693_10330823 3300025915 Bacteria 1193
240 Ga0207663_10431529 3300025916 Bacteria 1013
241 Ga0207663_10517678 3300025916 Bacteria 929
242 Ga0207660_10129897 3300025917 Bacteria 1916
243 Ga0207660_10856721 3300025917 Bacteria 742
244 Ga0207662_10009275 3300025918 Bacteria 5407
245 Ga0207662_10067775 3300025918 Unclassified 2153
246 Ga0207662_10235372 3300025918 Bacteria 1197
247 Ga0207662_10260948 3300025918 Unclassified 1140
248 Ga0207657_10035490 3300025919 Bacteria 4470
249 Ga0207657_10131841 3300025919 Unclassified 2048
250 Ga0207657_10225359 3300025919 Bacteria 1501
251 Ga0207649_10085363 3300025920 Bacteria 2054
252 Ga0207649_10465119 3300025920 Bacteria 957
253 Ga0207652_10005938 3300025921 Bacteria 9877
254 Ga0207646_10063512 3300025922 Bacteria 3297
255 Ga0207646_11846491 3300025922 Bacteria 516
256 Ga0207681_10115431 3300025923 Bacteria 1960
257 Ga0207681_11011635 3300025923 Bacteria 697
258 Ga0207694_10319655 3300025924 Bacteria 1281
259 Ga0207650_10006914 3300025925 Bacteria 7734
260 Ga0207659_10012675 3300025926 Bacteria 5376
261 Ga0207687_10017026 3300025927 Bacteria 4778
262 Ga0207687_10120777 3300025927 Bacteria 1959
263 Ga0207687_10136486 3300025927 Bacteria 1856
264 Ga0207687_10153968 3300025927 Bacteria 1757
265 Ga0207687_10537403 3300025927 Bacteria 979
266 Ga0207687_10817308 3300025927 Bacteria 795
267 Ga0207687_11012708 3300025927 Bacteria 712
268 Ga0207687_11136137 3300025927 Bacteria 671
269 Ga0207700_11808037 3300025928 Bacteria 537
270 Ga0207644_10349095 3300025931 Bacteria 1201
271 Ga0207644_10391078 3300025931 Bacteria 1135
272 Ga0207644_10950460 3300025931 Bacteria 721
273 Ga0207690_10007108 3300025932 Bacteria 6651
274 Ga0207690_11566030 3300025932 Bacteria 551
275 Ga0207706_10005278 3300025933 Bacteria 12049
276 Ga0207706_10256218 3300025933 Bacteria 1528
277 Ga0207706_10891628 3300025933 Bacteria 752
278 Ga0207686_10116726 3300025934 Bacteria 1810
279 Ga0207686_10178716 3300025934 Bacteria 1503
280 Ga0207686_10229578 3300025934 Unclassified 1345
281 Ga0207686_10243367 3300025934 Bacteria 1310
282 Ga0207709_10381464 3300025935 Bacteria 1073
283 Ga0207670_10116550 3300025936 Bacteria 1934
284 Ga0207670_10580867 3300025936 Bacteria 918
285 Ga0207669_10968472 3300025937 Bacteria 714
286 Ga0207704_10401581 3300025938 Bacteria 1082
287 Ga0207665_10218127 3300025939 Bacteria 1397
288 Ga0207691_10003012 3300025940 Bacteria 16442
289 Ga0207691_10482991 3300025940 Bacteria 1053
290 Ga0207711_10037950 3300025941 Bacteria 4096
291 Ga0207711_11017783 3300025941 Unclassified 768
292 Ga0207689_10002837 3300025942 Bacteria 15987
293 Ga0207689_10518060 3300025942 Bacteria 1000
294 Ga0207661_10009529 3300025944 Bacteria 6971
295 Ga0207661_10441350 3300025944 Bacteria 1185
296 Ga0207661_10462200 3300025944 Bacteria 1157
297 Ga0207661_10486911 3300025944 Bacteria 1126
298 Ga0207661_10571705 3300025944 Bacteria 1036
299 Ga0207679_10002036 3300025945 Bacteria 12538
300 Ga0207679_10107844 3300025945 Bacteria 2192
301 Ga0207679_10368465 3300025945 Bacteria 1257
302 Ga0207679_11437631 3300025945 Unclassified 633
303 Ga0207667_10068360 3300025949 Bacteria 3700
304 Ga0207651_10296696 3300025960 Unclassified 1342
305 Ga0207712_10448771 3300025961 Bacteria 1093
306 Ga0207640_11113850 3300025981 Bacteria 699
307 Ga0207658_10029329 3300025986 Unclassified 3885
308 Ga0207677_10053071 3300026023 Bacteria 2757
309 Ga0207677_10854379 3300026023 Bacteria 818
310 Ga0207703_10063221 3300026035 Bacteria 3034
311 Ga0207703_11055235 3300026035 Unclassified 780
312 Ga0207639_10395211 3300026041 Bacteria 1244
313 Ga0207639_11270305 3300026041 Unclassified 691
314 Ga0207678_10228934 3300026067 Bacteria 1592
315 Ga0207678_10399308 3300026067 Bacteria 1190
316 Ga0207708_10001216 3300026075 Bacteria 19447
317 Ga0207702_10019900 3300026078 Bacteria 5560
318 Ga0207702_12085338 3300026078 Unclassified 557
319 Ga0207641_10029996 3300026088 Bacteria 4501
320 Ga0207641_10861065 3300026088 Bacteria 899
321 Ga0207676_10010699 3300026095 Bacteria 6541
322 Ga0207676_10085360 3300026095 Bacteria 2576
323 Ga0207676_10739396 3300026095 Bacteria 956
324 Ga0207676_11795107 3300026095 Bacteria 612
325 Ga0207674_10003606 3300026116 Bacteria 18875
326 Ga0207674_10636536 3300026116 Bacteria 1030
327 Ga0207674_11000647 3300026116 Bacteria 805
328 Ga0207675_100038790 3300026118 Bacteria 4445
329 Ga0207675_100468887 3300026118 Bacteria 1250
330 Ga0207675_100863643 3300026118 Bacteria 920
331 Ga0207683_10298219 3300026121 Bacteria 1475
332 Ga0207698_10016763 3300026142 Bacteria 4950
333 Ga0207698_10391197 3300026142 Bacteria 1326
334 Ga0207698_10673310 3300026142 Bacteria 1027
335 Ga0210000_1026640 3300027462 Bacteria 897
336 Ga0209999_1117244 3300027543 Bacteria 521
337 Ga0209983_1168717 3300027665 Unclassified 502
338 Ga0209588_1101975 3300027671 Bacteria 923
339 Ga0207428_10231124 3300027907 Bacteria 1384
340 Ga0207428_10558762 3300027907 Bacteria 827
341 Ga0268266_10091701 3300028379 Bacteria 2665
342 Ga0268266_11063302 3300028379 Bacteria 783
343 Ga0268265_11166937 3300028380 Bacteria 767
344 Ga0268264_10026611 3300028381 Unclassified 4727
345 Ga0307413_11057233 3300031824 Bacteria 699
346 Ga0307410_10442054 3300031852 Bacteria 1059
347 Ga0307407_10151600 3300031903 Bacteria 1507
348 Ga0307409_100147958 3300031995 Bacteria 2034
349 Ga0307416_100039737 3300032002 Bacteria 3647
350 Ga0307415_100027089 3300032126 Bacteria 3627
351 Ga0373961_0314845 3300035241 Unclassified 582
352 Ga0373931_0210256 3300035691 Bacteria 1166
353 Ga0373937_0942645 3300036401 Unclassified 812
354 Ga0436365_0762781 3300039437 Bacteria 2419
355 Ga0436363_0411944 3300039450 Bacteria 804
356 Ga0451847_0640495 3300041503 Bacteria 550
357 Ga0451855_0900340 3300041511 Bacteria 915
358 Ga0451577_1108488 3300042876 Bacteria 708
359 Ga0466961_0195414 3300044693 Bacteria 1253
360 Ga0466961_0481660 3300044693 Bacteria 750
361 Ga0466963_0056055 3300044694 Bacteria 2622
362 Ga0466963_0131814 3300044694 Bacteria 1727
363 Ga0466963_0154006 3300044694 Bacteria 1597
364 Ga0466963_0228733 3300044694 Bacteria 1303
365 Ga0466963_0368016 3300044694 Bacteria 1013
366 Ga0466963_0728938 3300044694 Unclassified 699
367 Ga0466963_1103694 3300044694 Bacteria 558
368 Ga0466964_0688428 3300044706 Bacteria 569
369 Ga0466971_0027958 3300044719 Bacteria 2525
370 Ga0466971_0215362 3300044719 Bacteria 909
371 Ga0466970_0573257 3300044765 Bacteria 653
372 Ga0466957_0207807 3300044842 Bacteria 1288
373 Ga0466957_0362452 3300044842 Bacteria 985
374 Ga0466957_0417689 3300044842 Bacteria 920
375 Ga0466960_0019883 3300044901 Bacteria 2965
376 Ga0466960_0039445 3300044901 Bacteria 2228
377 Ga0466959_0381482 3300045049 Bacteria 959
378 Ga0451576_1026596 3300045051 Bacteria 864
379 Ga0466958_0247466 3300045836 Bacteria 1140
380 Ga0466958_0857545 3300045836 Bacteria 592
381 Ga0466967_0004734 3300045976 Bacteria 9255
382 Ga0466967_0044906 3300045976 Bacteria 3837
383 Ga0466967_0055716 3300045976 Bacteria 3483
384 Ga0466967_0322681 3300045976 Bacteria 1489
385 Ga0466967_0537579 3300045976 Bacteria 1149
386 Ga0466967_0899096 3300045976 Bacteria 880
387 Ga0466967_0974869 3300045976 Bacteria 844
388 Ga0466967_1029901 3300045976 Bacteria 820
389 Ga0495629_0019837 3300046459 Bacteria 4798
390 Ga0495582_0008895 3300046473 Bacteria 5541
391 Ga0495665_0062028 3300046531 Unclassified 1974
392 Ga0495586_0623299 3300046535 Bacteria 623
393 Ga0495645_0691426 3300046543 Bacteria 620
394 Ga0495635_0239686 3300046663 Bacteria 1224
395 Ga0495658_0116357 3300046683 Unclassified 1612
396 Ga0495581_0004249 3300047315 Bacteria 8260
397 Ga0495674_0923142 3300047319 Bacteria 673
398 Ga0495674_1189858 3300047319 Unclassified 576
399 Ga0495675_0183509 3300047444 Bacteria 1280
400 Ga0496100_0274382 3300048903 Bacteria 1255
401 Ga0496101_0127200 3300048904 Bacteria 1932
402 Ga0496102_0165675 3300048905 Bacteria 2080
403 Ga0496102_0203386 3300048905 Bacteria 1867
404 Ga0496102_0283992 3300048905 Bacteria 1560
405 Ga0496102_0497497 3300048905 Bacteria 1141
406 Ga0496102_0762835 3300048905 Unclassified 890
407 Ga0496102_1442849 3300048905 Bacteria 607
408 Ga0496104_0279981 3300048907 Bacteria 1581
409 Ga0496104_0616102 3300048907 Bacteria 995
410 Ga0496105_0341959 3300048908 Bacteria 1196
411 Ga0496105_0365114 3300048908 Bacteria 1151
412 Ga0496105_1332281 3300048908 Bacteria 523
413 Ga0496107_0458971 3300048910 Bacteria 946
414 Ga0496107_1120467 3300048910 Bacteria 568
415 Ga0496108_0006084 3300048911 Bacteria 9758
416 Ga0496108_0124717 3300048911 Bacteria 2210
417 Ga0496108_0248811 3300048911 Bacteria 1546
418 Ga0496108_0291037 3300048911 Bacteria 1422
419 Ga0496108_0794833 3300048911 Bacteria 816
420 Ga0496109_0062932 3300048912 Bacteria 3393
421 Ga0496109_0130287 3300048912 Unclassified 2347
422 Ga0496109_0284600 3300048912 Bacteria 1558
423 Ga0496109_0434408 3300048912 Bacteria 1240
424 Ga0496110_0017171 3300048913 Bacteria 6051
425 Ga0496110_0251604 3300048913 Bacteria 1608
426 Ga0496110_0554433 3300048913 Bacteria 1044
427 Ga0496111_0033505 3300048914 Bacteria 3664
428 Ga0496111_0040213 3300048914 Unclassified 3354
429 Ga0496111_0510515 3300048914 Bacteria 884
430 Ga0496111_0853531 3300048914 Bacteria 657
431 Ga0496112_0044862 3300048915 Bacteria 4332
432 Ga0496112_0273918 3300048915 Bacteria 1636
433 Ga0496113_0016808 3300048916 Bacteria 5062
434 Ga0496113_0110795 3300048916 Bacteria 2136
435 Ga0496113_0628591 3300048916 Bacteria 859
436 Ga0496114_0010259 3300048917 Bacteria 7454
437 Ga0496114_0073710 3300048917 Bacteria 2873
438 Ga0496114_0099235 3300048917 Bacteria 2484
439 Ga0496114_0117167 3300048917 Bacteria 2288
440 Ga0496114_0144883 3300048917 Bacteria 2059
441 Ga0496114_0673670 3300048917 Bacteria 908
442 Ga0496115_0037682 3300048918 Bacteria 3832
443 Ga0496115_0718693 3300048918 Bacteria 784
444 Ga0496121_0486599 3300048924 Unclassified 787
445 Ga0496126_0705106 3300048929 Bacteria 784
446 Ga0501031_0925851 3300049568 Bacteria 558
447 Ga0501076_0044089 3300049592 Bacteria 3517
448 Ga0501076_0294114 3300049592 Bacteria 1331
449 Ga0501227_066426 3300049665 Bacteria 931
450 Ga0501239_070017 3300049672 Bacteria 544
451 Ga0501035_0394759 3300049822 Unclassified 1152
452 nmdc:mga00v17_833742_c1 3300050491 Bacteria 586
453 nmdc:mga05p37_1091226_c1 3300050507 Bacteria 837
454 nmdc:mga05p37_1620837_c1 3300050507 Bacteria 636
455 nmdc:mga09592_1000153_c1 3300050508 Unclassified 699
456 nmdc:mga0qj67_672588_c1 3300050509 Bacteria 825
457 nmdc:mga08y16_100833_c1 3300050511 Bacteria 3006
458 nmdc:mga08y16_813146_c1 3300050511 Bacteria 927
459 Ga0495601_0134447 3300053077 Bacteria 1612
460 Ga0495595_0737134 3300053084 Bacteria 505
461 Ga0495619_0922335 3300053085 Bacteria 587
462 Ga0501084_0776806 3300054114 Unclassified 807
463 Ga0590075_116437 3300059424 Bacteria 699

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_10024248 Ga0105245_100242485 76
2 3300013102 Ga0157371_10383737 Ga0157371_103837372 76
3 3300013105 Ga0157369_11862064 Ga0157369_118620641 76
4 3300013307 Ga0157372_10276433 Ga0157372_102764333 76
5 3300013308 Ga0157375_10789706 Ga0157375_107897062 76
6 3300022467 Ga0224712_10137691 Ga0224712_101376912 76
7 3300025922 Ga0207646_10063512 Ga0207646_100635122 76
8 3300048908 Ga0496105_0365114 Ga0496105_0365114_534_767 76
9 3300048911 Ga0496108_0006084 Ga0496108_0006084_5072_5305 76
10 3300048912 Ga0496109_0062932 Ga0496109_0062932_932_1165 76
11 3300048914 Ga0496111_0853531 Ga0496111_0853531_189_422 76
12 3300048917 Ga0496114_0144883 Ga0496114_0144883_1358_1591 76
13 3300049592 Ga0501076_0044089 Ga0501076_0044089_2735_2974 77
14 3300006846 Ga0075430_100470919 Ga0075430_1004709192 78
15 3300025937 Ga0207669_10968472 Ga0207669_109684722 78
16 3300026116 Ga0207674_10636536 Ga0207674_106365362 78
17 3300045976 Ga0466967_0004734 Ga0466967_0004734_1943_2182 78
18 3300045976 Ga0466967_0055716 Ga0466967_0055716_244_483 78
19 3300046535 Ga0495586_0623299 Ga0495586_0623299_11_250 78
20 3300048910 Ga0496107_1120467 Ga0496107_1120467_64_303 78
21 3300048911 Ga0496108_0248811 Ga0496108_0248811_34_273 78
22 3300048912 Ga0496109_0284600 Ga0496109_0284600_1271_1510 78
23 3300048913 Ga0496110_0251604 Ga0496110_0251604_1337_1576 78
24 3300048917 Ga0496114_0099235 Ga0496114_0099235_1475_1714 78
25 3300050509 nmdc:mga0qj67_672588_c1 nmdc:mga0qj67_672588_c1_401_640 78
26 3300050511 nmdc:mga08y16_100833_c1 nmdc:mga08y16_100833_c1_2729_2968 78
27 3300050511 nmdc:mga08y16_813146_c1 nmdc:mga08y16_813146_c1_149_388 78
28 3300005535 Ga0070684_101745851 Ga0070684_1017458511 80
29 3300010375 Ga0105239_12029537 Ga0105239_120295371 80
30 3300025927 Ga0207687_10017026 Ga0207687_100170263 80
31 3300026023 Ga0207677_10854379 Ga0207677_108543792 80
32 3300026078 Ga0207702_12085338 Ga0207702_120853382 80
33 3300026142 Ga0207698_10391197 Ga0207698_103911973 80
34 3300036401 Ga0373937_0942645 Ga0373937_0942645_332_577 80
35 3300004798 Ga0058859_11270189 Ga0058859_112701891 81
36 3300004800 Ga0058861_11710926 Ga0058861_117109261 81
37 3300004803 Ga0058862_10008947 Ga0058862_100089471 81
38 3300005290 Ga0065712_10283164 Ga0065712_102831642 81
39 3300005328 Ga0070676_10685634 Ga0070676_106856341 81
40 3300005329 Ga0070683_100006027 Ga0070683_1000060273 81
41 3300005329 Ga0070683_100212923 Ga0070683_1002129231 81
42 3300005329 Ga0070683_100418567 Ga0070683_1004185672 81
43 3300005330 Ga0070690_100126228 Ga0070690_1001262281 81
44 3300005330 Ga0070690_100536832 Ga0070690_1005368322 81
45 3300005331 Ga0070670_100001650 Ga0070670_1000016505 81
46 3300005334 Ga0068869_100001541 Ga0068869_1000015417 81
47 3300005335 Ga0070666_10860857 Ga0070666_108608571 81
48 3300005336 Ga0070680_100104441 Ga0070680_1001044412 81
49 3300005337 Ga0070682_100003515 Ga0070682_1000035152 81
50 3300005338 Ga0068868_100104297 Ga0068868_1001042972 81
51 3300005339 Ga0070660_100024694 Ga0070660_1000246942 81
52 3300005340 Ga0070689_100195876 Ga0070689_1001958762 81
53 3300005343 Ga0070687_100443944 Ga0070687_1004439442 81
54 3300005343 Ga0070687_100870100 Ga0070687_1008701001 81
55 3300005344 Ga0070661_100001319 Ga0070661_1000013192 81
56 3300005345 Ga0070692_10010465 Ga0070692_100104654 81
57 3300005354 Ga0070675_100024459 Ga0070675_1000244595 81
58 3300005355 Ga0070671_100345757 Ga0070671_1003457572 81
59 3300005355 Ga0070671_100527772 Ga0070671_1005277722 81
60 3300005364 Ga0070673_100025570 Ga0070673_1000255702 81
61 3300005364 Ga0070673_101404938 Ga0070673_1014049381 81
62 3300005365 Ga0070688_100698786 Ga0070688_1006987862 81
63 3300005366 Ga0070659_100000532 Ga0070659_10000053211 81
64 3300005367 Ga0070667_100145539 Ga0070667_1001455392 81
65 3300005436 Ga0070713_100216534 Ga0070713_1002165341 81
66 3300005436 Ga0070713_101454880 Ga0070713_1014548801 81
67 3300005438 Ga0070701_11023423 Ga0070701_110234232 81
68 3300005440 Ga0070705_100384600 Ga0070705_1003846002 81
69 3300005455 Ga0070663_100197312 Ga0070663_1001973121 81
70 3300005457 Ga0070662_100044956 Ga0070662_1000449562 81
71 3300005458 Ga0070681_10231694 Ga0070681_102316942 81
72 3300005468 Ga0070707_102293474 Ga0070707_1022934741 81
73 3300005530 Ga0070679_100033762 Ga0070679_1000337625 81
74 3300005535 Ga0070684_100015201 Ga0070684_1000152016 81
75 3300005535 Ga0070684_100127630 Ga0070684_1001276302 81
76 3300005535 Ga0070684_101982002 Ga0070684_1019820021 81
77 3300005539 Ga0068853_100021271 Ga0068853_1000212716 81
78 3300005543 Ga0070672_101307427 Ga0070672_1013074272 81
79 3300005544 Ga0070686_100143040 Ga0070686_1001430401 81
80 3300005545 Ga0070695_100285663 Ga0070695_1002856632 81
81 3300005547 Ga0070693_100033249 Ga0070693_1000332492 81
82 3300005563 Ga0068855_100152037 Ga0068855_1001520373 81
83 3300005564 Ga0070664_100062862 Ga0070664_1000628622 81
84 3300005564 Ga0070664_100072886 Ga0070664_1000728862 81
85 3300005577 Ga0068857_100239870 Ga0068857_1002398702 81
86 3300005614 Ga0068856_100019110 Ga0068856_1000191107 81
87 3300005615 Ga0070702_100087235 Ga0070702_1000872352 81
88 3300005616 Ga0068852_100008867 Ga0068852_1000088674 81
89 3300005617 Ga0068859_100016601 Ga0068859_1000166014 81
90 3300005618 Ga0068864_100006225 Ga0068864_10000622511 81
91 3300005719 Ga0068861_101476274 Ga0068861_1014762741 81
92 3300005834 Ga0068851_10021424 Ga0068851_100214242 81
93 3300005840 Ga0068870_10083571 Ga0068870_100835712 81
94 3300005841 Ga0068863_100005505 Ga0068863_1000055052 81
95 3300005842 Ga0068858_100094243 Ga0068858_1000942432 81
96 3300005843 Ga0068860_100020654 Ga0068860_1000206545 81
97 3300005844 Ga0068862_102556254 Ga0068862_1025562542 81
98 3300006237 Ga0097621_100193660 Ga0097621_1001936602 81
99 3300006358 Ga0068871_100077085 Ga0068871_1000770853 81
100 3300006852 Ga0075433_11373984 Ga0075433_113739842 81
101 3300006871 Ga0075434_101918957 Ga0075434_1019189572 81
102 3300006931 Ga0097620_100016601 Ga0097620_1000166014 81
103 3300009098 Ga0105245_10004115 Ga0105245_100041152 81
104 3300009098 Ga0105245_10707108 Ga0105245_107071082 81
105 3300009101 Ga0105247_10153010 Ga0105247_101530102 81
106 3300009101 Ga0105247_11655946 Ga0105247_116559462 81
107 3300009174 Ga0105241_10003107 Ga0105241_100031073 81
108 3300009176 Ga0105242_10026035 Ga0105242_100260352 81
109 3300009176 Ga0105242_10182527 Ga0105242_101825272 81
110 3300009176 Ga0105242_12102614 Ga0105242_121026142 81
111 3300009177 Ga0105248_10109141 Ga0105248_101091412 81
112 3300009177 Ga0105248_10112991 Ga0105248_101129913 81
113 3300009551 Ga0105238_10546128 Ga0105238_105461282 81
114 3300010375 Ga0105239_10135725 Ga0105239_101357253 81
115 3300010375 Ga0105239_12253275 Ga0105239_122532752 81
116 3300011119 Ga0105246_10003081 Ga0105246_100030816 81
117 3300013100 Ga0157373_10005183 Ga0157373_100051836 81
118 3300013102 Ga0157371_10050431 Ga0157371_100504313 81
119 3300013104 Ga0157370_10713586 Ga0157370_107135862 81
120 3300013105 Ga0157369_10367956 Ga0157369_103679563 81
121 3300013296 Ga0157374_10004045 Ga0157374_100040454 81
122 3300013297 Ga0157378_10290001 Ga0157378_102900012 81
123 3300013297 Ga0157378_10514767 Ga0157378_105147671 81
124 3300013306 Ga0163162_12704703 Ga0163162_127047031 81
125 3300013307 Ga0157372_10147730 Ga0157372_101477303 81
126 3300013307 Ga0157372_10545770 Ga0157372_105457702 81
127 3300014325 Ga0163163_10077161 Ga0163163_100771612 81
128 3300014325 Ga0163163_10463226 Ga0163163_104632262 81
129 3300014745 Ga0157377_10001379 Ga0157377_100013797 81
130 3300014968 Ga0157379_10108566 Ga0157379_101085662 81
131 3300014968 Ga0157379_12488812 Ga0157379_124888121 81
132 3300014969 Ga0157376_10090810 Ga0157376_100908102 81
133 3300020070 Ga0206356_10305594 Ga0206356_103055941 81
134 3300020081 Ga0206354_10694300 Ga0206354_106943001 81
135 3300025900 Ga0207710_10324558 Ga0207710_103245582 81
136 3300025903 Ga0207680_10154818 Ga0207680_101548181 81
137 3300025904 Ga0207647_10306306 Ga0207647_103063062 81
138 3300025908 Ga0207643_10250473 Ga0207643_102504732 81
139 3300025911 Ga0207654_10017080 Ga0207654_100170804 81
140 3300025912 Ga0207707_10342245 Ga0207707_103422452 81
141 3300025917 Ga0207660_10129897 Ga0207660_101298972 81
142 3300025918 Ga0207662_10067775 Ga0207662_100677751 81
143 3300025918 Ga0207662_10235372 Ga0207662_102353722 81
144 3300025919 Ga0207657_10131841 Ga0207657_101318412 81
145 3300025920 Ga0207649_10085363 Ga0207649_100853632 81
146 3300025921 Ga0207652_10005938 Ga0207652_100059382 81
147 3300025924 Ga0207694_10319655 Ga0207694_103196552 81
148 3300025925 Ga0207650_10006914 Ga0207650_100069144 81
149 3300025926 Ga0207659_10012675 Ga0207659_100126754 81
150 3300025927 Ga0207687_10136486 Ga0207687_101364862 81
151 3300025927 Ga0207687_10153968 Ga0207687_101539682 81
152 3300025928 Ga0207700_11808037 Ga0207700_118080371 81
153 3300025931 Ga0207644_10349095 Ga0207644_103490952 81
154 3300025931 Ga0207644_10391078 Ga0207644_103910782 81
155 3300025932 Ga0207690_10007108 Ga0207690_100071083 81
156 3300025933 Ga0207706_10005278 Ga0207706_100052783 81
157 3300025934 Ga0207686_10178716 Ga0207686_101787163 81
158 3300025934 Ga0207686_10229578 Ga0207686_102295782 81
159 3300025936 Ga0207670_10580867 Ga0207670_105808671 81
160 3300025941 Ga0207711_10037950 Ga0207711_100379504 81
161 3300025941 Ga0207711_11017783 Ga0207711_110177832 81
162 3300025942 Ga0207689_10002837 Ga0207689_1000283718 81
163 3300025944 Ga0207661_10009529 Ga0207661_100095294 81
164 3300025944 Ga0207661_10462200 Ga0207661_104622001 81
165 3300025944 Ga0207661_10571705 Ga0207661_105717052 81
166 3300025945 Ga0207679_10002036 Ga0207679_1000203614 81
167 3300025945 Ga0207679_10107844 Ga0207679_101078442 81
168 3300025949 Ga0207667_10068360 Ga0207667_100683602 81
169 3300025960 Ga0207651_10296696 Ga0207651_102966962 81
170 3300025981 Ga0207640_11113850 Ga0207640_111138501 81
171 3300025986 Ga0207658_10029329 Ga0207658_100293292 81
172 3300026023 Ga0207677_10053071 Ga0207677_100530712 81
173 3300026035 Ga0207703_10063221 Ga0207703_100632212 81
174 3300026035 Ga0207703_11055235 Ga0207703_110552351 81
175 3300026041 Ga0207639_10395211 Ga0207639_103952112 81
176 3300026067 Ga0207678_10228934 Ga0207678_102289342 81
177 3300026078 Ga0207702_10019900 Ga0207702_100199002 81
178 3300026088 Ga0207641_10029996 Ga0207641_100299964 81
179 3300026095 Ga0207676_10010699 Ga0207676_100106992 81
180 3300026095 Ga0207676_10085360 Ga0207676_100853603 81
181 3300026116 Ga0207674_10003606 Ga0207674_1000360619 81
182 3300026142 Ga0207698_10016763 Ga0207698_100167635 81
183 3300028381 Ga0268264_10026611 Ga0268264_100266112 81
184 3300035691 Ga0373931_0210256 Ga0373931_0210256_545_793 81
185 3300041503 Ga0451847_0640495 Ga0451847_0640495_205_453 81
186 3300046459 Ga0495629_0019837 Ga0495629_0019837_4188_4436 81
187 3300046473 Ga0495582_0008895 Ga0495582_0008895_4624_4872 81
188 3300046531 Ga0495665_0062028 Ga0495665_0062028_599_847 81
189 3300046683 Ga0495658_0116357 Ga0495658_0116357_654_902 81
190 3300047315 Ga0495581_0004249 Ga0495581_0004249_7016_7264 81
191 3300047319 Ga0495674_1189858 Ga0495674_1189858_51_299 81
192 3300047444 Ga0495675_0183509 Ga0495675_0183509_601_849 81
193 3300048915 Ga0496112_0273918 Ga0496112_0273918_1168_1416 81
194 3300048916 Ga0496113_0110795 Ga0496113_0110795_719_967 81
195 3300053077 Ga0495601_0134447 Ga0495601_0134447_382_630 81
196 3300053084 Ga0495595_0737134 Ga0495595_0737134_113_361 81
197 3300053085 Ga0495619_0922335 Ga0495619_0922335_148_396 81
198 3300002067 JGI24735J21928_10020853 JGI24735J21928_100208531 82
199 3300005290 Ga0065712_10573527 Ga0065712_105735272 82
200 3300005293 Ga0065715_10164626 Ga0065715_101646262 82
201 3300005295 Ga0065707_10302798 Ga0065707_103027982 82
202 3300005327 Ga0070658_10096271 Ga0070658_100962712 82
203 3300005327 Ga0070658_10790553 Ga0070658_107905531 82
204 3300005327 Ga0070658_10871368 Ga0070658_108713682 82
205 3300005329 Ga0070683_100010042 Ga0070683_1000100425 82
206 3300005329 Ga0070683_100125463 Ga0070683_1001254631 82
207 3300005336 Ga0070680_100027097 Ga0070680_1000270977 82
208 3300005336 Ga0070680_100385897 Ga0070680_1003858972 82
209 3300005337 Ga0070682_100948978 Ga0070682_1009489781 82
210 3300005338 Ga0068868_101279769 Ga0068868_1012797692 82
211 3300005339 Ga0070660_100030166 Ga0070660_1000301662 82
212 3300005340 Ga0070689_100117627 Ga0070689_1001176273 82
213 3300005340 Ga0070689_101458086 Ga0070689_1014580861 82
214 3300005343 Ga0070687_100053069 Ga0070687_1000530693 82
215 3300005343 Ga0070687_100560294 Ga0070687_1005602941 82
216 3300005344 Ga0070661_101735839 Ga0070661_1017358391 82
217 3300005345 Ga0070692_10010486 Ga0070692_100104862 82
218 3300005347 Ga0070668_100166301 Ga0070668_1001663012 82
219 3300005347 Ga0070668_100420497 Ga0070668_1004204972 82
220 3300005353 Ga0070669_100126606 Ga0070669_1001266062 82
221 3300005355 Ga0070671_100645472 Ga0070671_1006454722 82
222 3300005366 Ga0070659_100835715 Ga0070659_1008357151 82
223 3300005406 Ga0070703_10081147 Ga0070703_100811472 82
224 3300005435 Ga0070714_102287423 Ga0070714_1022874231 82
225 3300005436 Ga0070713_102470691 Ga0070713_1024706911 82
226 3300005438 Ga0070701_10812704 Ga0070701_108127041 82
227 3300005444 Ga0070694_100066912 Ga0070694_1000669123 82
228 3300005445 Ga0070708_101832105 Ga0070708_1018321051 82
229 3300005445 Ga0070708_102087704 Ga0070708_1020877042 82
230 3300005455 Ga0070663_101448443 Ga0070663_1014484432 82
231 3300005456 Ga0070678_101174397 Ga0070678_1011743972 82
232 3300005457 Ga0070662_101679896 Ga0070662_1016798962 82
233 3300005459 Ga0068867_101486694 Ga0068867_1014866941 82
234 3300005468 Ga0070707_100222750 Ga0070707_1002227503 82
235 3300005468 Ga0070707_100575524 Ga0070707_1005755242 82
236 3300005518 Ga0070699_100407579 Ga0070699_1004075792 82
237 3300005530 Ga0070679_101270041 Ga0070679_1012700411 82
238 3300005530 Ga0070679_101930706 Ga0070679_1019307061 82
239 3300005535 Ga0070684_100269590 Ga0070684_1002695902 82
240 3300005536 Ga0070697_100209684 Ga0070697_1002096842 82
241 3300005543 Ga0070672_100004783 Ga0070672_1000047833 82
242 3300005545 Ga0070695_100105874 Ga0070695_1001058742 82
243 3300005545 Ga0070695_100208732 Ga0070695_1002087322 82
244 3300005545 Ga0070695_100950792 Ga0070695_1009507922 82
245 3300005547 Ga0070693_101193269 Ga0070693_1011932691 82
246 3300005548 Ga0070665_100153583 Ga0070665_1001535832 82
247 3300005548 Ga0070665_100886242 Ga0070665_1008862421 82
248 3300005549 Ga0070704_100088542 Ga0070704_1000885422 82
249 3300005549 Ga0070704_101652840 Ga0070704_1016528401 82
250 3300005564 Ga0070664_100579538 Ga0070664_1005795382 82
251 3300005578 Ga0068854_101273800 Ga0068854_1012738002 82
252 3300005615 Ga0070702_101198728 Ga0070702_1011987282 82
253 3300005616 Ga0068852_100370595 Ga0068852_1003705952 82
254 3300005617 Ga0068859_103050430 Ga0068859_1030504302 82
255 3300005618 Ga0068864_100482376 Ga0068864_1004823762 82
256 3300005618 Ga0068864_101587465 Ga0068864_1015874652 82
257 3300005718 Ga0068866_10106057 Ga0068866_101060572 82
258 3300005719 Ga0068861_100234415 Ga0068861_1002344153 82
259 3300005719 Ga0068861_100765408 Ga0068861_1007654082 82
260 3300005840 Ga0068870_10169098 Ga0068870_101690982 82
261 3300005842 Ga0068858_100863394 Ga0068858_1008633942 82
262 3300005843 Ga0068860_101227569 Ga0068860_1012275692 82
263 3300006038 Ga0075365_10098589 Ga0075365_100985892 82
264 3300006173 Ga0070716_100077342 Ga0070716_1000773422 82
265 3300006175 Ga0070712_100529768 Ga0070712_1005297682 82
266 3300006844 Ga0075428_101903574 Ga0075428_1019035742 82
267 3300006871 Ga0075434_100614040 Ga0075434_1006140402 82
268 3300006881 Ga0068865_100225611 Ga0068865_1002256112 82
269 3300006881 Ga0068865_100467022 Ga0068865_1004670222 82
270 3300006931 Ga0097620_103049100 Ga0097620_1030491002 82
271 3300007265 Ga0099794_10019928 Ga0099794_100199282 82
272 3300009094 Ga0111539_10051785 Ga0111539_100517852 82
273 3300009094 Ga0111539_10295965 Ga0111539_102959652 82
274 3300009098 Ga0105245_10059904 Ga0105245_100599042 82
275 3300009098 Ga0105245_11043110 Ga0105245_110431102 82
276 3300009098 Ga0105245_11186140 Ga0105245_111861402 82
277 3300009098 Ga0105245_11876499 Ga0105245_118764992 82
278 3300009101 Ga0105247_10982794 Ga0105247_109827942 82
279 3300009147 Ga0114129_10889677 Ga0114129_108896772 82
280 3300009148 Ga0105243_10023619 Ga0105243_100236193 82
281 3300009176 Ga0105242_10192544 Ga0105242_101925443 82
282 3300009176 Ga0105242_10412234 Ga0105242_104122342 82
283 3300009176 Ga0105242_11745645 Ga0105242_117456451 82
284 3300009177 Ga0105248_10133496 Ga0105248_101334962 82
285 3300009545 Ga0105237_11801493 Ga0105237_118014931 82
286 3300009551 Ga0105238_10655140 Ga0105238_106551402 82
287 3300009551 Ga0105238_10981744 Ga0105238_109817442 82
288 3300009553 Ga0105249_11326207 Ga0105249_113262072 82
289 3300010159 Ga0099796_10149206 Ga0099796_101492062 82
290 3300010375 Ga0105239_12501170 Ga0105239_125011702 82
291 3300011119 Ga0105246_10674076 Ga0105246_106740762 82
292 3300013105 Ga0157369_10185971 Ga0157369_101859713 82
293 3300013296 Ga0157374_10515331 Ga0157374_105153312 82
294 3300013296 Ga0157374_11582350 Ga0157374_115823502 82
295 3300013297 Ga0157378_13065674 Ga0157378_130656741 82
296 3300013307 Ga0157372_10922269 Ga0157372_109222692 82
297 3300013307 Ga0157372_11521063 Ga0157372_115210632 82
298 3300013307 Ga0157372_12083247 Ga0157372_120832472 82
299 3300013308 Ga0157375_11247769 Ga0157375_112477692 82
300 3300013308 Ga0157375_13241110 Ga0157375_132411101 82
301 3300014325 Ga0163163_10033845 Ga0163163_100338456 82
302 3300014326 Ga0157380_10031349 Ga0157380_100313492 82
303 3300014326 Ga0157380_10488473 Ga0157380_104884732 82
304 3300014497 Ga0182008_10145829 Ga0182008_101458292 82
305 3300014745 Ga0157377_10005923 Ga0157377_100059235 82
306 3300014968 Ga0157379_10755460 Ga0157379_107554602 82
307 3300020070 Ga0206356_11777551 Ga0206356_117775511 82
308 3300025885 Ga0207653_10325855 Ga0207653_103258552 82
309 3300025898 Ga0207692_11010988 Ga0207692_110109881 82
310 3300025900 Ga0207710_10723265 Ga0207710_107232652 82
311 3300025904 Ga0207647_10014246 Ga0207647_100142467 82
312 3300025904 Ga0207647_10237147 Ga0207647_102371472 82
313 3300025904 Ga0207647_10735700 Ga0207647_107357001 82
314 3300025909 Ga0207705_10077966 Ga0207705_100779664 82
315 3300025909 Ga0207705_10655266 Ga0207705_106552662 82
316 3300025909 Ga0207705_11523967 Ga0207705_115239672 82
317 3300025910 Ga0207684_10799532 Ga0207684_107995322 82
318 3300025910 Ga0207684_10894660 Ga0207684_108946601 82
319 3300025912 Ga0207707_10702520 Ga0207707_107025202 82
320 3300025912 Ga0207707_10777443 Ga0207707_107774432 82
321 3300025915 Ga0207693_10330823 Ga0207693_103308232 82
322 3300025916 Ga0207663_10431529 Ga0207663_104315292 82
323 3300025916 Ga0207663_10517678 Ga0207663_105176781 82
324 3300025917 Ga0207660_10856721 Ga0207660_108567212 82
325 3300025918 Ga0207662_10009275 Ga0207662_100092753 82
326 3300025918 Ga0207662_10260948 Ga0207662_102609482 82
327 3300025919 Ga0207657_10035490 Ga0207657_100354902 82
328 3300025919 Ga0207657_10225359 Ga0207657_102253592 82
329 3300025920 Ga0207649_10465119 Ga0207649_104651192 82
330 3300025922 Ga0207646_11846491 Ga0207646_118464912 82
331 3300025923 Ga0207681_10115431 Ga0207681_101154312 82
332 3300025923 Ga0207681_11011635 Ga0207681_110116351 82
333 3300025927 Ga0207687_10120777 Ga0207687_101207772 82
334 3300025927 Ga0207687_10537403 Ga0207687_105374032 82
335 3300025927 Ga0207687_10817308 Ga0207687_108173081 82
336 3300025927 Ga0207687_11012708 Ga0207687_110127082 82
337 3300025927 Ga0207687_11136137 Ga0207687_111361372 82
338 3300025931 Ga0207644_10950460 Ga0207644_109504602 82
339 3300025932 Ga0207690_11566030 Ga0207690_115660302 82
340 3300025933 Ga0207706_10256218 Ga0207706_102562184 82
341 3300025933 Ga0207706_10891628 Ga0207706_108916282 82
342 3300025934 Ga0207686_10116726 Ga0207686_101167262 82
343 3300025934 Ga0207686_10243367 Ga0207686_102433673 82
344 3300025935 Ga0207709_10381464 Ga0207709_103814642 82
345 3300025936 Ga0207670_10116550 Ga0207670_101165503 82
346 3300025938 Ga0207704_10401581 Ga0207704_104015812 82
347 3300025939 Ga0207665_10218127 Ga0207665_102181272 82
348 3300025940 Ga0207691_10003012 Ga0207691_100030125 82
349 3300025940 Ga0207691_10482991 Ga0207691_104829912 82
350 3300025942 Ga0207689_10518060 Ga0207689_105180602 82
351 3300025944 Ga0207661_10441350 Ga0207661_104413503 82
352 3300025944 Ga0207661_10486911 Ga0207661_104869111 82
353 3300025945 Ga0207679_10368465 Ga0207679_103684652 82
354 3300025945 Ga0207679_11437631 Ga0207679_114376312 82
355 3300025961 Ga0207712_10448771 Ga0207712_104487712 82
356 3300026041 Ga0207639_11270305 Ga0207639_112703051 82
357 3300026067 Ga0207678_10399308 Ga0207678_103993082 82
358 3300026075 Ga0207708_10001216 Ga0207708_100012164 82
359 3300026088 Ga0207641_10861065 Ga0207641_108610651 82
360 3300026095 Ga0207676_10739396 Ga0207676_107393962 82
361 3300026095 Ga0207676_11795107 Ga0207676_117951071 82
362 3300026116 Ga0207674_11000647 Ga0207674_110006472 82
363 3300026118 Ga0207675_100038790 Ga0207675_1000387901 82
364 3300026118 Ga0207675_100468887 Ga0207675_1004688872 82
365 3300026118 Ga0207675_100863643 Ga0207675_1008636432 82
366 3300026121 Ga0207683_10298219 Ga0207683_102982193 82
367 3300026142 Ga0207698_10673310 Ga0207698_106733101 82
368 3300027462 Ga0210000_1026640 Ga0210000_10266402 82
369 3300027543 Ga0209999_1117244 Ga0209999_11172442 82
370 3300027665 Ga0209983_1168717 Ga0209983_11687172 82
371 3300027671 Ga0209588_1101975 Ga0209588_11019752 82
372 3300027907 Ga0207428_10231124 Ga0207428_102311242 82
373 3300027907 Ga0207428_10558762 Ga0207428_105587622 82
374 3300028379 Ga0268266_10091701 Ga0268266_100917012 82
375 3300028379 Ga0268266_11063302 Ga0268266_110633021 82
376 3300028380 Ga0268265_11166937 Ga0268265_111669372 82
377 3300031824 Ga0307413_11057233 Ga0307413_110572331 82
378 3300031852 Ga0307410_10442054 Ga0307410_104420542 82
379 3300031903 Ga0307407_10151600 Ga0307407_101516002 82
380 3300031995 Ga0307409_100147958 Ga0307409_1001479582 82
381 3300032002 Ga0307416_100039737 Ga0307416_1000397372 82
382 3300032126 Ga0307415_100027089 Ga0307415_1000270892 82
383 3300035241 Ga0373961_0314845 Ga0373961_0314845_152_403 82
384 3300039437 Ga0436365_0762781 Ga0436365_0762781_402_653 82
385 3300039450 Ga0436363_0411944 Ga0436363_0411944_509_760 82
386 3300041511 Ga0451855_0900340 Ga0451855_0900340_166_417 82
387 3300042876 Ga0451577_1108488 Ga0451577_1108488_220_471 82
388 3300044693 Ga0466961_0195414 Ga0466961_0195414_598_849 82
389 3300044693 Ga0466961_0481660 Ga0466961_0481660_250_501 82
390 3300044694 Ga0466963_0056055 Ga0466963_0056055_1413_1664 82
391 3300044694 Ga0466963_0131814 Ga0466963_0131814_626_877 82
392 3300044694 Ga0466963_0154006 Ga0466963_0154006_1261_1512 82
393 3300044694 Ga0466963_0228733 Ga0466963_0228733_790_1041 82
394 3300044694 Ga0466963_0368016 Ga0466963_0368016_215_466 82
395 3300044694 Ga0466963_0728938 Ga0466963_0728938_270_518 82
396 3300044694 Ga0466963_1103694 Ga0466963_1103694_27_275 82
397 3300044706 Ga0466964_0688428 Ga0466964_0688428_294_545 82
398 3300044719 Ga0466971_0027958 Ga0466971_0027958_511_762 82
399 3300044719 Ga0466971_0215362 Ga0466971_0215362_141_392 82
400 3300044765 Ga0466970_0573257 Ga0466970_0573257_15_266 82
401 3300044842 Ga0466957_0207807 Ga0466957_0207807_219_470 82
402 3300044842 Ga0466957_0362452 Ga0466957_0362452_525_776 82
403 3300044842 Ga0466957_0417689 Ga0466957_0417689_335_586 82
404 3300044901 Ga0466960_0019883 Ga0466960_0019883_1809_2060 82
405 3300044901 Ga0466960_0039445 Ga0466960_0039445_373_624 82
406 3300045049 Ga0466959_0381482 Ga0466959_0381482_682_933 82
407 3300045051 Ga0451576_1026596 Ga0451576_1026596_310_561 82
408 3300045836 Ga0466958_0247466 Ga0466958_0247466_655_906 82
409 3300045836 Ga0466958_0857545 Ga0466958_0857545_187_438 82
410 3300045976 Ga0466967_0044906 Ga0466967_0044906_2150_2398 82
411 3300045976 Ga0466967_0322681 Ga0466967_0322681_1215_1466 82
412 3300045976 Ga0466967_0537579 Ga0466967_0537579_476_727 82
413 3300045976 Ga0466967_0899096 Ga0466967_0899096_215_466 82
414 3300045976 Ga0466967_0974869 Ga0466967_0974869_156_407 82
415 3300045976 Ga0466967_1029901 Ga0466967_1029901_53_304 82
416 3300046543 Ga0495645_0691426 Ga0495645_0691426_187_438 82
417 3300046663 Ga0495635_0239686 Ga0495635_0239686_201_452 82
418 3300047319 Ga0495674_0923142 Ga0495674_0923142_109_360 82
419 3300048903 Ga0496100_0274382 Ga0496100_0274382_993_1241 82
420 3300048904 Ga0496101_0127200 Ga0496101_0127200_268_519 82
421 3300048905 Ga0496102_0165675 Ga0496102_0165675_105_356 82
422 3300048905 Ga0496102_0203386 Ga0496102_0203386_1105_1356 82
423 3300048905 Ga0496102_0283992 Ga0496102_0283992_348_596 82
424 3300048905 Ga0496102_0497497 Ga0496102_0497497_810_1061 82
425 3300048905 Ga0496102_0762835 Ga0496102_0762835_245_496 82
426 3300048905 Ga0496102_1442849 Ga0496102_1442849_229_480 82
427 3300048907 Ga0496104_0279981 Ga0496104_0279981_43_294 82
428 3300048907 Ga0496104_0616102 Ga0496104_0616102_469_717 82
429 3300048908 Ga0496105_0341959 Ga0496105_0341959_106_357 82
430 3300048908 Ga0496105_1332281 Ga0496105_1332281_96_347 82
431 3300048910 Ga0496107_0458971 Ga0496107_0458971_567_818 82
432 3300048911 Ga0496108_0124717 Ga0496108_0124717_1388_1639 82
433 3300048911 Ga0496108_0291037 Ga0496108_0291037_822_1073 82
434 3300048911 Ga0496108_0794833 Ga0496108_0794833_535_786 82
435 3300048912 Ga0496109_0130287 Ga0496109_0130287_1367_1618 82
436 3300048912 Ga0496109_0434408 Ga0496109_0434408_868_1116 82
437 3300048913 Ga0496110_0017171 Ga0496110_0017171_134_382 82
438 3300048913 Ga0496110_0554433 Ga0496110_0554433_394_645 82
439 3300048914 Ga0496111_0033505 Ga0496111_0033505_3008_3259 82
440 3300048914 Ga0496111_0040213 Ga0496111_0040213_122_373 82
441 3300048914 Ga0496111_0510515 Ga0496111_0510515_173_421 82
442 3300048915 Ga0496112_0044862 Ga0496112_0044862_1574_1825 82
443 3300048916 Ga0496113_0016808 Ga0496113_0016808_2102_2353 82
444 3300048916 Ga0496113_0628591 Ga0496113_0628591_153_404 82
445 3300048917 Ga0496114_0010259 Ga0496114_0010259_2806_3057 82
446 3300048917 Ga0496114_0073710 Ga0496114_0073710_40_291 82
447 3300048917 Ga0496114_0117167 Ga0496114_0117167_281_532 82
448 3300048917 Ga0496114_0673670 Ga0496114_0673670_273_524 82
449 3300048918 Ga0496115_0037682 Ga0496115_0037682_939_1187 82
450 3300048918 Ga0496115_0718693 Ga0496115_0718693_483_734 82
451 3300048924 Ga0496121_0486599 Ga0496121_0486599_330_581 82
452 3300048929 Ga0496126_0705106 Ga0496126_0705106_491_739 82
453 3300049568 Ga0501031_0925851 Ga0501031_0925851_72_323 82
454 3300049592 Ga0501076_0294114 Ga0501076_0294114_100_351 82
455 3300049665 Ga0501227_066426 Ga0501227_066426_441_689 82
456 3300049672 Ga0501239_070017 Ga0501239_070017_84_332 82
457 3300049822 Ga0501035_0394759 Ga0501035_0394759_368_616 82
458 3300050491 nmdc:mga00v17_833742_c1 nmdc:mga00v17_833742_c1_176_427 82
459 3300050507 nmdc:mga05p37_1091226_c1 nmdc:mga05p37_1091226_c1_527_778 82
460 3300050507 nmdc:mga05p37_1620837_c1 nmdc:mga05p37_1620837_c1_173_421 82
461 3300050508 nmdc:mga09592_1000153_c1 nmdc:mga09592_1000153_c1_192_443 82
462 3300054114 Ga0501084_0776806 Ga0501084_0776806_404_655 82
463 3300059424 Ga0590075_116437 Ga0590075_116437_196_447 82

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14026

SCO4226-like

Nickel responsive protein SCO4226-like

15

90

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.9265 3 82
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.905 3 82
3rhu-assembly1.cif.gz_A epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.7936 34 54
1v4p-assembly3.cif.gz_C crystal structure of alanyl-trna synthetase from pyrococcus horikoshii ot3 0.7575 34 56
2a6o-assembly1.cif.gz_A crystal structure of the ishp608 transposase in complex with stem-loop dna 0.681 2 81
ID Description Score Start End Superfamily
4oi3B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.925 4 82 3.30.70.3090
4oi3B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.9031 4 82 3.30.70.3090
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.7694 1 78 3.30.70.3090
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.7313 1 78 3.30.70.3090
af_Q1ZXR2_492_809_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.7257 5 53 1.10.510.10
ID Description Score Start End GO Terms
AF-A0A1Q4F204-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9987 1 79 GO:0003700
GO:0043565
AF-A0A428K041-F1-model_v4 DUF4242 domain-containing protein 0.9973 1 79 GO:0003700
GO:0043565
AF-A0A537JU00-F1-model_v4 DUF4242 domain-containing protein 0.9971 1 79 GO:0003700
GO:0004016
GO:0009190
GO:0035556
GO:0043565
AF-A0A110B1H8-F1-model_v4 AraC-like DNA-binding protein (Transcriptional activator FtrA) 0.9968 1 79 GO:0003700
GO:0004016
GO:0009190
GO:0035556
GO:0043565
AF-A0A317IU28-F1-model_v4 Guanylate cyclase domain-containing protein 0.9954 1 79 GO:0004016
GO:0009190
GO:0035556

Feature Viewer

pLDDT pTM Quality
97.43 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map