F449128

General Info

Members Datasets Scaffolds Average Seq Length
463 240 926 247

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10059733|Ga0307515_100597331
Length 265
Sequence VRGNLTDGAVGYAFHLVTEFNRAPRLTLLPAVDVADGKAVRLTQGEAGSETSYGDPIEAAANWANQGAEWIHLVDLDAAFGRGNNHAVIKKVIKNTPRKVNIELSGGIRDDESLEAALSTGAKRINLGTAALENPEWAAHVIAEYGDAIAVGLDVRGTTLAARGWTQDGGDLWTVLERLEAAGCSRYVVTDVTKDGTLKGPNLELLAEVCSRTDRPVIASGGIADLDDIAELRELVPQGLEGAIVGKALYAGAFTLAEALDVASV

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
24 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
33 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
34 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
41 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
42 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
44 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
47 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
59 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
60 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
61 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
62 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
66 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
67 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
68 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
69 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
70 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
73 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
74 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
75 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
76 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
79 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
80 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
83 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
84 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
87 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
88 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
89 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
90 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
91 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
92 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
93 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
94 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
98 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
99 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
100 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
101 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
102 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
103 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
104 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
105 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
106 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
107 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
108 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
109 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
110 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
111 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
112 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
113 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
129 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
130 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
131 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
139 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
140 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
141 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
142 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
143 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
144 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
145 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
146 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
147 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
148 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
149 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
150 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
151 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
152 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
156 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
157 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
158 2643221546 Microbacterium sp. Root53 Isolate Unclassified
159 2643221549 Agromyces sp. Root1464 Isolate Unclassified
160 2643221553 Microbacterium sp. Root553 Isolate Unclassified
161 2643221566 Microbacterium sp. Root166 Isolate Unclassified
162 2643221575 Microbacterium sp. Root61 Isolate Unclassified
163 2643221597 Microbacterium sp. Root180 Isolate Unclassified
164 2643221616 Leifsonia sp. Root227 Isolate Unclassified
165 2643221619 Agromyces sp. Root81 Isolate Unclassified
166 2643221630 Microbacterium sp. Root322 Isolate Unclassified
167 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
168 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
169 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
170 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
171 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
172 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
173 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
174 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
175 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
176 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
177 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
178 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
179 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
180 2808606372 Agromyces sp. 23-23 Isolate Unclassified
181 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
182 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
183 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
184 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
185 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
186 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
187 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
188 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
189 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
190 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
191 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
192 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
193 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
194 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
195 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
196 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
197 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
198 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
199 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
200 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
201 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
202 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
203 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
204 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
205 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
206 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
207 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
208 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
209 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
210 2919069694 Microbacterium sp. 1154 Isolate Unclassified
211 2919395869 Microbacterium resistens 2980 Isolate Unclassified
212 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
213 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
214 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
215 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
216 2928153084 Leifsonia sp. 563 Isolate Unclassified
217 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
218 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
219 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
220 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
221 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
222 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
223 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
224 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
225 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
226 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
227 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
228 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
229 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
230 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
231 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
232 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
233 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
234 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
235 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
236 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
237 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
238 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
239 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
240 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.56
Metatranscriptomes 1.08
Isolates 18.36

Biome Distribution

Category Percentage (%)
Aerial Root 0.43
Bulb 0
Endosphere 15.33
Nodule 0
Rhizoplane 5.4
Rhizosphere 50.11
Stem 0
Stem Tuber 0.22
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10059733 3300028794 Bacteria 5457
2 JGI24740J21852_10001577 3300001979 Bacteria 10469
3 JGI25154J39366_1000828 3300002738 Bacteria 13428
4 JGI25164J39214_1000620 3300002772 Bacteria 15088
5 JGI25165J46597_1000004 3300003214 Bacteria 667510
6 Ga0006562J51391_1106503 3300003578 Bacteria 9350
7 Ga0006562J51391_1106506 3300003578 Bacteria 6320
8 Ga0006562J51391_1175917 3300003578 Bacteria 8784
9 Ga0006562J51391_1175918 3300003578 Bacteria 8784
10 Ga0055539_1000005 3300003752 Bacteria 609598
11 Ga0055533_1000001 3300003756 Bacteria 1863437
12 Ga0055525_1000237 3300003759 Bacteria 57574
13 Ga0055527_1000001 3300003760 Bacteria 850044
14 Ga0055529_1000019 3300003763 Bacteria 332786
15 Ga0055541_1002324 3300003841 Bacteria 3828
16 Ga0070668_100000654 3300005347 Bacteria 23449
17 Ga0070659_100149342 3300005366 Bacteria 1906
18 Ga0070710_10018169 3300005437 Bacteria 3613
19 Ga0070663_100000249 3300005455 Bacteria 27248
20 Ga0070663_100318953 3300005455 Bacteria 1249
21 Ga0070665_100545518 3300005548 Bacteria 1171
22 Ga0068861_100028136 3300005719 Bacteria 4101
23 Ga0075365_10004167 3300006038 Bacteria 7610
24 Ga0075365_10079723 3300006038 Bacteria 2216
25 Ga0075365_10126226 3300006038 Bacteria 1768
26 Ga0075365_10300752 3300006038 Bacteria 1129
27 Ga0075368_10207868 3300006042 Bacteria 829
28 Ga0075364_10008890 3300006051 Bacteria 6017
29 Ga0075364_10020414 3300006051 Bacteria 4166
30 Ga0075364_10026521 3300006051 Bacteria 3697
31 Ga0075364_10035873 3300006051 Bacteria 3205
32 Ga0075364_10413418 3300006051 Bacteria 921
33 Ga0075367_10004065 3300006178 Bacteria 7078
34 Ga0075367_10320280 3300006178 Bacteria 977
35 Ga0075369_10005242 3300006186 Bacteria 4832
36 Ga0105244_10014442 3300009036 Bacteria 4565
37 Ga0105244_10041324 3300009036 Bacteria 2390
38 Ga0105244_10216536 3300009036 Bacteria 899
39 Ga0111539_10531350 3300009094 Bacteria 1370
40 Ga0105243_10010890 3300009148 Bacteria 6880
41 Ga0105243_10478282 3300009148 Bacteria 1175
42 Ga0157370_10068448 3300013104 Bacteria 3355
43 Ga0157369_10001248 3300013105 Bacteria 31691
44 Ga0157369_10072084 3300013105 Bacteria 3708
45 Ga0157369_10129588 3300013105 Bacteria 2674
46 Ga0157369_10487599 3300013105 Bacteria 1275
47 Ga0157369_10922095 3300013105 Bacteria 895
48 Ga0171462_1001 3300013250 Bacteria 1135406
49 Ga0163162_10545821 3300013306 Bacteria 1287
50 Ga0157372_10672439 3300013307 Bacteria 1205
51 Ga0157380_10693724 3300014326 Bacteria 1022
52 Ga0157380_10737284 3300014326 Bacteria 995
53 Ga0163161_10227068 3300017792 Bacteria 1448
54 Ga0163161_10467893 3300017792 Bacteria 1022
55 Ga0206353_11639430 3300020082 Bacteria 6954
56 Ga0209566_100105 3300025225 Bacteria 125766
57 Ga0209674_100001 3300025226 Bacteria 4013750
58 Ga0209672_100006 3300025228 Bacteria 1004497
59 Ga0209147_100854 3300025229 Bacteria 14264
60 Ga0209563_100001 3300025230 Bacteria 4013775
61 Ga0207427_100010 3300025231 Bacteria 648610
62 Ga0209437_101360 3300025233 Bacteria 6308
63 Ga0209258_101278 3300025242 Bacteria 9455
64 Ga0209646_1000013 3300025246 Bacteria 565830
65 Ga0209677_100001 3300025253 Bacteria 4013787
66 Ga0209677_108322 3300025253 Bacteria 2029
67 Ga0209148_1000015 3300025254 Bacteria 850103
68 Ga0209233_1000001 3300025261 Bacteria 2992747
69 Ga0209455_1000013 3300025272 Bacteria 850103
70 Ga0209455_1000928 3300025272 Bacteria 15084
71 Ga0207655_1004214 3300025728 Bacteria 10305
72 Ga0207655_1028318 3300025728 Bacteria 2645
73 Ga0207655_1060498 3300025728 Bacteria 1468
74 Ga0207692_10207506 3300025898 Bacteria 1155
75 Ga0207647_10018369 3300025904 Bacteria 4733
76 Ga0207664_10013133 3300025929 Bacteria 5939
77 Ga0207690_10133570 3300025932 Bacteria 1819
78 Ga0207709_10003288 3300025935 Bacteria 9699
79 Ga0207668_10174890 3300025972 Bacteria 1688
80 Ga0207658_10018383 3300025986 Bacteria 4827
81 Ga0207678_10000065 3300026067 Bacteria 83028
82 Ga0207678_10399392 3300026067 Bacteria 1190
83 Ga0268266_10148907 3300028379 Bacteria 2108
84 Ga0307515_10138279 3300028794 Bacteria 2631
85 Ga0307512_10096752 3300030522 Bacteria 2023
86 Ga0316576_10112732 3300031727 Bacteria 2039
87 Ga0307405_10062282 3300031731 Bacteria 2362
88 Ga0307413_10056723 3300031824 Bacteria 2391
89 Ga0307406_10000213 3300031901 Bacteria 34975
90 Ga0307406_10000509 3300031901 Bacteria 22369
91 Ga0307406_10005107 3300031901 Bacteria 7161
92 Ga0307406_10134035 3300031901 Bacteria 1743
93 Ga0307406_10179062 3300031901 Bacteria 1542
94 Ga0307406_10184409 3300031901 Bacteria 1522
95 Ga0307406_10428881 3300031901 Bacteria 1055
96 Ga0307406_10635437 3300031901 Bacteria 884
97 Ga0307412_10025994 3300031911 Bacteria 3634
98 Ga0307416_100680287 3300032002 Bacteria 1116
99 Ga0307415_100464053 3300032126 Bacteria 1098
100 Ga0316574_0011550 3300035398 Bacteria 5023
101 Ga0316584_0285584 3300036712 Bacteria 1198
102 Ga0395899_0001103 3300037312 Bacteria 24193
103 Ga0395899_0049816 3300037312 Bacteria 3112
104 Ga0395900_0023407 3300037418 Bacteria 6323
105 Ga0395900_0154864 3300037418 Bacteria 2341
106 Ga0395898_0000015 3300037466 Bacteria 439819
107 Ga0395898_0044738 3300037466 Bacteria 4355
108 Ga0395898_0049048 3300037466 Bacteria 4138
109 Ga0395901_0132943 3300038443 Bacteria 2615
110 Ga0451793_0428684 3300041452 Bacteria 820
111 Ga0451793_0851508 3300041452 Bacteria 2309
112 Ga0451793_1135981 3300041452 Bacteria 1440
113 Ga0451837_0575325 3300041494 Bacteria 852
114 Ga0466972_0003105 3300044658 Bacteria 8240
115 Ga0466972_0027024 3300044658 Bacteria 2841
116 Ga0466972_0039731 3300044658 Bacteria 2295
117 Ga0466965_0000002 3300044683 Bacteria 297957
118 Ga0466965_0015433 3300044683 Bacteria 3629
119 Ga0466965_0020486 3300044683 Bacteria 3179
120 Ga0466965_0041750 3300044683 Bacteria 2260
121 Ga0466965_0102617 3300044683 Bacteria 1464
122 Ga0466965_0197495 3300044683 Bacteria 1066
123 Ga0466966_0115617 3300044684 Bacteria 1651
124 Ga0466961_0069490 3300044693 Bacteria 2236
125 Ga0466961_0125495 3300044693 Bacteria 1610
126 Ga0466971_0014183 3300044719 Bacteria 3504
127 Ga0466968_0053422 3300044735 Bacteria 1730
128 Ga0466968_0125598 3300044735 Bacteria 1164
129 Ga0466970_0000017 3300044765 Bacteria 64907
130 Ga0466970_0011275 3300044765 Bacteria 4554
131 Ga0466970_0020017 3300044765 Bacteria 3472
132 Ga0466970_0023084 3300044765 Bacteria 3247
133 Ga0466970_0032051 3300044765 Bacteria 2776
134 Ga0466970_0035683 3300044765 Bacteria 2634
135 Ga0466970_0053658 3300044765 Bacteria 2153
136 Ga0466970_0054846 3300044765 Bacteria 2128
137 Ga0466970_0132213 3300044765 Bacteria 1371
138 Ga0466970_0136952 3300044765 Bacteria 1347
139 Ga0466957_0039892 3300044842 Bacteria 2834
140 Ga0466957_0171164 3300044842 Bacteria 1415
141 Ga0466960_0057764 3300044901 Bacteria 1893
142 Ga0466959_0124837 3300045049 Bacteria 1827
143 Ga0466959_0147279 3300045049 Bacteria 1661
144 Ga0466959_0219020 3300045049 Bacteria 1321
145 Ga0466959_0540387 3300045049 Bacteria 786
146 Ga0466958_0286239 3300045836 Bacteria 1057
147 Ga0466967_0032541 3300045976 Bacteria 4404
148 Ga0466967_0259694 3300045976 Bacteria 1662
149 Ga0495627_012915 3300046453 Bacteria 2948
150 Ga0495590_0000183 3300046457 Bacteria 36526
151 Ga0495650_0112283 3300046471 Bacteria 1011
152 Ga0495631_0084608 3300046518 Bacteria 1367
153 Ga0495644_0086986 3300046523 Bacteria 1178
154 Ga0495609_0134898 3300046538 Bacteria 1056
155 Ga0495621_0113074 3300046539 Bacteria 1043
156 Ga0496100_0127375 3300048903 Bacteria 1789
157 Ga0496101_0147391 3300048904 Bacteria 1798
158 Ga0496101_0315221 3300048904 Bacteria 1227
159 Ga0496102_0297683 3300048905 Bacteria 1521
160 Ga0496104_0098885 3300048907 Bacteria 2793
161 Ga0496104_0251855 3300048907 Bacteria 1679
162 Ga0496105_0072215 3300048908 Bacteria 2852
163 Ga0496105_0112283 3300048908 Bacteria 2249
164 Ga0496105_0120150 3300048908 Bacteria 2167
165 Ga0496109_0084400 3300048912 Bacteria 2930
166 Ga0496111_0057428 3300048914 Bacteria 2818
167 Ga0496111_0516425 3300048914 Bacteria 879
168 Ga0496113_0111285 3300048916 Bacteria 2132
169 Ga0496114_0033419 3300048917 Bacteria 4238
170 Ga0496114_0173709 3300048917 Bacteria 1879
171 Ga0496114_0182310 3300048917 Bacteria 1834
172 Ga0496114_0202547 3300048917 Bacteria 1739
173 Ga0496114_0252385 3300048917 Bacteria 1552
174 Ga0496114_0261604 3300048917 Bacteria 1523
175 Ga0496115_0093637 3300048918 Bacteria 2457
176 Ga0496115_0103147 3300048918 Bacteria 2339
177 Ga0496115_0458365 3300048918 Bacteria 1029
178 Ga0496116_0120959 3300048919 Bacteria 1515
179 Ga0496117_0000028 3300048920 Bacteria 407392
180 Ga0496117_0001238 3300048920 Bacteria 38206
181 Ga0496117_0002355 3300048920 Bacteria 24155
182 Ga0496117_0002931 3300048920 Bacteria 20647
183 Ga0496117_0006826 3300048920 Bacteria 11363
184 Ga0496117_0017818 3300048920 Bacteria 5919
185 Ga0496117_0025083 3300048920 Bacteria 4695
186 Ga0496117_0047832 3300048920 Bacteria 3062
187 Ga0496117_0060812 3300048920 Bacteria 2600
188 Ga0496117_0069973 3300048920 Bacteria 2360
189 Ga0496117_0126460 3300048920 Bacteria 1559
190 Ga0496117_0268867 3300048920 Bacteria 919
191 Ga0496118_0000149 3300048921 Bacteria 123317
192 Ga0496118_0009971 3300048921 Bacteria 9486
193 Ga0496118_0013519 3300048921 Bacteria 7712
194 Ga0496118_0013711 3300048921 Bacteria 7647
195 Ga0496118_0038535 3300048921 Bacteria 3828
196 Ga0496118_0098457 3300048921 Bacteria 1986
197 Ga0496119_0002490 3300048922 Bacteria 20129
198 Ga0496119_0006823 3300048922 Bacteria 10468
199 Ga0496119_0011987 3300048922 Bacteria 7099
200 Ga0496119_0015108 3300048922 Bacteria 5975
201 Ga0496119_0019797 3300048922 Bacteria 4935
202 Ga0496119_0033780 3300048922 Bacteria 3384
203 Ga0496119_0052975 3300048922 Bacteria 2482
204 Ga0496119_0147311 3300048922 Bacteria 1265
205 Ga0496119_0197807 3300048922 Bacteria 1042
206 Ga0496119_0263972 3300048922 Bacteria 863
207 Ga0496120_0000553 3300048923 Bacteria 56978
208 Ga0496120_0000809 3300048923 Bacteria 44906
209 Ga0496120_0002169 3300048923 Bacteria 20844
210 Ga0496120_0028722 3300048923 Bacteria 3404
211 Ga0496121_0000277 3300048924 Bacteria 107014
212 Ga0496121_0024521 3300048924 Bacteria 5765
213 Ga0496122_0000036 3300048925 Bacteria 312598
214 Ga0496122_0000055 3300048925 Bacteria 258485
215 Ga0496122_0002530 3300048925 Bacteria 25739
216 Ga0496122_0012349 3300048925 Bacteria 8523
217 Ga0496122_0017586 3300048925 Bacteria 6672
218 Ga0496122_0059043 3300048925 Bacteria 2834
219 Ga0496122_0061337 3300048925 Bacteria 2761
220 Ga0496122_0073563 3300048925 Bacteria 2422
221 Ga0496122_0132419 3300048925 Bacteria 1581
222 Ga0496123_0000003 3300048926 Bacteria 866556
223 Ga0496123_0000011 3300048926 Bacteria 493925
224 Ga0496123_0002201 3300048926 Bacteria 24786
225 Ga0496123_0006381 3300048926 Bacteria 11443
226 Ga0496123_0016558 3300048926 Bacteria 5978
227 Ga0496123_0022170 3300048926 Bacteria 4905
228 Ga0496123_0194450 3300048926 Bacteria 1046
229 Ga0496124_0003142 3300048927 Bacteria 20440
230 Ga0496124_0003169 3300048927 Bacteria 20336
231 Ga0496124_0003796 3300048927 Bacteria 18150
232 Ga0496124_0010149 3300048927 Bacteria 9583
233 Ga0496124_0025041 3300048927 Bacteria 5411
234 Ga0496124_0044534 3300048927 Bacteria 3807
235 Ga0496124_0095398 3300048927 Bacteria 2418
236 Ga0496124_0204182 3300048927 Bacteria 1500
237 Ga0496125_0000473 3300048928 Bacteria 71177
238 Ga0496125_0001414 3300048928 Bacteria 35032
239 Ga0496125_0003322 3300048928 Bacteria 19662
240 Ga0496125_0006023 3300048928 Bacteria 13265
241 Ga0496125_0007780 3300048928 Bacteria 11338
242 Ga0496125_0032231 3300048928 Bacteria 4657
243 Ga0496125_0054853 3300048928 Bacteria 3254
244 Ga0496125_0200409 3300048928 Bacteria 1307
245 Ga0496125_0204211 3300048928 Bacteria 1290
246 Ga0496126_0003639 3300048929 Bacteria 19260
247 Ga0496126_0007023 3300048929 Bacteria 12421
248 Ga0496126_0010550 3300048929 Bacteria 9667
249 Ga0496126_0019741 3300048929 Bacteria 6632
250 Ga0496126_0042568 3300048929 Bacteria 4194
251 Ga0496126_0128492 3300048929 Bacteria 2191
252 Ga0496126_0217570 3300048929 Bacteria 1606
253 Ga0501031_0029883 3300049568 Bacteria 3554
254 Ga0501032_0059844 3300049569 Bacteria 2555
255 Ga0501032_0096078 3300049569 Bacteria 1964
256 Ga0501032_0203587 3300049569 Bacteria 1291
257 Ga0501033_0010214 3300049570 Bacteria 7208
258 Ga0501033_0015199 3300049570 Bacteria 5842
259 Ga0501033_0022405 3300049570 Bacteria 4765
260 Ga0501033_0143989 3300049570 Bacteria 1722
261 Ga0501033_0430619 3300049570 Bacteria 918
262 Ga0501034_0000699 3300049571 Bacteria 50906
263 Ga0501034_0005600 3300049571 Bacteria 13679
264 Ga0501034_0010917 3300049571 Bacteria 9436
265 Ga0501034_0032570 3300049571 Bacteria 5292
266 Ga0501034_0032981 3300049571 Bacteria 5258
267 Ga0501034_0079856 3300049571 Bacteria 3275
268 Ga0501034_0104108 3300049571 Bacteria 2831
269 Ga0501034_0107252 3300049571 Bacteria 2785
270 Ga0501034_0108460 3300049571 Bacteria 2768
271 Ga0501034_0118651 3300049571 Bacteria 2632
272 Ga0501034_0140557 3300049571 Bacteria 2394
273 Ga0501034_0143769 3300049571 Bacteria 2363
274 Ga0501036_0042309 3300049572 Bacteria 3857
275 Ga0501036_0148896 3300049572 Bacteria 1974
276 Ga0501036_0186145 3300049572 Bacteria 1747
277 Ga0501037_0097226 3300049573 Bacteria 2127
278 Ga0501037_0271390 3300049573 Bacteria 1183
279 Ga0501038_0021753 3300049574 Bacteria 5755
280 Ga0501038_0083236 3300049574 Bacteria 2693
281 Ga0501038_0094493 3300049574 Bacteria 2499
282 Ga0501039_0016460 3300049575 Bacteria 5664
283 Ga0501039_0033838 3300049575 Bacteria 3943
284 Ga0501039_0172397 3300049575 Bacteria 1701
285 Ga0501039_0172939 3300049575 Bacteria 1698
286 Ga0501039_0290419 3300049575 Bacteria 1285
287 Ga0501042_0003829 3300049578 Bacteria 9514
288 Ga0501043_0022996 3300049579 Bacteria 4888
289 Ga0501043_0035485 3300049579 Bacteria 3922
290 Ga0501043_0082923 3300049579 Bacteria 2520
291 Ga0501043_0084109 3300049579 Bacteria 2501
292 Ga0501043_0239993 3300049579 Bacteria 1398
293 Ga0501046_0006653 3300049580 Bacteria 10206
294 Ga0501046_0041935 3300049580 Bacteria 3649
295 Ga0501047_0000018 3300049581 Bacteria 274180
296 Ga0501047_0014678 3300049581 Bacteria 7454
297 Ga0501047_0087772 3300049581 Bacteria 2988
298 Ga0501047_0105685 3300049581 Bacteria 2695
299 Ga0501047_0202860 3300049581 Bacteria 1843
300 Ga0501047_0330879 3300049581 Bacteria 1362
301 Ga0501068_0136618 3300049584 Bacteria 1535
302 Ga0501068_0174087 3300049584 Bacteria 1359
303 Ga0501070_0000150 3300049586 Bacteria 64208
304 Ga0501070_0001815 3300049586 Bacteria 18803
305 Ga0501070_0005356 3300049586 Bacteria 10946
306 Ga0501070_0019809 3300049586 Bacteria 5641
307 Ga0501070_0025075 3300049586 Bacteria 5000
308 Ga0501070_0035763 3300049586 Bacteria 4148
309 Ga0501070_0040339 3300049586 Bacteria 3893
310 Ga0501070_0154781 3300049586 Bacteria 1891
311 Ga0501071_0000061 3300049587 Bacteria 37719
312 Ga0501071_0337920 3300049587 Bacteria 1145
313 Ga0501072_0169500 3300049588 Bacteria 1742
314 Ga0501072_0260998 3300049588 Bacteria 1379
315 Ga0501073_0000024 3300049589 Bacteria 128851
316 Ga0501073_0077982 3300049589 Bacteria 2305
317 Ga0501073_0159365 3300049589 Bacteria 1564
318 Ga0501073_0286138 3300049589 Bacteria 1137
319 Ga0501074_0223805 3300049590 Bacteria 1339
320 Ga0501080_0000058 3300049742 Bacteria 72664
321 Ga0501080_0056542 3300049742 Bacteria 3653
322 Ga0501083_0000056 3300049744 Bacteria 82115
323 Ga0501083_0006666 3300049744 Bacteria 8191
324 Ga0501083_0039348 3300049744 Bacteria 3212
325 Ga0501035_0019411 3300049822 Bacteria 6252
326 Ga0501035_0050407 3300049822 Bacteria 3731
327 Ga0501035_0053302 3300049822 Bacteria 3618
328 Ga0501035_0165806 3300049822 Bacteria 1910
329 Ga0501035_0280039 3300049822 Bacteria 1409
330 Ga0501035_0316279 3300049822 Bacteria 1312
331 Ga0501044_0005435 3300049823 Bacteria 14154
332 Ga0501044_0015675 3300049823 Bacteria 8162
333 Ga0501044_0131499 3300049823 Bacteria 2496
334 Ga0501044_0375530 3300049823 Bacteria 1337
335 Ga0501044_0387625 3300049823 Bacteria 1311
336 Ga0501044_0711604 3300049823 Bacteria 889
337 Ga0501045_0162409 3300049824 Bacteria 1663
338 nmdc:mga03n38_127055_c1 3300050490 Bacteria 1259
339 nmdc:mga00v17_128995_c1 3300050491 Bacteria 1615
340 nmdc:mga00v17_33519_c1 3300050491 Bacteria 3043
341 nmdc:mga0yw44_138077_c1 3300050492 Bacteria 1582
342 nmdc:mga0yw44_180378_c1 3300050492 Bacteria 1390
343 nmdc:mga0yw44_21477_c1 3300050492 Bacteria 3601
344 nmdc:mga0yw44_40546_c1 3300050492 Bacteria 2767
345 nmdc:mga0yw44_59711_c1 3300050492 Bacteria 2334
346 nmdc:mga0sz30_19925_c1 3300050516 Bacteria 2701
347 Ga0500635_0000039 3300053080 Bacteria 93004
348 Ga0500650_0002152 3300053098 Bacteria 6375
349 Ga0500556_0000062 3300053104 Bacteria 110818
350 Ga0500556_0001014 3300053104 Bacteria 14754
351 Ga0500562_000346 3300053108 Bacteria 11134
352 Ga0500562_087924 3300053108 Bacteria 843
353 Ga0500593_000363 3300053117 Bacteria 18295
354 Ga0500655_001024 3300053133 Bacteria 5398
355 Ga0500559_0000496 3300053136 Bacteria 27644
356 Ga0500559_0001158 3300053136 Bacteria 15884
357 Ga0500559_0038610 3300053136 Bacteria 2074
358 Ga0500568_0000060 3300053139 Bacteria 107901
359 Ga0500568_0000075 3300053139 Bacteria 94413
360 Ga0500568_0000151 3300053139 Bacteria 60575
361 Ga0500568_0003966 3300053139 Bacteria 8048
362 Ga0500568_0019144 3300053139 Bacteria 2981
363 Ga0500573_0006182 3300053140 Bacteria 6456
364 Ga0500573_0031312 3300053140 Bacteria 3070
365 Ga0500573_0044916 3300053140 Bacteria 2547
366 Ga0500573_0065572 3300053140 Bacteria 2076
367 Ga0500573_0141644 3300053140 Bacteria 1323
368 Ga0500577_0030923 3300053142 Bacteria 1868
369 Ga0500588_0049157 3300053146 Bacteria 1307
370 Ga0500616_0000071 3300053153 Bacteria 232527
371 Ga0500616_0000781 3300053153 Bacteria 36581
372 Ga0500616_0001401 3300053153 Bacteria 23221
373 Ga0500616_0031943 3300053153 Bacteria 2880
374 Ga0501084_0190913 3300054114 Bacteria 1728
375 Ga0501082_0060608 3300060353 Bacteria 3258
376 Ga0501082_0378903 3300060353 Bacteria 1234
377 Ga0501082_0702187 3300060353 Bacteria 885
378 Ga0466962_0026411 3300061719 Bacteria 2788
379 2588106557 2585428157 Bacteria 3018951
380 2643735115 2643221542 Bacteria 3563959
381 2643754217 2643221546 Bacteria 2910897
382 2643769314 2643221549 Bacteria 4042819
383 2643786765 2643221553 Bacteria 3544260
384 2643849583 2643221566 Bacteria 3460379
385 2643888732 2643221575 Bacteria 4022601
386 2643996189 2643221597 Bacteria 3347721
387 2644097007 2643221616 Bacteria 4066575
388 2644113931 2643221619 Bacteria 4158469
389 2644173277 2643221630 Bacteria 3601215
390 2644183877 2643221632 Bacteria 3406696
391 2644198567 2643221635 Bacteria 2632343
392 2644681438 2643221724 Bacteria 3593515
393 2655032029 2654587600 Bacteria 3911798
394 2723642606 2721755702 Bacteria 4373124
395 2730230124 2728369380 Bacteria 3620317
396 2747953831 2747842429 Bacteria 3914386
397 2753301417 2751185788 Bacteria 4541048
398 2758224218 2757320536 Bacteria 3629334
399 2774381506 2773857758 Bacteria 3592392
400 2774399976 2773857763 Bacteria 4180068
401 2808631560 2808606306 Bacteria 3608896
402 2808885257 2808606368 Bacteria 3174172
403 2808902577 2808606372 Bacteria 4649509
404 2809227033 2808606447 Bacteria 3572005
405 2812322654 2811994872 Bacteria 4121241
406 2812365440 2811994880 Bacteria 4147780
407 2821269576 2821268502 Bacteria 3750023
408 2833710489 2833709550 Bacteria 4008291
409 2844842821 2844841374 Bacteria 3917147
410 2844854895 2844852863 Bacteria 3849151
411 2852633581 2852632344 Bacteria 3463163
412 2852649604 2852646457 Bacteria 3408613
413 2852665569 2852663356 Bacteria 4090475
414 2857720434 2857720070 Bacteria 3189373
415 2857725071 2857723135 Bacteria 4217853
416 2857735433 2857733635 Bacteria 3532004
417 2862993284 2862993130 Bacteria 3860849
418 2870623211 2870622029 Bacteria 3643329
419 2870629917 2870628048 Bacteria 3696012
420 2870804988 2870804320 Bacteria 2552467
421 2884765797 2884763398 Bacteria 4091164
422 2897564731 2897561785 Bacteria 3256946
423 2904433362 2904430863 Bacteria 3486923
424 2904503769 2904501621 Bacteria 3401437
425 2904509808 2904509784 Bacteria 3520416
426 2908675409 2908674828 Bacteria 3382763
427 2908678976 2908678064 Bacteria 3482747
428 2909077663 2909074476 Bacteria 3436050
429 2919041992 2919039151 Bacteria 3391018
430 2919045044 2919042368 Bacteria 3905917
431 2919053200 2919051321 Bacteria 4210889
432 2919059062 2919055335 Bacteria 3875751
433 2919071324 2919069694 Bacteria 3622919
434 2919395892 2919395869 Bacteria 3704152
435 2919443184 2919443155 Bacteria 4072969
436 2919524906 2919523602 Bacteria 3788128
437 2928092479 2928090899 Bacteria 3158267
438 2928108381 2928104781 Bacteria 3877447
439 2928156902 2928153084 Bacteria 4020257
440 2928501434 2928500415 Bacteria 3384541
441 2935413231 2935409751 Bacteria 4179611
442 2939657607 2939657138 Bacteria 3740283
443 2945968311 2945968032 Bacteria 4111363
444 2946025269 2946024296 Bacteria 3508095
445 2946044771 2946041624 Bacteria 4191385
446 2946084605 2946080515 Bacteria 4310960
447 2966923897 2966921586 Bacteria 3092803
448 2966927664 2966924647 Bacteria 3268643
449 2974297833 2974294766 Bacteria 3767688
450 2974325932 2974324384 Bacteria 3750535
451 2977230880 2977228692 Bacteria 3450105
452 2977239678 2977236895 Bacteria 3569373
453 2977266108 2977264416 Bacteria 3750737
454 2984546050 2984542743 Bacteria 3569378
455 2984580747 2984580707 Bacteria 3351387
456 2990089688 2990088156 Bacteria 6657676
457 8003322291 8003314358 Bacteria 10575343
458 8004185659 8004182704 Bacteria 3391155
459 8004214504 8004212874 Bacteria 2861420
460 8045831261 8045830549 Bacteria 4444727
461 8056038835 8056037122 Bacteria 3854319
462 8056061989 8056060235 Bacteria 7259403
463 8057349542 8057345674 Bacteria 4160394
464 Ga0307515_10059733
465 JGI24740J21852_10001577
466 JGI25154J39366_1000828
467 JGI25164J39214_1000620
468 JGI25165J46597_1000004
469 Ga0006562J51391_1106503
470 Ga0006562J51391_1106506
471 Ga0006562J51391_1175917
472 Ga0006562J51391_1175918
473 Ga0055539_1000005
474 Ga0055533_1000001
475 Ga0055525_1000237
476 Ga0055527_1000001
477 Ga0055529_1000019
478 Ga0055541_1002324
479 Ga0070668_100000654
480 Ga0070659_100149342
481 Ga0070710_10018169
482 Ga0070663_100000249
483 Ga0070663_100318953
484 Ga0070665_100545518
485 Ga0068861_100028136
486 Ga0075365_10004167
487 Ga0075365_10079723
488 Ga0075365_10126226
489 Ga0075365_10300752
490 Ga0075368_10207868
491 Ga0075364_10008890
492 Ga0075364_10020414
493 Ga0075364_10026521
494 Ga0075364_10035873
495 Ga0075364_10413418
496 Ga0075367_10004065
497 Ga0075367_10320280
498 Ga0075369_10005242
499 Ga0105244_10014442
500 Ga0105244_10041324
501 Ga0105244_10216536
502 Ga0111539_10531350
503 Ga0105243_10010890
504 Ga0105243_10478282
505 Ga0157370_10068448
506 Ga0157369_10001248
507 Ga0157369_10072084
508 Ga0157369_10129588
509 Ga0157369_10487599
510 Ga0157369_10922095
511 Ga0171462_1001
512 Ga0163162_10545821
513 Ga0157372_10672439
514 Ga0157380_10693724
515 Ga0157380_10737284
516 Ga0163161_10227068
517 Ga0163161_10467893
518 Ga0206353_11639430
519 Ga0209566_100105
520 Ga0209674_100001
521 Ga0209672_100006
522 Ga0209147_100854
523 Ga0209563_100001
524 Ga0207427_100010
525 Ga0209437_101360
526 Ga0209258_101278
527 Ga0209646_1000013
528 Ga0209677_100001
529 Ga0209677_108322
530 Ga0209148_1000015
531 Ga0209233_1000001
532 Ga0209455_1000013
533 Ga0209455_1000928
534 Ga0207655_1004214
535 Ga0207655_1028318
536 Ga0207655_1060498
537 Ga0207692_10207506
538 Ga0207647_10018369
539 Ga0207664_10013133
540 Ga0207690_10133570
541 Ga0207709_10003288
542 Ga0207668_10174890
543 Ga0207658_10018383
544 Ga0207678_10000065
545 Ga0207678_10399392
546 Ga0268266_10148907
547 Ga0307515_10138279
548 Ga0307512_10096752
549 Ga0316576_10112732
550 Ga0307405_10062282
551 Ga0307413_10056723
552 Ga0307406_10000213
553 Ga0307406_10000509
554 Ga0307406_10005107
555 Ga0307406_10134035
556 Ga0307406_10179062
557 Ga0307406_10184409
558 Ga0307406_10428881
559 Ga0307406_10635437
560 Ga0307412_10025994
561 Ga0307416_100680287
562 Ga0307415_100464053
563 Ga0316574_0011550
564 Ga0316584_0285584
565 Ga0395899_0001103
566 Ga0395899_0049816
567 Ga0395900_0023407
568 Ga0395900_0154864
569 Ga0395898_0000015
570 Ga0395898_0044738
571 Ga0395898_0049048
572 Ga0395901_0132943
573 Ga0451793_0428684
574 Ga0451793_0851508
575 Ga0451793_1135981
576 Ga0451837_0575325
577 Ga0466972_0003105
578 Ga0466972_0027024
579 Ga0466972_0039731
580 Ga0466965_0000002
581 Ga0466965_0015433
582 Ga0466965_0020486
583 Ga0466965_0041750
584 Ga0466965_0102617
585 Ga0466965_0197495
586 Ga0466966_0115617
587 Ga0466961_0069490
588 Ga0466961_0125495
589 Ga0466971_0014183
590 Ga0466968_0053422
591 Ga0466968_0125598
592 Ga0466970_0000017
593 Ga0466970_0011275
594 Ga0466970_0020017
595 Ga0466970_0023084
596 Ga0466970_0032051
597 Ga0466970_0035683
598 Ga0466970_0053658
599 Ga0466970_0054846
600 Ga0466970_0132213
601 Ga0466970_0136952
602 Ga0466957_0039892
603 Ga0466957_0171164
604 Ga0466960_0057764
605 Ga0466959_0124837
606 Ga0466959_0147279
607 Ga0466959_0219020
608 Ga0466959_0540387
609 Ga0466958_0286239
610 Ga0466967_0032541
611 Ga0466967_0259694
612 Ga0495627_012915
613 Ga0495590_0000183
614 Ga0495650_0112283
615 Ga0495631_0084608
616 Ga0495644_0086986
617 Ga0495609_0134898
618 Ga0495621_0113074
619 Ga0496100_0127375
620 Ga0496101_0147391
621 Ga0496101_0315221
622 Ga0496102_0297683
623 Ga0496104_0098885
624 Ga0496104_0251855
625 Ga0496105_0072215
626 Ga0496105_0112283
627 Ga0496105_0120150
628 Ga0496109_0084400
629 Ga0496111_0057428
630 Ga0496111_0516425
631 Ga0496113_0111285
632 Ga0496114_0033419
633 Ga0496114_0173709
634 Ga0496114_0182310
635 Ga0496114_0202547
636 Ga0496114_0252385
637 Ga0496114_0261604
638 Ga0496115_0093637
639 Ga0496115_0103147
640 Ga0496115_0458365
641 Ga0496116_0120959
642 Ga0496117_0000028
643 Ga0496117_0001238
644 Ga0496117_0002355
645 Ga0496117_0002931
646 Ga0496117_0006826
647 Ga0496117_0017818
648 Ga0496117_0025083
649 Ga0496117_0047832
650 Ga0496117_0060812
651 Ga0496117_0069973
652 Ga0496117_0126460
653 Ga0496117_0268867
654 Ga0496118_0000149
655 Ga0496118_0009971
656 Ga0496118_0013519
657 Ga0496118_0013711
658 Ga0496118_0038535
659 Ga0496118_0098457
660 Ga0496119_0002490
661 Ga0496119_0006823
662 Ga0496119_0011987
663 Ga0496119_0015108
664 Ga0496119_0019797
665 Ga0496119_0033780
666 Ga0496119_0052975
667 Ga0496119_0147311
668 Ga0496119_0197807
669 Ga0496119_0263972
670 Ga0496120_0000553
671 Ga0496120_0000809
672 Ga0496120_0002169
673 Ga0496120_0028722
674 Ga0496121_0000277
675 Ga0496121_0024521
676 Ga0496122_0000036
677 Ga0496122_0000055
678 Ga0496122_0002530
679 Ga0496122_0012349
680 Ga0496122_0017586
681 Ga0496122_0059043
682 Ga0496122_0061337
683 Ga0496122_0073563
684 Ga0496122_0132419
685 Ga0496123_0000003
686 Ga0496123_0000011
687 Ga0496123_0002201
688 Ga0496123_0006381
689 Ga0496123_0016558
690 Ga0496123_0022170
691 Ga0496123_0194450
692 Ga0496124_0003142
693 Ga0496124_0003169
694 Ga0496124_0003796
695 Ga0496124_0010149
696 Ga0496124_0025041
697 Ga0496124_0044534
698 Ga0496124_0095398
699 Ga0496124_0204182
700 Ga0496125_0000473
701 Ga0496125_0001414
702 Ga0496125_0003322
703 Ga0496125_0006023
704 Ga0496125_0007780
705 Ga0496125_0032231
706 Ga0496125_0054853
707 Ga0496125_0200409
708 Ga0496125_0204211
709 Ga0496126_0003639
710 Ga0496126_0007023
711 Ga0496126_0010550
712 Ga0496126_0019741
713 Ga0496126_0042568
714 Ga0496126_0128492
715 Ga0496126_0217570
716 Ga0501031_0029883
717 Ga0501032_0059844
718 Ga0501032_0096078
719 Ga0501032_0203587
720 Ga0501033_0010214
721 Ga0501033_0015199
722 Ga0501033_0022405
723 Ga0501033_0143989
724 Ga0501033_0430619
725 Ga0501034_0000699
726 Ga0501034_0005600
727 Ga0501034_0010917
728 Ga0501034_0032570
729 Ga0501034_0032981
730 Ga0501034_0079856
731 Ga0501034_0104108
732 Ga0501034_0107252
733 Ga0501034_0108460
734 Ga0501034_0118651
735 Ga0501034_0140557
736 Ga0501034_0143769
737 Ga0501036_0042309
738 Ga0501036_0148896
739 Ga0501036_0186145
740 Ga0501037_0097226
741 Ga0501037_0271390
742 Ga0501038_0021753
743 Ga0501038_0083236
744 Ga0501038_0094493
745 Ga0501039_0016460
746 Ga0501039_0033838
747 Ga0501039_0172397
748 Ga0501039_0172939
749 Ga0501039_0290419
750 Ga0501042_0003829
751 Ga0501043_0022996
752 Ga0501043_0035485
753 Ga0501043_0082923
754 Ga0501043_0084109
755 Ga0501043_0239993
756 Ga0501046_0006653
757 Ga0501046_0041935
758 Ga0501047_0000018
759 Ga0501047_0014678
760 Ga0501047_0087772
761 Ga0501047_0105685
762 Ga0501047_0202860
763 Ga0501047_0330879
764 Ga0501068_0136618
765 Ga0501068_0174087
766 Ga0501070_0000150
767 Ga0501070_0001815
768 Ga0501070_0005356
769 Ga0501070_0019809
770 Ga0501070_0025075
771 Ga0501070_0035763
772 Ga0501070_0040339
773 Ga0501070_0154781
774 Ga0501071_0000061
775 Ga0501071_0337920
776 Ga0501072_0169500
777 Ga0501072_0260998
778 Ga0501073_0000024
779 Ga0501073_0077982
780 Ga0501073_0159365
781 Ga0501073_0286138
782 Ga0501074_0223805
783 Ga0501080_0000058
784 Ga0501080_0056542
785 Ga0501083_0000056
786 Ga0501083_0006666
787 Ga0501083_0039348
788 Ga0501035_0019411
789 Ga0501035_0050407
790 Ga0501035_0053302
791 Ga0501035_0165806
792 Ga0501035_0280039
793 Ga0501035_0316279
794 Ga0501044_0005435
795 Ga0501044_0015675
796 Ga0501044_0131499
797 Ga0501044_0375530
798 Ga0501044_0387625
799 Ga0501044_0711604
800 Ga0501045_0162409
801 nmdc:mga03n38_127055_c1
802 nmdc:mga00v17_128995_c1
803 nmdc:mga00v17_33519_c1
804 nmdc:mga0yw44_138077_c1
805 nmdc:mga0yw44_180378_c1
806 nmdc:mga0yw44_21477_c1
807 nmdc:mga0yw44_40546_c1
808 nmdc:mga0yw44_59711_c1
809 nmdc:mga0sz30_19925_c1
810 Ga0500635_0000039
811 Ga0500650_0002152
812 Ga0500556_0000062
813 Ga0500556_0001014
814 Ga0500562_000346
815 Ga0500562_087924
816 Ga0500593_000363
817 Ga0500655_001024
818 Ga0500559_0000496
819 Ga0500559_0001158
820 Ga0500559_0038610
821 Ga0500568_0000060
822 Ga0500568_0000075
823 Ga0500568_0000151
824 Ga0500568_0003966
825 Ga0500568_0019144
826 Ga0500573_0006182
827 Ga0500573_0031312
828 Ga0500573_0044916
829 Ga0500573_0065572
830 Ga0500573_0141644
831 Ga0500577_0030923
832 Ga0500588_0049157
833 Ga0500616_0000071
834 Ga0500616_0000781
835 Ga0500616_0001401
836 Ga0500616_0031943
837 Ga0501084_0190913
838 Ga0501082_0060608
839 Ga0501082_0378903
840 Ga0501082_0702187
841 Ga0466962_0026411
842 2588106557
843 2643735115
844 2643754217
845 2643769314
846 2643786765
847 2643849583
848 2643888732
849 2643996189
850 2644097007
851 2644113931
852 2644173277
853 2644183877
854 2644198567
855 2644681438
856 2655032029
857 2723642606
858 2730230124
859 2747953831
860 2753301417
861 2758224218
862 2774381506
863 2774399976
864 2808631560
865 2808885257
866 2808902577
867 2809227033
868 2812322654
869 2812365440
870 2821269576
871 2833710489
872 2844842821
873 2844854895
874 2852633581
875 2852649604
876 2852665569
877 2857720434
878 2857725071
879 2857735433
880 2862993284
881 2870623211
882 2870629917
883 2870804988
884 2884765797
885 2897564731
886 2904433362
887 2904503769
888 2904509808
889 2908675409
890 2908678976
891 2909077663
892 2919041992
893 2919045044
894 2919053200
895 2919059062
896 2919071324
897 2919395892
898 2919443184
899 2919524906
900 2928092479
901 2928108381
902 2928156902
903 2928501434
904 2935413231
905 2939657607
906 2945968311
907 2946025269
908 2946044771
909 2946084605
910 2966923897
911 2966927664
912 2974297833
913 2974325932
914 2977230880
915 2977239678
916 2977266108
917 2984546050
918 2984580747
919 2990089688
920 8003322291
921 8004185659
922 8004214504
923 8045831261
924 8056038835
925 8056061989
926 8057349542

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00977

His_biosynth

Histidine biosynthesis protein

27

255

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4x9s-assembly1.cif.gz_A crystal structure of hisap from streptomyces sp. mg1 0.9406 9 242
2vep-assembly1.cif.gz_A crystal structure of the full length bifunctional enzyme pria 0.9381 9 240
3zs4-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase with bound prfar 0.9359 9 242
1vzw-assembly1.cif.gz_A crystal structure of the bifunctional protein pria 0.9351 9 240
4tx9-assembly1.cif.gz_A crystal structure of hisap from streptomyces sviceus with degraded profar 0.9349 5 242
ID Description Score Start End Superfamily
4x2rA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9262 9 241 3.20.20.70
4x2rA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8891 9 241 3.20.20.70
af_P10371_1_245_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8872 11 239 3.20.20.70
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8765 10 242 3.20.20.70
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.859 10 242 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6N9YAZ4-F1-model_v4 deleted 0.971 77 240
AF-A0A2G7BRR1-F1-model_v4 deleted 0.969 78 240
AF-A0A7K0SNI1-F1-model_v4 Bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA (EC 5.3.1.16, EC 5.3.1.24) 0.9596 30 242 GO:0000105
GO:0000162
GO:0003949
GO:0004640
GO:0005737
AF-A0A6I2XYG1-F1-model_v4 Bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA (EC 5.3.1.16, EC 5.3.1.24) 0.9592 116 240 GO:0000105
GO:0000162
GO:0003949
GO:0004640
GO:0005737
AF-A0A3C1FHI2-F1-model_v4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) 0.9587 8 242 GO:0000105
GO:0000162
GO:0003949
GO:0004640
GO:0005737

Map