F449138
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 463 | 275 | 463 | 90 |
Family's Representative Sequence
| Representative Sequence | 3300035398|Ga0316574_0484409|Ga0316574_0484409_456_746 |
| Length | 96 |
| Sequence | VSSNVSQNYPYSSESEAARAAAVTAAFSANEGLQEKVEAESTPLGDVQPADHGAPVTWWIWVCHACIVGRLHVAGYARDRHAVYTVCDKCGQTSLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 2 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 148 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 152 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 153 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 155 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 156 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 157 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 159 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 160 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 161 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 162 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 163 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 164 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 165 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 166 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 167 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 168 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 169 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 170 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 171 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 173 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 174 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 175 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 176 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 177 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 178 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 179 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 180 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 181 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 182 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 183 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 184 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 185 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 186 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 187 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 223 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 224 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 225 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 228 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 229 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 230 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 231 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 253 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 257 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 273 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 274 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.22 |
| Nodule | 0 |
| Rhizoplane | 3.89 |
| Rhizosphere | 95.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10017991 | 3300002077 | Unclassified | 1402 |
| 2 | JGI24033J26618_1029978 | 3300002155 | Unclassified | 729 |
| 3 | JGI24034J26672_10100102 | 3300002239 | Bacteria | 546 |
| 4 | JGI25406J46586_10027042 | 3300003203 | Bacteria | 2205 |
| 5 | rootL2_10230045 | 3300003322 | Unclassified | 1112 |
| 6 | Ga0070676_10376871 | 3300005328 | Bacteria | 981 |
| 7 | Ga0070676_10600223 | 3300005328 | Unclassified | 794 |
| 8 | Ga0070683_100173427 | 3300005329 | Unclassified | 2047 |
| 9 | Ga0070683_100395975 | 3300005329 | Unclassified | 1317 |
| 10 | Ga0070690_100114866 | 3300005330 | Bacteria | 1801 |
| 11 | Ga0070670_100342454 | 3300005331 | Bacteria | 1313 |
| 12 | Ga0070677_10562541 | 3300005333 | Archaea | 626 |
| 13 | Ga0068869_101093839 | 3300005334 | Bacteria | 697 |
| 14 | Ga0070666_10800500 | 3300005335 | Bacteria | 694 |
| 15 | Ga0070680_100488093 | 3300005336 | Unclassified | 1053 |
| 16 | Ga0070682_100012609 | 3300005337 | Bacteria | 4849 |
| 17 | Ga0070682_100036972 | 3300005337 | Bacteria | 2987 |
| 18 | Ga0068868_100137613 | 3300005338 | Bacteria | 2003 |
| 19 | Ga0070660_100024235 | 3300005339 | Bacteria | 4502 |
| 20 | Ga0070689_100078025 | 3300005340 | Unclassified | 2596 |
| 21 | Ga0070687_100002534 | 3300005343 | Bacteria | 6882 |
| 22 | Ga0070661_100324372 | 3300005344 | Bacteria | 1203 |
| 23 | Ga0070692_10019368 | 3300005345 | Bacteria | 3284 |
| 24 | Ga0070668_100140729 | 3300005347 | Bacteria | 1944 |
| 25 | Ga0070668_100519510 | 3300005347 | Unclassified | 1033 |
| 26 | Ga0070669_100404151 | 3300005353 | Bacteria | 1118 |
| 27 | Ga0070675_100036549 | 3300005354 | Bacteria | 3998 |
| 28 | Ga0070674_100001461 | 3300005356 | Bacteria | 12594 |
| 29 | Ga0070674_100007430 | 3300005356 | Bacteria | 6463 |
| 30 | Ga0070673_100017805 | 3300005364 | Bacteria | 5063 |
| 31 | Ga0070673_101017675 | 3300005364 | Bacteria | 772 |
| 32 | Ga0070688_100088312 | 3300005365 | Bacteria | 2021 |
| 33 | Ga0070659_100215447 | 3300005366 | Unclassified | 1583 |
| 34 | Ga0070713_100978467 | 3300005436 | Bacteria | 816 |
| 35 | Ga0070713_102129272 | 3300005436 | Unclassified | 544 |
| 36 | Ga0070701_10079006 | 3300005438 | Unclassified | 1777 |
| 37 | Ga0070705_100433431 | 3300005440 | Unclassified | 982 |
| 38 | Ga0070705_100616986 | 3300005440 | Bacteria | 841 |
| 39 | Ga0070705_101579021 | 3300005440 | Bacteria | 552 |
| 40 | Ga0070700_100064761 | 3300005441 | Bacteria | 2315 |
| 41 | Ga0070700_100115488 | 3300005441 | Unclassified | 1791 |
| 42 | Ga0070700_100146689 | 3300005441 | Bacteria | 1609 |
| 43 | Ga0070694_100058793 | 3300005444 | Bacteria | 2616 |
| 44 | Ga0070694_100694550 | 3300005444 | Bacteria | 827 |
| 45 | Ga0070694_101304007 | 3300005444 | Unclassified | 611 |
| 46 | Ga0070694_101583979 | 3300005444 | Unclassified | 555 |
| 47 | Ga0070708_100021184 | 3300005445 | Bacteria | 5493 |
| 48 | Ga0070708_100021271 | 3300005445 | Bacteria | 5483 |
| 49 | Ga0070708_100025853 | 3300005445 | Bacteria | 5020 |
| 50 | Ga0070708_100326255 | 3300005445 | Bacteria | 1446 |
| 51 | Ga0070663_100106348 | 3300005455 | Bacteria | 2102 |
| 52 | Ga0070663_100986261 | 3300005455 | Bacteria | 732 |
| 53 | Ga0070678_100070393 | 3300005456 | Bacteria | 2615 |
| 54 | Ga0070678_100614454 | 3300005456 | Bacteria | 972 |
| 55 | Ga0070662_100123376 | 3300005457 | Bacteria | 1988 |
| 56 | Ga0070681_11411413 | 3300005458 | Bacteria | 620 |
| 57 | Ga0068867_100011299 | 3300005459 | Bacteria | 6299 |
| 58 | Ga0068867_100104691 | 3300005459 | Bacteria | 2166 |
| 59 | Ga0068867_100160936 | 3300005459 | Bacteria | 1770 |
| 60 | Ga0068867_100619474 | 3300005459 | Unclassified | 946 |
| 61 | Ga0068867_101538248 | 3300005459 | Unclassified | 620 |
| 62 | Ga0070685_10012464 | 3300005466 | Bacteria | 4467 |
| 63 | Ga0070685_10356086 | 3300005466 | Unclassified | 1002 |
| 64 | Ga0070706_100050898 | 3300005467 | Bacteria | 3822 |
| 65 | Ga0070706_100607812 | 3300005467 | Unclassified | 1016 |
| 66 | Ga0070706_100640497 | 3300005467 | Archaea | 987 |
| 67 | Ga0070706_100822885 | 3300005467 | Unclassified | 859 |
| 68 | Ga0070707_100001009 | 3300005468 | Bacteria | 27892 |
| 69 | Ga0070707_100026690 | 3300005468 | Bacteria | 5486 |
| 70 | Ga0070707_100036581 | 3300005468 | Bacteria | 4684 |
| 71 | Ga0070707_100795352 | 3300005468 | Unclassified | 909 |
| 72 | Ga0070698_100151294 | 3300005471 | Bacteria | 2268 |
| 73 | Ga0070699_100028561 | 3300005518 | Archaea | 4810 |
| 74 | Ga0070699_100032705 | 3300005518 | Bacteria | 4492 |
| 75 | Ga0070699_100063885 | 3300005518 | Bacteria | 3192 |
| 76 | Ga0070699_100942395 | 3300005518 | Unclassified | 791 |
| 77 | Ga0070679_100820248 | 3300005530 | Bacteria | 873 |
| 78 | Ga0070684_100035666 | 3300005535 | Bacteria | 4258 |
| 79 | Ga0070684_100381444 | 3300005535 | Unclassified | 1298 |
| 80 | Ga0070697_100021612 | 3300005536 | Bacteria | 5100 |
| 81 | Ga0070697_100561774 | 3300005536 | Unclassified | 1001 |
| 82 | Ga0070697_101047462 | 3300005536 | Bacteria | 726 |
| 83 | Ga0068853_100972563 | 3300005539 | Bacteria | 817 |
| 84 | Ga0070672_102061216 | 3300005543 | Bacteria | 514 |
| 85 | Ga0070686_100007488 | 3300005544 | Bacteria | 6092 |
| 86 | Ga0070695_100021965 | 3300005545 | Bacteria | 3910 |
| 87 | Ga0070695_100023249 | 3300005545 | Bacteria | 3807 |
| 88 | Ga0070695_100222412 | 3300005545 | Bacteria | 1361 |
| 89 | Ga0070695_100669695 | 3300005545 | Unclassified | 821 |
| 90 | Ga0070696_100063003 | 3300005546 | Bacteria | 2597 |
| 91 | Ga0070696_100340970 | 3300005546 | Unclassified | 1158 |
| 92 | Ga0070693_100039445 | 3300005547 | Bacteria | 2645 |
| 93 | Ga0070693_101119777 | 3300005547 | Bacteria | 601 |
| 94 | Ga0070704_100052164 | 3300005549 | Bacteria | 2884 |
| 95 | Ga0070704_100056808 | 3300005549 | Bacteria | 2780 |
| 96 | Ga0070704_100262294 | 3300005549 | Unclassified | 1424 |
| 97 | Ga0070664_100291888 | 3300005564 | Bacteria | 1472 |
| 98 | Ga0068857_100137377 | 3300005577 | Unclassified | 2207 |
| 99 | Ga0068854_100007542 | 3300005578 | Bacteria | 6952 |
| 100 | Ga0068854_101985439 | 3300005578 | Bacteria | 536 |
| 101 | Ga0070702_100002645 | 3300005615 | Bacteria | 7810 |
| 102 | Ga0070702_100754558 | 3300005615 | Unclassified | 748 |
| 103 | Ga0068852_100157380 | 3300005616 | Bacteria | 2118 |
| 104 | Ga0068859_100172981 | 3300005617 | Unclassified | 2241 |
| 105 | Ga0068859_100419157 | 3300005617 | Bacteria | 1435 |
| 106 | Ga0068864_100014152 | 3300005618 | Bacteria | 6621 |
| 107 | Ga0068866_10011362 | 3300005718 | Bacteria | 3850 |
| 108 | Ga0068861_100119568 | 3300005719 | Unclassified | 2123 |
| 109 | Ga0068861_100415824 | 3300005719 | Bacteria | 1197 |
| 110 | Ga0068851_10552038 | 3300005834 | Unclassified | 696 |
| 111 | Ga0068870_10229625 | 3300005840 | Bacteria | 1140 |
| 112 | Ga0068870_10706283 | 3300005840 | Unclassified | 696 |
| 113 | Ga0068863_100743416 | 3300005841 | Unclassified | 976 |
| 114 | Ga0068858_100268694 | 3300005842 | Bacteria | 1622 |
| 115 | Ga0068860_100073876 | 3300005843 | Bacteria | 3241 |
| 116 | Ga0068860_101758946 | 3300005843 | Unclassified | 642 |
| 117 | Ga0068862_100321359 | 3300005844 | Unclassified | 1429 |
| 118 | Ga0081539_10003460 | 3300005985 | Bacteria | 19336 |
| 119 | Ga0075365_10066178 | 3300006038 | Bacteria | 2424 |
| 120 | Ga0075432_10287323 | 3300006058 | Bacteria | 679 |
| 121 | Ga0075428_100898310 | 3300006844 | Bacteria | 940 |
| 122 | Ga0075431_100406993 | 3300006847 | Bacteria | 1361 |
| 123 | Ga0075431_101171791 | 3300006847 | Bacteria | 732 |
| 124 | Ga0075433_10008221 | 3300006852 | Bacteria | 8313 |
| 125 | Ga0075433_10413449 | 3300006852 | Bacteria | 1190 |
| 126 | Ga0075433_10505540 | 3300006852 | Bacteria | 1063 |
| 127 | Ga0075434_100529599 | 3300006871 | Bacteria | 1199 |
| 128 | Ga0075434_101692566 | 3300006871 | Unclassified | 640 |
| 129 | Ga0068865_100003323 | 3300006881 | Bacteria | 9635 |
| 130 | Ga0075436_100359650 | 3300006914 | Bacteria | 1050 |
| 131 | Ga0097620_100172996 | 3300006931 | Unclassified | 2241 |
| 132 | Ga0097620_100419108 | 3300006931 | Bacteria | 1435 |
| 133 | Ga0075435_100275175 | 3300007076 | Unclassified | 1437 |
| 134 | Ga0075435_100719912 | 3300007076 | Bacteria | 868 |
| 135 | Ga0105251_10274053 | 3300009011 | Unclassified | 762 |
| 136 | Ga0105244_10094482 | 3300009036 | Bacteria | 1468 |
| 137 | Ga0111539_10020328 | 3300009094 | Bacteria | 8178 |
| 138 | Ga0111539_10117766 | 3300009094 | Bacteria | 3113 |
| 139 | Ga0111539_10913438 | 3300009094 | Unclassified | 1021 |
| 140 | Ga0105245_10026836 | 3300009098 | Bacteria | 5071 |
| 141 | Ga0105245_10733264 | 3300009098 | Unclassified | 1023 |
| 142 | Ga0105247_10398576 | 3300009101 | Bacteria | 980 |
| 143 | Ga0114129_10446219 | 3300009147 | Bacteria | 1697 |
| 144 | Ga0114129_10979224 | 3300009147 | Bacteria | 1066 |
| 145 | Ga0105243_10073588 | 3300009148 | Bacteria | 2769 |
| 146 | Ga0105243_10901361 | 3300009148 | Unclassified | 880 |
| 147 | Ga0105243_11354425 | 3300009148 | Bacteria | 731 |
| 148 | Ga0105242_10019629 | 3300009176 | Bacteria | 5298 |
| 149 | Ga0105242_10540592 | 3300009176 | Bacteria | 1115 |
| 150 | Ga0105242_11870444 | 3300009176 | Unclassified | 640 |
| 151 | Ga0105248_10337716 | 3300009177 | Unclassified | 1696 |
| 152 | Ga0105248_11826080 | 3300009177 | Bacteria | 689 |
| 153 | Ga0105237_10303552 | 3300009545 | Bacteria | 1599 |
| 154 | Ga0105238_10835521 | 3300009551 | Bacteria | 938 |
| 155 | Ga0105249_10011568 | 3300009553 | Bacteria | 7754 |
| 156 | Ga0105249_10577604 | 3300009553 | Unclassified | 1177 |
| 157 | Ga0105249_10895749 | 3300009553 | Unclassified | 954 |
| 158 | Ga0099796_10332410 | 3300010159 | Unclassified | 651 |
| 159 | Ga0099796_10574615 | 3300010159 | Unclassified | 507 |
| 160 | Ga0105239_10036633 | 3300010375 | Bacteria | 5385 |
| 161 | Ga0105246_10176212 | 3300011119 | Bacteria | 1642 |
| 162 | Ga0105246_12447808 | 3300011119 | Unclassified | 513 |
| 163 | Ga0157378_10021356 | 3300013297 | Bacteria | 5692 |
| 164 | Ga0163162_10933670 | 3300013306 | Bacteria | 979 |
| 165 | Ga0163162_12024273 | 3300013306 | Unclassified | 660 |
| 166 | Ga0157372_13366306 | 3300013307 | Bacteria | 509 |
| 167 | Ga0157375_10008137 | 3300013308 | Bacteria | 9175 |
| 168 | Ga0157375_10898729 | 3300013308 | Bacteria | 1030 |
| 169 | Ga0163163_10018899 | 3300014325 | Bacteria | 6465 |
| 170 | Ga0163163_10477786 | 3300014325 | Unclassified | 1307 |
| 171 | Ga0163163_10805815 | 3300014325 | Unclassified | 1003 |
| 172 | Ga0157380_10016123 | 3300014326 | Bacteria | 5504 |
| 173 | Ga0157380_10182771 | 3300014326 | Bacteria | 1844 |
| 174 | Ga0157377_10001871 | 3300014745 | Bacteria | 9216 |
| 175 | Ga0157379_10059263 | 3300014968 | Bacteria | 3423 |
| 176 | Ga0157376_10958911 | 3300014969 | Unclassified | 876 |
| 177 | Ga0207697_10104681 | 3300025315 | Bacteria | 1209 |
| 178 | Ga0207642_10060743 | 3300025899 | Unclassified | 1754 |
| 179 | Ga0207710_10320223 | 3300025900 | Bacteria | 786 |
| 180 | Ga0207688_10242661 | 3300025901 | Unclassified | 1090 |
| 181 | Ga0207645_10266169 | 3300025907 | Unclassified | 1136 |
| 182 | Ga0207645_10681526 | 3300025907 | Bacteria | 698 |
| 183 | Ga0207643_10004561 | 3300025908 | Bacteria | 7443 |
| 184 | Ga0207684_10022072 | 3300025910 | Bacteria | 5436 |
| 185 | Ga0207684_10403686 | 3300025910 | Archaea | 1175 |
| 186 | Ga0207660_10439840 | 3300025917 | Unclassified | 1054 |
| 187 | Ga0207662_10012310 | 3300025918 | Bacteria | 4761 |
| 188 | Ga0207657_10023977 | 3300025919 | Bacteria | 5665 |
| 189 | Ga0207657_11221383 | 3300025919 | Unclassified | 571 |
| 190 | Ga0207649_10524376 | 3300025920 | Bacteria | 903 |
| 191 | Ga0207646_10002036 | 3300025922 | Bacteria | 24288 |
| 192 | Ga0207646_10012048 | 3300025922 | Bacteria | 8327 |
| 193 | Ga0207646_10016705 | 3300025922 | Bacteria | 6884 |
| 194 | Ga0207646_11734832 | 3300025922 | Unclassified | 536 |
| 195 | Ga0207681_10024491 | 3300025923 | Bacteria | 3875 |
| 196 | Ga0207694_10077664 | 3300025924 | Bacteria | 2602 |
| 197 | Ga0207650_10062714 | 3300025925 | Bacteria | 2778 |
| 198 | Ga0207659_10399537 | 3300025926 | Bacteria | 1149 |
| 199 | Ga0207687_10901767 | 3300025927 | Unclassified | 756 |
| 200 | Ga0207706_10035925 | 3300025933 | Bacteria | 4403 |
| 201 | Ga0207686_10016970 | 3300025934 | Bacteria | 4093 |
| 202 | Ga0207709_10016662 | 3300025935 | Bacteria | 4090 |
| 203 | Ga0207709_10679351 | 3300025935 | Unclassified | 822 |
| 204 | Ga0207709_11272139 | 3300025935 | Unclassified | 607 |
| 205 | Ga0207670_10656674 | 3300025936 | Bacteria | 865 |
| 206 | Ga0207669_10030336 | 3300025937 | Bacteria | 3004 |
| 207 | Ga0207669_10033555 | 3300025937 | Unclassified | 2898 |
| 208 | Ga0207669_10168542 | 3300025937 | Unclassified | 1556 |
| 209 | Ga0207704_10267625 | 3300025938 | Bacteria | 1292 |
| 210 | Ga0207691_11687880 | 3300025940 | Unclassified | 513 |
| 211 | Ga0207661_11164649 | 3300025944 | Unclassified | 710 |
| 212 | Ga0207661_11711926 | 3300025944 | Unclassified | 574 |
| 213 | Ga0207679_10023805 | 3300025945 | Bacteria | 4192 |
| 214 | Ga0207651_10651955 | 3300025960 | Bacteria | 924 |
| 215 | Ga0207712_10615472 | 3300025961 | Unclassified | 941 |
| 216 | Ga0207668_10394879 | 3300025972 | Bacteria | 1168 |
| 217 | Ga0207668_10601775 | 3300025972 | Unclassified | 958 |
| 218 | Ga0207640_10018979 | 3300025981 | Bacteria | 4052 |
| 219 | Ga0207640_10875684 | 3300025981 | Bacteria | 783 |
| 220 | Ga0207677_10545879 | 3300026023 | Unclassified | 1009 |
| 221 | Ga0207703_10028330 | 3300026035 | Bacteria | 4415 |
| 222 | Ga0207639_11070336 | 3300026041 | Bacteria | 756 |
| 223 | Ga0207678_10021470 | 3300026067 | Bacteria | 5661 |
| 224 | Ga0207708_10003005 | 3300026075 | Bacteria | 12424 |
| 225 | Ga0207708_10058992 | 3300026075 | Bacteria | 2928 |
| 226 | Ga0207708_10092031 | 3300026075 | Bacteria | 2339 |
| 227 | Ga0207641_10595179 | 3300026088 | Unclassified | 1082 |
| 228 | Ga0207648_10003422 | 3300026089 | Bacteria | 16653 |
| 229 | Ga0207648_10227771 | 3300026089 | Bacteria | 1658 |
| 230 | Ga0207648_10303772 | 3300026089 | Bacteria | 1431 |
| 231 | Ga0207676_10243515 | 3300026095 | Unclassified | 1615 |
| 232 | Ga0207676_10341602 | 3300026095 | Unclassified | 1381 |
| 233 | Ga0207674_10009525 | 3300026116 | Bacteria | 11085 |
| 234 | Ga0207675_100038773 | 3300026118 | Bacteria | 4446 |
| 235 | Ga0207683_10015985 | 3300026121 | Bacteria | 6386 |
| 236 | Ga0207683_10393981 | 3300026121 | Bacteria | 1274 |
| 237 | Ga0207683_11026919 | 3300026121 | Bacteria | 765 |
| 238 | Ga0207698_10226283 | 3300026142 | Bacteria | 1694 |
| 239 | Ga0209998_10025011 | 3300027717 | Bacteria | 1299 |
| 240 | Ga0207428_10272781 | 3300027907 | Unclassified | 1257 |
| 241 | Ga0268266_10387225 | 3300028379 | Bacteria | 1320 |
| 242 | Ga0268265_10464531 | 3300028380 | Bacteria | 1185 |
| 243 | Ga0268264_10092179 | 3300028381 | Unclassified | 2615 |
| 244 | Ga0268264_12011677 | 3300028381 | Unclassified | 587 |
| 245 | Ga0265337_1010279 | 3300028556 | Unclassified | 3286 |
| 246 | Ga0316576_10032170 | 3300031727 | Bacteria | 3727 |
| 247 | Ga0307405_10055016 | 3300031731 | Bacteria | 2488 |
| 248 | Ga0307405_10170464 | 3300031731 | Bacteria | 1552 |
| 249 | Ga0307410_10170401 | 3300031852 | Bacteria | 1640 |
| 250 | Ga0307410_10178821 | 3300031852 | Unclassified | 1604 |
| 251 | Ga0307406_10169796 | 3300031901 | Unclassified | 1577 |
| 252 | Ga0307406_10563964 | 3300031901 | Unclassified | 933 |
| 253 | Ga0307407_10430220 | 3300031903 | Unclassified | 953 |
| 254 | Ga0307412_10199536 | 3300031911 | Unclassified | 1518 |
| 255 | Ga0307412_11579590 | 3300031911 | Unclassified | 598 |
| 256 | Ga0307409_100030286 | 3300031995 | Bacteria | 3886 |
| 257 | Ga0307409_100325000 | 3300031995 | Bacteria | 1441 |
| 258 | Ga0307416_100002960 | 3300032002 | Bacteria | 9902 |
| 259 | Ga0307416_101386972 | 3300032002 | Viruses | 808 |
| 260 | Ga0307415_100009017 | 3300032126 | Bacteria | 5564 |
| 261 | Ga0307415_101144535 | 3300032126 | Unclassified | 730 |
| 262 | Ga0373950_0046322 | 3300034818 | Bacteria | 844 |
| 263 | Ga0373959_0039341 | 3300034820 | Unclassified | 986 |
| 264 | Ga0373928_0129327 | 3300035084 | Bacteria | 683 |
| 265 | Ga0373929_0084312 | 3300035085 | Unclassified | 779 |
| 266 | Ga0373941_0244853 | 3300035115 | Bacteria | 698 |
| 267 | Ga0373943_0635320 | 3300035170 | Bacteria | 630 |
| 268 | Ga0373962_0057454 | 3300035242 | Unclassified | 1135 |
| 269 | Ga0316574_0484409 | 3300035398 | Bacteria | 773 |
| 270 | Ga0373931_0227053 | 3300035691 | Unclassified | 1126 |
| 271 | Ga0373935_1485995 | 3300035692 | Unclassified | 507 |
| 272 | Ga0373937_1608042 | 3300036401 | Bacteria | 597 |
| 273 | Ga0395899_0837354 | 3300037312 | Unclassified | 566 |
| 274 | Ga0395905_1624125 | 3300037471 | Unclassified | 551 |
| 275 | Ga0395901_0202427 | 3300038443 | Unclassified | 2081 |
| 276 | Ga0395901_0564705 | 3300038443 | Unclassified | 1152 |
| 277 | Ga0395901_1611586 | 3300038443 | Unclassified | 602 |
| 278 | Ga0451841_1258803 | 3300041498 | Bacteria | 540 |
| 279 | Ga0439441_023056 | 3300042001 | Bacteria | 1161 |
| 280 | Ga0439448_0233382 | 3300042005 | Bacteria | 648 |
| 281 | Ga0450905_091397 | 3300042142 | Unclassified | 538 |
| 282 | Ga0450910_013640 | 3300042147 | Bacteria | 1184 |
| 283 | Ga0439458_0069317 | 3300042157 | Bacteria | 889 |
| 284 | Ga0439459_0119647 | 3300042438 | Unclassified | 663 |
| 285 | Ga0439440_0141668 | 3300042993 | Unclassified | 683 |
| 286 | Ga0466972_0141854 | 3300044658 | Unclassified | 1131 |
| 287 | Ga0466968_0073517 | 3300044735 | Bacteria | 1492 |
| 288 | Ga0466960_0402086 | 3300044901 | Unclassified | 789 |
| 289 | Ga0451576_2630143 | 3300045051 | Unclassified | 513 |
| 290 | Ga0495641_0081293 | 3300046461 | Bacteria | 1451 |
| 291 | Ga0495651_0019074 | 3300046462 | Bacteria | 5315 |
| 292 | Ga0495653_0160494 | 3300046463 | Bacteria | 1561 |
| 293 | Ga0495639_0633335 | 3300046475 | Bacteria | 551 |
| 294 | Ga0495662_0083556 | 3300046476 | Bacteria | 1554 |
| 295 | Ga0495664_0192132 | 3300046477 | Bacteria | 1237 |
| 296 | Ga0495596_0400014 | 3300046500 | Unclassified | 535 |
| 297 | Ga0495608_0512855 | 3300046511 | Unclassified | 725 |
| 298 | Ga0495618_0156439 | 3300046514 | Bacteria | 1455 |
| 299 | Ga0495628_0094295 | 3300046516 | Bacteria | 2314 |
| 300 | Ga0495628_0566542 | 3300046516 | Bacteria | 814 |
| 301 | Ga0495630_0345100 | 3300046517 | Bacteria | 1139 |
| 302 | Ga0495630_1330737 | 3300046517 | Unclassified | 541 |
| 303 | Ga0495637_0361299 | 3300046520 | Archaea | 508 |
| 304 | Ga0495640_0027776 | 3300046533 | Bacteria | 4078 |
| 305 | Ga0495587_0265827 | 3300046536 | Unclassified | 963 |
| 306 | Ga0495609_0409999 | 3300046538 | Archaea | 542 |
| 307 | Ga0495621_0536677 | 3300046539 | Unclassified | 507 |
| 308 | Ga0495633_0564965 | 3300046558 | Unclassified | 512 |
| 309 | Ga0495667_0674549 | 3300046559 | Archaea | 641 |
| 310 | Ga0495667_0705064 | 3300046559 | Unclassified | 625 |
| 311 | Ga0495635_0249373 | 3300046663 | Bacteria | 1197 |
| 312 | Ga0495659_0144497 | 3300046664 | Unclassified | 952 |
| 313 | Ga0495657_0174349 | 3300046675 | Bacteria | 1323 |
| 314 | Ga0495657_0362362 | 3300046675 | Bacteria | 857 |
| 315 | Ga0495657_0733689 | 3300046675 | Unclassified | 567 |
| 316 | Ga0495599_0590593 | 3300046678 | Bacteria | 647 |
| 317 | Ga0495623_0161615 | 3300046679 | Unclassified | 1316 |
| 318 | Ga0495613_0357524 | 3300046689 | Bacteria | 1002 |
| 319 | Ga0495624_0202939 | 3300046690 | Bacteria | 1204 |
| 320 | Ga0495670_0572218 | 3300046691 | Unclassified | 615 |
| 321 | Ga0495600_0172165 | 3300046809 | Bacteria | 1397 |
| 322 | Ga0495604_0224544 | 3300047317 | Bacteria | 1291 |
| 323 | Ga0495674_0376955 | 3300047319 | Bacteria | 1148 |
| 324 | Ga0495674_0488743 | 3300047319 | Archaea | 986 |
| 325 | Ga0495680_0102568 | 3300047322 | Bacteria | 2130 |
| 326 | Ga0495684_0141457 | 3300047471 | Bacteria | 1804 |
| 327 | Ga0495593_0205231 | 3300047673 | Bacteria | 990 |
| 328 | Ga0495602_0246172 | 3300048088 | Bacteria | 1335 |
| 329 | Ga0496100_0705906 | 3300048903 | Bacteria | 787 |
| 330 | Ga0496101_0068185 | 3300048904 | Unclassified | 2600 |
| 331 | Ga0496101_0148286 | 3300048904 | Bacteria | 1793 |
| 332 | Ga0496102_0104013 | 3300048905 | Bacteria | 2641 |
| 333 | Ga0496102_0116152 | 3300048905 | Bacteria | 2497 |
| 334 | Ga0496102_0244132 | 3300048905 | Bacteria | 1693 |
| 335 | Ga0496102_1062333 | 3300048905 | Bacteria | 730 |
| 336 | Ga0496103_0214486 | 3300048906 | Bacteria | 1238 |
| 337 | Ga0496106_0117047 | 3300048909 | Bacteria | 2079 |
| 338 | Ga0496106_0919368 | 3300048909 | Bacteria | 690 |
| 339 | Ga0496108_0139343 | 3300048911 | Unclassified | 2089 |
| 340 | Ga0496109_0117680 | 3300048912 | Unclassified | 2474 |
| 341 | Ga0496109_1000808 | 3300048912 | Bacteria | 773 |
| 342 | Ga0496111_0129419 | 3300048914 | Bacteria | 1867 |
| 343 | Ga0496112_0075314 | 3300048915 | Unclassified | 3338 |
| 344 | Ga0496112_1883124 | 3300048915 | Bacteria | 510 |
| 345 | Ga0496113_0042521 | 3300048916 | Bacteria | 3359 |
| 346 | Ga0496114_0721933 | 3300048917 | Bacteria | 873 |
| 347 | Ga0501031_0151233 | 3300049568 | Unclassified | 1517 |
| 348 | Ga0501031_0235193 | 3300049568 | Bacteria | 1192 |
| 349 | Ga0501032_0412654 | 3300049569 | Bacteria | 867 |
| 350 | Ga0501036_0020106 | 3300049572 | Bacteria | 5606 |
| 351 | Ga0501037_0449708 | 3300049573 | Unclassified | 879 |
| 352 | Ga0501037_0615889 | 3300049573 | Bacteria | 728 |
| 353 | Ga0501037_0629348 | 3300049573 | Unclassified | 719 |
| 354 | Ga0501037_0720238 | 3300049573 | Bacteria | 663 |
| 355 | Ga0501038_0435746 | 3300049574 | Unclassified | 1010 |
| 356 | Ga0501038_0735699 | 3300049574 | Bacteria | 737 |
| 357 | Ga0501039_0063103 | 3300049575 | Bacteria | 2871 |
| 358 | Ga0501039_0140789 | 3300049575 | Bacteria | 1895 |
| 359 | Ga0501039_0996963 | 3300049575 | Bacteria | 651 |
| 360 | Ga0501040_0008058 | 3300049576 | Bacteria | 6843 |
| 361 | Ga0501040_0452559 | 3300049576 | Bacteria | 924 |
| 362 | Ga0501040_0533984 | 3300049576 | Unclassified | 846 |
| 363 | Ga0501040_0661459 | 3300049576 | Bacteria | 755 |
| 364 | Ga0501040_0899616 | 3300049576 | Bacteria | 641 |
| 365 | Ga0501041_0251402 | 3300049577 | Bacteria | 1111 |
| 366 | Ga0501041_0511217 | 3300049577 | Bacteria | 764 |
| 367 | Ga0501041_0667304 | 3300049577 | Unclassified | 665 |
| 368 | Ga0501042_0461868 | 3300049578 | Bacteria | 921 |
| 369 | Ga0501042_1338060 | 3300049578 | Bacteria | 522 |
| 370 | Ga0501042_1423607 | 3300049578 | Bacteria | 506 |
| 371 | Ga0501043_1097860 | 3300049579 | Bacteria | 562 |
| 372 | Ga0501046_0344387 | 3300049580 | Bacteria | 1083 |
| 373 | Ga0501046_1148961 | 3300049580 | Unclassified | 535 |
| 374 | Ga0501048_0150187 | 3300049582 | Bacteria | 1648 |
| 375 | Ga0501048_0397226 | 3300049582 | Bacteria | 985 |
| 376 | Ga0501048_0640137 | 3300049582 | Bacteria | 763 |
| 377 | Ga0501048_0693586 | 3300049582 | Unclassified | 731 |
| 378 | Ga0501048_0869490 | 3300049582 | Unclassified | 648 |
| 379 | Ga0501068_0401656 | 3300049584 | Bacteria | 884 |
| 380 | Ga0501068_0419878 | 3300049584 | Unclassified | 864 |
| 381 | Ga0501069_0048314 | 3300049585 | Unclassified | 2363 |
| 382 | Ga0501071_0160917 | 3300049587 | Bacteria | 1678 |
| 383 | Ga0501071_0452814 | 3300049587 | Bacteria | 982 |
| 384 | Ga0501071_0568508 | 3300049587 | Archaea | 871 |
| 385 | Ga0501072_0039219 | 3300049588 | Bacteria | 3719 |
| 386 | Ga0501072_0175200 | 3300049588 | Bacteria | 1711 |
| 387 | Ga0501072_0477579 | 3300049588 | Unclassified | 986 |
| 388 | Ga0501072_0615837 | 3300049588 | Unclassified | 855 |
| 389 | Ga0501073_0643487 | 3300049589 | Bacteria | 732 |
| 390 | Ga0501074_1126309 | 3300049590 | Viruses | 551 |
| 391 | Ga0501074_1314408 | 3300049590 | Bacteria | 507 |
| 392 | Ga0501075_0121984 | 3300049591 | Unclassified | 1984 |
| 393 | Ga0501075_0397648 | 3300049591 | Unclassified | 1050 |
| 394 | Ga0501075_0454804 | 3300049591 | Bacteria | 976 |
| 395 | Ga0501075_0546499 | 3300049591 | Bacteria | 884 |
| 396 | Ga0501075_1110678 | 3300049591 | Bacteria | 600 |
| 397 | Ga0501076_0020659 | 3300049592 | Bacteria | 5042 |
| 398 | Ga0501076_0153112 | 3300049592 | Bacteria | 1876 |
| 399 | Ga0501076_0156324 | 3300049592 | Bacteria | 1856 |
| 400 | Ga0501076_0466284 | 3300049592 | Bacteria | 1040 |
| 401 | Ga0501076_1084512 | 3300049592 | Bacteria | 659 |
| 402 | Ga0501076_1520891 | 3300049592 | Bacteria | 549 |
| 403 | Ga0501077_0358004 | 3300049593 | Bacteria | 932 |
| 404 | Ga0501077_1149267 | 3300049593 | Bacteria | 500 |
| 405 | Ga0501202_057959 | 3300049652 | Unclassified | 870 |
| 406 | Ga0501079_0077688 | 3300049741 | Bacteria | 2568 |
| 407 | Ga0501079_0139611 | 3300049741 | Bacteria | 1887 |
| 408 | Ga0501079_0352880 | 3300049741 | Bacteria | 1152 |
| 409 | Ga0501079_0387821 | 3300049741 | Bacteria | 1095 |
| 410 | Ga0501080_0211407 | 3300049742 | Unclassified | 1778 |
| 411 | Ga0501080_0232990 | 3300049742 | Bacteria | 1683 |
| 412 | Ga0501080_0821576 | 3300049742 | Unclassified | 814 |
| 413 | Ga0501080_1208029 | 3300049742 | Bacteria | 650 |
| 414 | Ga0501081_0036584 | 3300049743 | Bacteria | 3348 |
| 415 | Ga0501081_0119321 | 3300049743 | Bacteria | 1877 |
| 416 | Ga0501081_0295357 | 3300049743 | Unclassified | 1188 |
| 417 | Ga0501081_0347512 | 3300049743 | Bacteria | 1093 |
| 418 | Ga0501081_0371529 | 3300049743 | Unclassified | 1056 |
| 419 | Ga0501081_0502870 | 3300049743 | Bacteria | 903 |
| 420 | Ga0501270_069460 | 3300049767 | Viruses | 678 |
| 421 | Ga0501035_1097250 | 3300049822 | Unclassified | 622 |
| 422 | Ga0501044_1336677 | 3300049823 | Bacteria | 583 |
| 423 | Ga0501044_1628064 | 3300049823 | Unclassified | 511 |
| 424 | Ga0501045_0026214 | 3300049824 | Bacteria | 4191 |
| 425 | Ga0501045_0212114 | 3300049824 | Unclassified | 1442 |
| 426 | Ga0501045_0288839 | 3300049824 | Unclassified | 1220 |
| 427 | Ga0501045_0642537 | 3300049824 | Bacteria | 784 |
| 428 | nmdc:mga05p37_221260_c1 | 3300050507 | Bacteria | 2284 |
| 429 | nmdc:mga05p37_893748_c1 | 3300050507 | Bacteria | 959 |
| 430 | nmdc:mga06r32_395639_c1 | 3300050510 | Bacteria | 1364 |
| 431 | nmdc:mga08y16_190706_c1 | 3300050511 | Bacteria | 2126 |
| 432 | nmdc:mga08y16_239947_c1 | 3300050511 | Bacteria | 1874 |
| 433 | nmdc:mga08y16_980943_c1 | 3300050511 | Unclassified | 826 |
| 434 | nmdc:mga0n895_51529_c1 | 3300050512 | Unclassified | 4038 |
| 435 | nmdc:mga0rr50_116696_c1 | 3300050513 | Unclassified | 2119 |
| 436 | nmdc:mga0rr50_242902_c1 | 3300050513 | Unclassified | 1493 |
| 437 | nmdc:mga0rr50_931374_c1 | 3300050513 | Bacteria | 741 |
| 438 | nmdc:mga08x19_148064_c1 | 3300050514 | Bacteria | 1588 |
| 439 | nmdc:mga0a205_425056_c1 | 3300050515 | Bacteria | 1190 |
| 440 | nmdc:mga0a205_79891_c1 | 3300050515 | Bacteria | 3161 |
| 441 | nmdc:mga0a205_812978_c1 | 3300050515 | Bacteria | 782 |
| 442 | Ga0495601_0017799 | 3300053077 | Bacteria | 4317 |
| 443 | Ga0495612_0000038 | 3300053078 | Bacteria | 63146 |
| 444 | Ga0495612_0083122 | 3300053078 | Bacteria | 1347 |
| 445 | Ga0495595_0045150 | 3300053084 | Bacteria | 2026 |
| 446 | Ga0495595_0173556 | 3300053084 | Bacteria | 1068 |
| 447 | Ga0495619_0162759 | 3300053085 | Bacteria | 1541 |
| 448 | Ga0501084_0020040 | 3300054114 | Bacteria | 5576 |
| 449 | Ga0501084_0081838 | 3300054114 | Unclassified | 2709 |
| 450 | Ga0501084_0090840 | 3300054114 | Bacteria | 2564 |
| 451 | Ga0501084_0290605 | 3300054114 | Unclassified | 1381 |
| 452 | Ga0501084_0307554 | 3300054114 | Bacteria | 1339 |
| 453 | Ga0501084_0872842 | 3300054114 | Unclassified | 757 |
| 454 | Ga0590074_009669 | 3300059423 | Bacteria | 1607 |
| 455 | Ga0590075_010118 | 3300059424 | Bacteria | 2268 |
| 456 | Ga0501082_0080617 | 3300060353 | Bacteria | 2809 |
| 457 | Ga0501082_0652425 | 3300060353 | Bacteria | 921 |
| 458 | Ga0501082_0655699 | 3300060353 | Bacteria | 918 |
| 459 | Ga0501082_0902750 | 3300060353 | Unclassified | 773 |
| 460 | Ga0530510_0015123 | 3300061734 | Bacteria | 5450 |
| 461 | Ga0530510_0049143 | 3300061734 | Bacteria | 3048 |
| 462 | Ga0530510_0080057 | 3300061734 | Bacteria | 2377 |
| 463 | Ga0530510_1086134 | 3300061734 | Bacteria | 613 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042147 | Ga0450910_013640 | Ga0450910_013640_224_532 | 77 |
| 2 | 3300031727 | Ga0316576_10032170 | Ga0316576_100321703 | 87 |
| 3 | 3300035398 | Ga0316574_0484409 | Ga0316574_0484409_456_746 | 87 |
| 4 | 3300028556 | Ga0265337_1010279 | Ga0265337_10102793 | 89 |
| 5 | 3300002077 | JGI24744J21845_10017991 | JGI24744J21845_100179912 | 90 |
| 6 | 3300002155 | JGI24033J26618_1029978 | JGI24033J26618_10299782 | 90 |
| 7 | 3300002239 | JGI24034J26672_10100102 | JGI24034J26672_101001022 | 90 |
| 8 | 3300003203 | JGI25406J46586_10027042 | JGI25406J46586_100270422 | 90 |
| 9 | 3300003322 | rootL2_10230045 | rootL2_102300452 | 90 |
| 10 | 3300005328 | Ga0070676_10376871 | Ga0070676_103768712 | 90 |
| 11 | 3300005328 | Ga0070676_10600223 | Ga0070676_106002231 | 90 |
| 12 | 3300005329 | Ga0070683_100173427 | Ga0070683_1001734273 | 90 |
| 13 | 3300005329 | Ga0070683_100395975 | Ga0070683_1003959751 | 90 |
| 14 | 3300005330 | Ga0070690_100114866 | Ga0070690_1001148661 | 90 |
| 15 | 3300005331 | Ga0070670_100342454 | Ga0070670_1003424542 | 90 |
| 16 | 3300005333 | Ga0070677_10562541 | Ga0070677_105625411 | 90 |
| 17 | 3300005334 | Ga0068869_101093839 | Ga0068869_1010938391 | 90 |
| 18 | 3300005335 | Ga0070666_10800500 | Ga0070666_108005001 | 90 |
| 19 | 3300005336 | Ga0070680_100488093 | Ga0070680_1004880932 | 90 |
| 20 | 3300005337 | Ga0070682_100012609 | Ga0070682_1000126091 | 90 |
| 21 | 3300005337 | Ga0070682_100036972 | Ga0070682_1000369725 | 90 |
| 22 | 3300005338 | Ga0068868_100137613 | Ga0068868_1001376132 | 90 |
| 23 | 3300005339 | Ga0070660_100024235 | Ga0070660_1000242354 | 90 |
| 24 | 3300005340 | Ga0070689_100078025 | Ga0070689_1000780252 | 90 |
| 25 | 3300005343 | Ga0070687_100002534 | Ga0070687_1000025347 | 90 |
| 26 | 3300005344 | Ga0070661_100324372 | Ga0070661_1003243722 | 90 |
| 27 | 3300005345 | Ga0070692_10019368 | Ga0070692_100193682 | 90 |
| 28 | 3300005347 | Ga0070668_100140729 | Ga0070668_1001407292 | 90 |
| 29 | 3300005347 | Ga0070668_100519510 | Ga0070668_1005195101 | 90 |
| 30 | 3300005353 | Ga0070669_100404151 | Ga0070669_1004041512 | 90 |
| 31 | 3300005354 | Ga0070675_100036549 | Ga0070675_1000365493 | 90 |
| 32 | 3300005356 | Ga0070674_100001461 | Ga0070674_1000014616 | 90 |
| 33 | 3300005356 | Ga0070674_100007430 | Ga0070674_1000074304 | 90 |
| 34 | 3300005364 | Ga0070673_100017805 | Ga0070673_1000178054 | 90 |
| 35 | 3300005364 | Ga0070673_101017675 | Ga0070673_1010176752 | 90 |
| 36 | 3300005365 | Ga0070688_100088312 | Ga0070688_1000883122 | 90 |
| 37 | 3300005366 | Ga0070659_100215447 | Ga0070659_1002154472 | 90 |
| 38 | 3300005436 | Ga0070713_100978467 | Ga0070713_1009784671 | 90 |
| 39 | 3300005436 | Ga0070713_102129272 | Ga0070713_1021292721 | 90 |
| 40 | 3300005438 | Ga0070701_10079006 | Ga0070701_100790061 | 90 |
| 41 | 3300005440 | Ga0070705_100433431 | Ga0070705_1004334312 | 90 |
| 42 | 3300005440 | Ga0070705_100616986 | Ga0070705_1006169862 | 90 |
| 43 | 3300005440 | Ga0070705_101579021 | Ga0070705_1015790211 | 90 |
| 44 | 3300005441 | Ga0070700_100064761 | Ga0070700_1000647612 | 90 |
| 45 | 3300005441 | Ga0070700_100115488 | Ga0070700_1001154882 | 90 |
| 46 | 3300005441 | Ga0070700_100146689 | Ga0070700_1001466893 | 90 |
| 47 | 3300005444 | Ga0070694_100058793 | Ga0070694_1000587936 | 90 |
| 48 | 3300005444 | Ga0070694_100694550 | Ga0070694_1006945501 | 90 |
| 49 | 3300005444 | Ga0070694_101304007 | Ga0070694_1013040071 | 90 |
| 50 | 3300005444 | Ga0070694_101583979 | Ga0070694_1015839791 | 90 |
| 51 | 3300005445 | Ga0070708_100021184 | Ga0070708_1000211844 | 90 |
| 52 | 3300005445 | Ga0070708_100021271 | Ga0070708_1000212713 | 90 |
| 53 | 3300005445 | Ga0070708_100025853 | Ga0070708_1000258533 | 90 |
| 54 | 3300005445 | Ga0070708_100326255 | Ga0070708_1003262552 | 90 |
| 55 | 3300005455 | Ga0070663_100106348 | Ga0070663_1001063482 | 90 |
| 56 | 3300005455 | Ga0070663_100986261 | Ga0070663_1009862612 | 90 |
| 57 | 3300005456 | Ga0070678_100070393 | Ga0070678_1000703934 | 90 |
| 58 | 3300005456 | Ga0070678_100614454 | Ga0070678_1006144542 | 90 |
| 59 | 3300005457 | Ga0070662_100123376 | Ga0070662_1001233764 | 90 |
| 60 | 3300005458 | Ga0070681_11411413 | Ga0070681_114114131 | 90 |
| 61 | 3300005459 | Ga0068867_100011299 | Ga0068867_1000112995 | 90 |
| 62 | 3300005459 | Ga0068867_100104691 | Ga0068867_1001046912 | 90 |
| 63 | 3300005459 | Ga0068867_100160936 | Ga0068867_1001609363 | 90 |
| 64 | 3300005459 | Ga0068867_100619474 | Ga0068867_1006194742 | 90 |
| 65 | 3300005459 | Ga0068867_101538248 | Ga0068867_1015382481 | 90 |
| 66 | 3300005466 | Ga0070685_10012464 | Ga0070685_100124642 | 90 |
| 67 | 3300005466 | Ga0070685_10356086 | Ga0070685_103560862 | 90 |
| 68 | 3300005467 | Ga0070706_100050898 | Ga0070706_1000508983 | 90 |
| 69 | 3300005467 | Ga0070706_100607812 | Ga0070706_1006078121 | 90 |
| 70 | 3300005467 | Ga0070706_100640497 | Ga0070706_1006404972 | 90 |
| 71 | 3300005467 | Ga0070706_100822885 | Ga0070706_1008228852 | 90 |
| 72 | 3300005468 | Ga0070707_100001009 | Ga0070707_1000010095 | 90 |
| 73 | 3300005468 | Ga0070707_100026690 | Ga0070707_1000266905 | 90 |
| 74 | 3300005468 | Ga0070707_100036581 | Ga0070707_1000365812 | 90 |
| 75 | 3300005468 | Ga0070707_100795352 | Ga0070707_1007953522 | 90 |
| 76 | 3300005471 | Ga0070698_100151294 | Ga0070698_1001512941 | 90 |
| 77 | 3300005518 | Ga0070699_100028561 | Ga0070699_1000285613 | 90 |
| 78 | 3300005518 | Ga0070699_100032705 | Ga0070699_1000327053 | 90 |
| 79 | 3300005518 | Ga0070699_100063885 | Ga0070699_1000638852 | 90 |
| 80 | 3300005518 | Ga0070699_100942395 | Ga0070699_1009423952 | 90 |
| 81 | 3300005530 | Ga0070679_100820248 | Ga0070679_1008202481 | 90 |
| 82 | 3300005535 | Ga0070684_100035666 | Ga0070684_1000356666 | 90 |
| 83 | 3300005535 | Ga0070684_100381444 | Ga0070684_1003814442 | 90 |
| 84 | 3300005536 | Ga0070697_100021612 | Ga0070697_1000216122 | 90 |
| 85 | 3300005536 | Ga0070697_100561774 | Ga0070697_1005617743 | 90 |
| 86 | 3300005536 | Ga0070697_101047462 | Ga0070697_1010474621 | 90 |
| 87 | 3300005539 | Ga0068853_100972563 | Ga0068853_1009725632 | 90 |
| 88 | 3300005543 | Ga0070672_102061216 | Ga0070672_1020612161 | 90 |
| 89 | 3300005544 | Ga0070686_100007488 | Ga0070686_1000074886 | 90 |
| 90 | 3300005545 | Ga0070695_100021965 | Ga0070695_1000219656 | 90 |
| 91 | 3300005545 | Ga0070695_100023249 | Ga0070695_1000232493 | 90 |
| 92 | 3300005545 | Ga0070695_100222412 | Ga0070695_1002224121 | 90 |
| 93 | 3300005545 | Ga0070695_100669695 | Ga0070695_1006696952 | 90 |
| 94 | 3300005546 | Ga0070696_100063003 | Ga0070696_1000630035 | 90 |
| 95 | 3300005546 | Ga0070696_100340970 | Ga0070696_1003409702 | 90 |
| 96 | 3300005547 | Ga0070693_100039445 | Ga0070693_1000394451 | 90 |
| 97 | 3300005547 | Ga0070693_101119777 | Ga0070693_1011197771 | 90 |
| 98 | 3300005549 | Ga0070704_100052164 | Ga0070704_1000521642 | 90 |
| 99 | 3300005549 | Ga0070704_100056808 | Ga0070704_1000568081 | 90 |
| 100 | 3300005549 | Ga0070704_100262294 | Ga0070704_1002622942 | 90 |
| 101 | 3300005564 | Ga0070664_100291888 | Ga0070664_1002918882 | 90 |
| 102 | 3300005577 | Ga0068857_100137377 | Ga0068857_1001373772 | 90 |
| 103 | 3300005578 | Ga0068854_100007542 | Ga0068854_1000075425 | 90 |
| 104 | 3300005578 | Ga0068854_101985439 | Ga0068854_1019854391 | 90 |
| 105 | 3300005615 | Ga0070702_100002645 | Ga0070702_1000026456 | 90 |
| 106 | 3300005615 | Ga0070702_100754558 | Ga0070702_1007545581 | 90 |
| 107 | 3300005616 | Ga0068852_100157380 | Ga0068852_1001573802 | 90 |
| 108 | 3300005617 | Ga0068859_100172981 | Ga0068859_1001729814 | 90 |
| 109 | 3300005617 | Ga0068859_100419157 | Ga0068859_1004191573 | 90 |
| 110 | 3300005618 | Ga0068864_100014152 | Ga0068864_1000141528 | 90 |
| 111 | 3300005718 | Ga0068866_10011362 | Ga0068866_100113625 | 90 |
| 112 | 3300005719 | Ga0068861_100119568 | Ga0068861_1001195684 | 90 |
| 113 | 3300005719 | Ga0068861_100415824 | Ga0068861_1004158242 | 90 |
| 114 | 3300005834 | Ga0068851_10552038 | Ga0068851_105520382 | 90 |
| 115 | 3300005840 | Ga0068870_10229625 | Ga0068870_102296252 | 90 |
| 116 | 3300005840 | Ga0068870_10706283 | Ga0068870_107062831 | 90 |
| 117 | 3300005841 | Ga0068863_100743416 | Ga0068863_1007434162 | 90 |
| 118 | 3300005842 | Ga0068858_100268694 | Ga0068858_1002686942 | 90 |
| 119 | 3300005843 | Ga0068860_100073876 | Ga0068860_1000738762 | 90 |
| 120 | 3300005843 | Ga0068860_101758946 | Ga0068860_1017589461 | 90 |
| 121 | 3300005844 | Ga0068862_100321359 | Ga0068862_1003213592 | 90 |
| 122 | 3300005985 | Ga0081539_10003460 | Ga0081539_1000346017 | 90 |
| 123 | 3300006038 | Ga0075365_10066178 | Ga0075365_100661783 | 90 |
| 124 | 3300006058 | Ga0075432_10287323 | Ga0075432_102873232 | 90 |
| 125 | 3300006844 | Ga0075428_100898310 | Ga0075428_1008983102 | 90 |
| 126 | 3300006847 | Ga0075431_100406993 | Ga0075431_1004069932 | 90 |
| 127 | 3300006847 | Ga0075431_101171791 | Ga0075431_1011717912 | 90 |
| 128 | 3300006852 | Ga0075433_10008221 | Ga0075433_100082217 | 90 |
| 129 | 3300006852 | Ga0075433_10413449 | Ga0075433_104134492 | 90 |
| 130 | 3300006852 | Ga0075433_10505540 | Ga0075433_105055402 | 90 |
| 131 | 3300006871 | Ga0075434_100529599 | Ga0075434_1005295992 | 90 |
| 132 | 3300006871 | Ga0075434_101692566 | Ga0075434_1016925662 | 90 |
| 133 | 3300006881 | Ga0068865_100003323 | Ga0068865_1000033235 | 90 |
| 134 | 3300006914 | Ga0075436_100359650 | Ga0075436_1003596502 | 90 |
| 135 | 3300006931 | Ga0097620_100172996 | Ga0097620_1001729962 | 90 |
| 136 | 3300006931 | Ga0097620_100419108 | Ga0097620_1004191083 | 90 |
| 137 | 3300007076 | Ga0075435_100275175 | Ga0075435_1002751752 | 90 |
| 138 | 3300007076 | Ga0075435_100719912 | Ga0075435_1007199122 | 90 |
| 139 | 3300009011 | Ga0105251_10274053 | Ga0105251_102740532 | 90 |
| 140 | 3300009036 | Ga0105244_10094482 | Ga0105244_100944822 | 90 |
| 141 | 3300009094 | Ga0111539_10020328 | Ga0111539_100203286 | 90 |
| 142 | 3300009094 | Ga0111539_10117766 | Ga0111539_101177662 | 90 |
| 143 | 3300009094 | Ga0111539_10913438 | Ga0111539_109134381 | 90 |
| 144 | 3300009098 | Ga0105245_10026836 | Ga0105245_100268363 | 90 |
| 145 | 3300009098 | Ga0105245_10733264 | Ga0105245_107332642 | 90 |
| 146 | 3300009101 | Ga0105247_10398576 | Ga0105247_103985762 | 90 |
| 147 | 3300009147 | Ga0114129_10446219 | Ga0114129_104462192 | 90 |
| 148 | 3300009147 | Ga0114129_10979224 | Ga0114129_109792242 | 90 |
| 149 | 3300009148 | Ga0105243_10073588 | Ga0105243_100735884 | 90 |
| 150 | 3300009148 | Ga0105243_10901361 | Ga0105243_109013611 | 90 |
| 151 | 3300009148 | Ga0105243_11354425 | Ga0105243_113544252 | 90 |
| 152 | 3300009176 | Ga0105242_10019629 | Ga0105242_100196294 | 90 |
| 153 | 3300009176 | Ga0105242_10540592 | Ga0105242_105405922 | 90 |
| 154 | 3300009176 | Ga0105242_11870444 | Ga0105242_118704442 | 90 |
| 155 | 3300009177 | Ga0105248_10337716 | Ga0105248_103377162 | 90 |
| 156 | 3300009177 | Ga0105248_11826080 | Ga0105248_118260801 | 90 |
| 157 | 3300009545 | Ga0105237_10303552 | Ga0105237_103035522 | 90 |
| 158 | 3300009551 | Ga0105238_10835521 | Ga0105238_108355212 | 90 |
| 159 | 3300009553 | Ga0105249_10011568 | Ga0105249_100115686 | 90 |
| 160 | 3300009553 | Ga0105249_10577604 | Ga0105249_105776042 | 90 |
| 161 | 3300009553 | Ga0105249_10895749 | Ga0105249_108957492 | 90 |
| 162 | 3300010159 | Ga0099796_10332410 | Ga0099796_103324102 | 90 |
| 163 | 3300010159 | Ga0099796_10574615 | Ga0099796_105746151 | 90 |
| 164 | 3300010375 | Ga0105239_10036633 | Ga0105239_100366332 | 90 |
| 165 | 3300011119 | Ga0105246_10176212 | Ga0105246_101762122 | 90 |
| 166 | 3300011119 | Ga0105246_12447808 | Ga0105246_124478081 | 90 |
| 167 | 3300013297 | Ga0157378_10021356 | Ga0157378_100213564 | 90 |
| 168 | 3300013306 | Ga0163162_10933670 | Ga0163162_109336702 | 90 |
| 169 | 3300013306 | Ga0163162_12024273 | Ga0163162_120242732 | 90 |
| 170 | 3300013307 | Ga0157372_13366306 | Ga0157372_133663061 | 90 |
| 171 | 3300013308 | Ga0157375_10008137 | Ga0157375_100081374 | 90 |
| 172 | 3300013308 | Ga0157375_10898729 | Ga0157375_108987292 | 90 |
| 173 | 3300014325 | Ga0163163_10018899 | Ga0163163_100188992 | 90 |
| 174 | 3300014325 | Ga0163163_10477786 | Ga0163163_104777861 | 90 |
| 175 | 3300014325 | Ga0163163_10805815 | Ga0163163_108058151 | 90 |
| 176 | 3300014326 | Ga0157380_10016123 | Ga0157380_100161232 | 90 |
| 177 | 3300014326 | Ga0157380_10182771 | Ga0157380_101827712 | 90 |
| 178 | 3300014745 | Ga0157377_10001871 | Ga0157377_100018716 | 90 |
| 179 | 3300014968 | Ga0157379_10059263 | Ga0157379_100592633 | 90 |
| 180 | 3300014969 | Ga0157376_10958911 | Ga0157376_109589112 | 90 |
| 181 | 3300025315 | Ga0207697_10104681 | Ga0207697_101046812 | 90 |
| 182 | 3300025899 | Ga0207642_10060743 | Ga0207642_100607432 | 90 |
| 183 | 3300025900 | Ga0207710_10320223 | Ga0207710_103202231 | 90 |
| 184 | 3300025901 | Ga0207688_10242661 | Ga0207688_102426612 | 90 |
| 185 | 3300025907 | Ga0207645_10266169 | Ga0207645_102661693 | 90 |
| 186 | 3300025907 | Ga0207645_10681526 | Ga0207645_106815262 | 90 |
| 187 | 3300025908 | Ga0207643_10004561 | Ga0207643_100045619 | 90 |
| 188 | 3300025910 | Ga0207684_10022072 | Ga0207684_100220725 | 90 |
| 189 | 3300025910 | Ga0207684_10403686 | Ga0207684_104036862 | 90 |
| 190 | 3300025917 | Ga0207660_10439840 | Ga0207660_104398402 | 90 |
| 191 | 3300025918 | Ga0207662_10012310 | Ga0207662_100123102 | 90 |
| 192 | 3300025919 | Ga0207657_10023977 | Ga0207657_100239776 | 90 |
| 193 | 3300025919 | Ga0207657_11221383 | Ga0207657_112213831 | 90 |
| 194 | 3300025920 | Ga0207649_10524376 | Ga0207649_105243761 | 90 |
| 195 | 3300025922 | Ga0207646_10002036 | Ga0207646_100020362 | 90 |
| 196 | 3300025922 | Ga0207646_10012048 | Ga0207646_100120485 | 90 |
| 197 | 3300025922 | Ga0207646_10016705 | Ga0207646_100167054 | 90 |
| 198 | 3300025922 | Ga0207646_11734832 | Ga0207646_117348322 | 90 |
| 199 | 3300025923 | Ga0207681_10024491 | Ga0207681_100244914 | 90 |
| 200 | 3300025924 | Ga0207694_10077664 | Ga0207694_100776644 | 90 |
| 201 | 3300025925 | Ga0207650_10062714 | Ga0207650_100627142 | 90 |
| 202 | 3300025926 | Ga0207659_10399537 | Ga0207659_103995372 | 90 |
| 203 | 3300025927 | Ga0207687_10901767 | Ga0207687_109017672 | 90 |
| 204 | 3300025933 | Ga0207706_10035925 | Ga0207706_100359255 | 90 |
| 205 | 3300025934 | Ga0207686_10016970 | Ga0207686_100169704 | 90 |
| 206 | 3300025935 | Ga0207709_10016662 | Ga0207709_100166623 | 90 |
| 207 | 3300025935 | Ga0207709_10679351 | Ga0207709_106793512 | 90 |
| 208 | 3300025935 | Ga0207709_11272139 | Ga0207709_112721392 | 90 |
| 209 | 3300025936 | Ga0207670_10656674 | Ga0207670_106566741 | 90 |
| 210 | 3300025937 | Ga0207669_10030336 | Ga0207669_100303363 | 90 |
| 211 | 3300025937 | Ga0207669_10033555 | Ga0207669_100335555 | 90 |
| 212 | 3300025937 | Ga0207669_10168542 | Ga0207669_101685422 | 90 |
| 213 | 3300025938 | Ga0207704_10267625 | Ga0207704_102676252 | 90 |
| 214 | 3300025940 | Ga0207691_11687880 | Ga0207691_116878802 | 90 |
| 215 | 3300025944 | Ga0207661_11164649 | Ga0207661_111646491 | 90 |
| 216 | 3300025944 | Ga0207661_11711926 | Ga0207661_117119262 | 90 |
| 217 | 3300025945 | Ga0207679_10023805 | Ga0207679_100238055 | 90 |
| 218 | 3300025960 | Ga0207651_10651955 | Ga0207651_106519552 | 90 |
| 219 | 3300025961 | Ga0207712_10615472 | Ga0207712_106154722 | 90 |
| 220 | 3300025972 | Ga0207668_10394879 | Ga0207668_103948792 | 90 |
| 221 | 3300025972 | Ga0207668_10601775 | Ga0207668_106017752 | 90 |
| 222 | 3300025981 | Ga0207640_10018979 | Ga0207640_100189792 | 90 |
| 223 | 3300025981 | Ga0207640_10875684 | Ga0207640_108756841 | 90 |
| 224 | 3300026023 | Ga0207677_10545879 | Ga0207677_105458792 | 90 |
| 225 | 3300026035 | Ga0207703_10028330 | Ga0207703_100283304 | 90 |
| 226 | 3300026041 | Ga0207639_11070336 | Ga0207639_110703362 | 90 |
| 227 | 3300026067 | Ga0207678_10021470 | Ga0207678_100214705 | 90 |
| 228 | 3300026075 | Ga0207708_10003005 | Ga0207708_100030052 | 90 |
| 229 | 3300026075 | Ga0207708_10058992 | Ga0207708_100589925 | 90 |
| 230 | 3300026075 | Ga0207708_10092031 | Ga0207708_100920312 | 90 |
| 231 | 3300026088 | Ga0207641_10595179 | Ga0207641_105951792 | 90 |
| 232 | 3300026089 | Ga0207648_10003422 | Ga0207648_100034226 | 90 |
| 233 | 3300026089 | Ga0207648_10227771 | Ga0207648_102277711 | 90 |
| 234 | 3300026089 | Ga0207648_10303772 | Ga0207648_103037722 | 90 |
| 235 | 3300026095 | Ga0207676_10243515 | Ga0207676_102435152 | 90 |
| 236 | 3300026095 | Ga0207676_10341602 | Ga0207676_103416022 | 90 |
| 237 | 3300026116 | Ga0207674_10009525 | Ga0207674_100095257 | 90 |
| 238 | 3300026118 | Ga0207675_100038773 | Ga0207675_1000387733 | 90 |
| 239 | 3300026121 | Ga0207683_10015985 | Ga0207683_100159854 | 90 |
| 240 | 3300026121 | Ga0207683_10393981 | Ga0207683_103939812 | 90 |
| 241 | 3300026121 | Ga0207683_11026919 | Ga0207683_110269192 | 90 |
| 242 | 3300026142 | Ga0207698_10226283 | Ga0207698_102262832 | 90 |
| 243 | 3300027717 | Ga0209998_10025011 | Ga0209998_100250112 | 90 |
| 244 | 3300027907 | Ga0207428_10272781 | Ga0207428_102727812 | 90 |
| 245 | 3300028379 | Ga0268266_10387225 | Ga0268266_103872252 | 90 |
| 246 | 3300028380 | Ga0268265_10464531 | Ga0268265_104645312 | 90 |
| 247 | 3300028381 | Ga0268264_10092179 | Ga0268264_100921792 | 90 |
| 248 | 3300028381 | Ga0268264_12011677 | Ga0268264_120116771 | 90 |
| 249 | 3300031731 | Ga0307405_10055016 | Ga0307405_100550162 | 90 |
| 250 | 3300031731 | Ga0307405_10170464 | Ga0307405_101704642 | 90 |
| 251 | 3300031852 | Ga0307410_10170401 | Ga0307410_101704012 | 90 |
| 252 | 3300031852 | Ga0307410_10178821 | Ga0307410_101788211 | 90 |
| 253 | 3300031901 | Ga0307406_10169796 | Ga0307406_101697961 | 90 |
| 254 | 3300031901 | Ga0307406_10563964 | Ga0307406_105639642 | 90 |
| 255 | 3300031903 | Ga0307407_10430220 | Ga0307407_104302202 | 90 |
| 256 | 3300031911 | Ga0307412_10199536 | Ga0307412_101995362 | 90 |
| 257 | 3300031911 | Ga0307412_11579590 | Ga0307412_115795902 | 90 |
| 258 | 3300031995 | Ga0307409_100030286 | Ga0307409_1000302865 | 90 |
| 259 | 3300031995 | Ga0307409_100325000 | Ga0307409_1003250002 | 90 |
| 260 | 3300032002 | Ga0307416_100002960 | Ga0307416_10000296011 | 90 |
| 261 | 3300032002 | Ga0307416_101386972 | Ga0307416_1013869722 | 90 |
| 262 | 3300032126 | Ga0307415_100009017 | Ga0307415_1000090176 | 90 |
| 263 | 3300032126 | Ga0307415_101144535 | Ga0307415_1011445351 | 90 |
| 264 | 3300034818 | Ga0373950_0046322 | Ga0373950_0046322_108_380 | 90 |
| 265 | 3300034820 | Ga0373959_0039341 | Ga0373959_0039341_454_726 | 90 |
| 266 | 3300035084 | Ga0373928_0129327 | Ga0373928_0129327_160_432 | 90 |
| 267 | 3300035085 | Ga0373929_0084312 | Ga0373929_0084312_66_338 | 90 |
| 268 | 3300035115 | Ga0373941_0244853 | Ga0373941_0244853_329_601 | 90 |
| 269 | 3300035170 | Ga0373943_0635320 | Ga0373943_0635320_68_340 | 90 |
| 270 | 3300035242 | Ga0373962_0057454 | Ga0373962_0057454_396_668 | 90 |
| 271 | 3300035691 | Ga0373931_0227053 | Ga0373931_0227053_283_555 | 90 |
| 272 | 3300035692 | Ga0373935_1485995 | Ga0373935_1485995_124_396 | 90 |
| 273 | 3300036401 | Ga0373937_1608042 | Ga0373937_1608042_150_422 | 90 |
| 274 | 3300037312 | Ga0395899_0837354 | Ga0395899_0837354_144_416 | 90 |
| 275 | 3300037471 | Ga0395905_1624125 | Ga0395905_1624125_174_446 | 90 |
| 276 | 3300038443 | Ga0395901_0202427 | Ga0395901_0202427_355_627 | 90 |
| 277 | 3300038443 | Ga0395901_0564705 | Ga0395901_0564705_277_549 | 90 |
| 278 | 3300038443 | Ga0395901_1611586 | Ga0395901_1611586_86_358 | 90 |
| 279 | 3300041498 | Ga0451841_1258803 | Ga0451841_1258803_59_331 | 90 |
| 280 | 3300042001 | Ga0439441_023056 | Ga0439441_023056_545_817 | 90 |
| 281 | 3300042005 | Ga0439448_0233382 | Ga0439448_0233382_360_632 | 90 |
| 282 | 3300042142 | Ga0450905_091397 | Ga0450905_091397_121_393 | 90 |
| 283 | 3300042157 | Ga0439458_0069317 | Ga0439458_0069317_97_369 | 90 |
| 284 | 3300042438 | Ga0439459_0119647 | Ga0439459_0119647_109_381 | 90 |
| 285 | 3300042993 | Ga0439440_0141668 | Ga0439440_0141668_315_587 | 90 |
| 286 | 3300044658 | Ga0466972_0141854 | Ga0466972_0141854_600_872 | 90 |
| 287 | 3300044735 | Ga0466968_0073517 | Ga0466968_0073517_838_1110 | 90 |
| 288 | 3300044901 | Ga0466960_0402086 | Ga0466960_0402086_439_711 | 90 |
| 289 | 3300045051 | Ga0451576_2630143 | Ga0451576_2630143_114_386 | 90 |
| 290 | 3300046461 | Ga0495641_0081293 | Ga0495641_0081293_290_562 | 90 |
| 291 | 3300046462 | Ga0495651_0019074 | Ga0495651_0019074_3897_4169 | 90 |
| 292 | 3300046463 | Ga0495653_0160494 | Ga0495653_0160494_986_1258 | 90 |
| 293 | 3300046475 | Ga0495639_0633335 | Ga0495639_0633335_203_475 | 90 |
| 294 | 3300046476 | Ga0495662_0083556 | Ga0495662_0083556_965_1237 | 90 |
| 295 | 3300046477 | Ga0495664_0192132 | Ga0495664_0192132_123_395 | 90 |
| 296 | 3300046500 | Ga0495596_0400014 | Ga0495596_0400014_41_313 | 90 |
| 297 | 3300046511 | Ga0495608_0512855 | Ga0495608_0512855_89_361 | 90 |
| 298 | 3300046514 | Ga0495618_0156439 | Ga0495618_0156439_1168_1440 | 90 |
| 299 | 3300046516 | Ga0495628_0094295 | Ga0495628_0094295_1079_1351 | 90 |
| 300 | 3300046516 | Ga0495628_0566542 | Ga0495628_0566542_365_637 | 90 |
| 301 | 3300046517 | Ga0495630_0345100 | Ga0495630_0345100_151_423 | 90 |
| 302 | 3300046517 | Ga0495630_1330737 | Ga0495630_1330737_144_416 | 90 |
| 303 | 3300046520 | Ga0495637_0361299 | Ga0495637_0361299_175_447 | 90 |
| 304 | 3300046533 | Ga0495640_0027776 | Ga0495640_0027776_966_1238 | 90 |
| 305 | 3300046536 | Ga0495587_0265827 | Ga0495587_0265827_426_698 | 90 |
| 306 | 3300046538 | Ga0495609_0409999 | Ga0495609_0409999_242_514 | 90 |
| 307 | 3300046539 | Ga0495621_0536677 | Ga0495621_0536677_160_432 | 90 |
| 308 | 3300046558 | Ga0495633_0564965 | Ga0495633_0564965_140_481 | 90 |
| 309 | 3300046559 | Ga0495667_0674549 | Ga0495667_0674549_312_584 | 90 |
| 310 | 3300046559 | Ga0495667_0705064 | Ga0495667_0705064_72_344 | 90 |
| 311 | 3300046663 | Ga0495635_0249373 | Ga0495635_0249373_35_307 | 90 |
| 312 | 3300046664 | Ga0495659_0144497 | Ga0495659_0144497_589_861 | 90 |
| 313 | 3300046675 | Ga0495657_0174349 | Ga0495657_0174349_360_632 | 90 |
| 314 | 3300046675 | Ga0495657_0362362 | Ga0495657_0362362_72_344 | 90 |
| 315 | 3300046675 | Ga0495657_0733689 | Ga0495657_0733689_264_536 | 90 |
| 316 | 3300046678 | Ga0495599_0590593 | Ga0495599_0590593_79_351 | 90 |
| 317 | 3300046679 | Ga0495623_0161615 | Ga0495623_0161615_574_846 | 90 |
| 318 | 3300046689 | Ga0495613_0357524 | Ga0495613_0357524_474_746 | 90 |
| 319 | 3300046690 | Ga0495624_0202939 | Ga0495624_0202939_301_573 | 90 |
| 320 | 3300046691 | Ga0495670_0572218 | Ga0495670_0572218_296_568 | 90 |
| 321 | 3300046809 | Ga0495600_0172165 | Ga0495600_0172165_89_361 | 90 |
| 322 | 3300047317 | Ga0495604_0224544 | Ga0495604_0224544_432_704 | 90 |
| 323 | 3300047319 | Ga0495674_0376955 | Ga0495674_0376955_712_984 | 90 |
| 324 | 3300047319 | Ga0495674_0488743 | Ga0495674_0488743_82_354 | 90 |
| 325 | 3300047322 | Ga0495680_0102568 | Ga0495680_0102568_1717_1989 | 90 |
| 326 | 3300047471 | Ga0495684_0141457 | Ga0495684_0141457_888_1160 | 90 |
| 327 | 3300047673 | Ga0495593_0205231 | Ga0495593_0205231_584_856 | 90 |
| 328 | 3300048088 | Ga0495602_0246172 | Ga0495602_0246172_298_570 | 90 |
| 329 | 3300048903 | Ga0496100_0705906 | Ga0496100_0705906_501_773 | 90 |
| 330 | 3300048904 | Ga0496101_0068185 | Ga0496101_0068185_1961_2233 | 90 |
| 331 | 3300048904 | Ga0496101_0148286 | Ga0496101_0148286_1232_1504 | 90 |
| 332 | 3300048905 | Ga0496102_0104013 | Ga0496102_0104013_154_426 | 90 |
| 333 | 3300048905 | Ga0496102_0116152 | Ga0496102_0116152_17_289 | 90 |
| 334 | 3300048905 | Ga0496102_0244132 | Ga0496102_0244132_242_514 | 90 |
| 335 | 3300048905 | Ga0496102_1062333 | Ga0496102_1062333_78_350 | 90 |
| 336 | 3300048906 | Ga0496103_0214486 | Ga0496103_0214486_671_943 | 90 |
| 337 | 3300048909 | Ga0496106_0117047 | Ga0496106_0117047_343_615 | 90 |
| 338 | 3300048909 | Ga0496106_0919368 | Ga0496106_0919368_233_505 | 90 |
| 339 | 3300048911 | Ga0496108_0139343 | Ga0496108_0139343_1576_1848 | 90 |
| 340 | 3300048912 | Ga0496109_0117680 | Ga0496109_0117680_546_818 | 90 |
| 341 | 3300048912 | Ga0496109_1000808 | Ga0496109_1000808_468_740 | 90 |
| 342 | 3300048914 | Ga0496111_0129419 | Ga0496111_0129419_256_528 | 90 |
| 343 | 3300048915 | Ga0496112_0075314 | Ga0496112_0075314_2114_2386 | 90 |
| 344 | 3300048915 | Ga0496112_1883124 | Ga0496112_1883124_189_461 | 90 |
| 345 | 3300048916 | Ga0496113_0042521 | Ga0496113_0042521_690_962 | 90 |
| 346 | 3300048917 | Ga0496114_0721933 | Ga0496114_0721933_355_639 | 90 |
| 347 | 3300049568 | Ga0501031_0151233 | Ga0501031_0151233_916_1188 | 90 |
| 348 | 3300049568 | Ga0501031_0235193 | Ga0501031_0235193_45_317 | 90 |
| 349 | 3300049569 | Ga0501032_0412654 | Ga0501032_0412654_318_590 | 90 |
| 350 | 3300049572 | Ga0501036_0020106 | Ga0501036_0020106_5117_5389 | 90 |
| 351 | 3300049573 | Ga0501037_0449708 | Ga0501037_0449708_206_478 | 90 |
| 352 | 3300049573 | Ga0501037_0615889 | Ga0501037_0615889_16_288 | 90 |
| 353 | 3300049573 | Ga0501037_0629348 | Ga0501037_0629348_342_614 | 90 |
| 354 | 3300049573 | Ga0501037_0720238 | Ga0501037_0720238_276_548 | 90 |
| 355 | 3300049574 | Ga0501038_0435746 | Ga0501038_0435746_71_343 | 90 |
| 356 | 3300049574 | Ga0501038_0735699 | Ga0501038_0735699_335_607 | 90 |
| 357 | 3300049575 | Ga0501039_0063103 | Ga0501039_0063103_300_584 | 90 |
| 358 | 3300049575 | Ga0501039_0140789 | Ga0501039_0140789_1414_1686 | 90 |
| 359 | 3300049575 | Ga0501039_0996963 | Ga0501039_0996963_12_284 | 90 |
| 360 | 3300049576 | Ga0501040_0008058 | Ga0501040_0008058_6094_6378 | 90 |
| 361 | 3300049576 | Ga0501040_0452559 | Ga0501040_0452559_16_288 | 90 |
| 362 | 3300049576 | Ga0501040_0533984 | Ga0501040_0533984_230_502 | 90 |
| 363 | 3300049576 | Ga0501040_0661459 | Ga0501040_0661459_274_546 | 90 |
| 364 | 3300049576 | Ga0501040_0899616 | Ga0501040_0899616_161_445 | 90 |
| 365 | 3300049577 | Ga0501041_0251402 | Ga0501041_0251402_64_336 | 90 |
| 366 | 3300049577 | Ga0501041_0511217 | Ga0501041_0511217_221_505 | 90 |
| 367 | 3300049577 | Ga0501041_0667304 | Ga0501041_0667304_288_572 | 90 |
| 368 | 3300049578 | Ga0501042_0461868 | Ga0501042_0461868_250_522 | 90 |
| 369 | 3300049578 | Ga0501042_1338060 | Ga0501042_1338060_66_338 | 90 |
| 370 | 3300049578 | Ga0501042_1423607 | Ga0501042_1423607_170_454 | 90 |
| 371 | 3300049579 | Ga0501043_1097860 | Ga0501043_1097860_118_402 | 90 |
| 372 | 3300049580 | Ga0501046_0344387 | Ga0501046_0344387_538_810 | 90 |
| 373 | 3300049580 | Ga0501046_1148961 | Ga0501046_1148961_88_372 | 90 |
| 374 | 3300049582 | Ga0501048_0150187 | Ga0501048_0150187_101_385 | 90 |
| 375 | 3300049582 | Ga0501048_0397226 | Ga0501048_0397226_451_723 | 90 |
| 376 | 3300049582 | Ga0501048_0640137 | Ga0501048_0640137_411_683 | 90 |
| 377 | 3300049582 | Ga0501048_0693586 | Ga0501048_0693586_426_698 | 90 |
| 378 | 3300049582 | Ga0501048_0869490 | Ga0501048_0869490_179_451 | 90 |
| 379 | 3300049584 | Ga0501068_0401656 | Ga0501068_0401656_235_519 | 90 |
| 380 | 3300049584 | Ga0501068_0419878 | Ga0501068_0419878_452_724 | 90 |
| 381 | 3300049585 | Ga0501069_0048314 | Ga0501069_0048314_1262_1534 | 90 |
| 382 | 3300049587 | Ga0501071_0160917 | Ga0501071_0160917_1086_1358 | 90 |
| 383 | 3300049587 | Ga0501071_0452814 | Ga0501071_0452814_557_829 | 90 |
| 384 | 3300049587 | Ga0501071_0568508 | Ga0501071_0568508_130_402 | 90 |
| 385 | 3300049588 | Ga0501072_0039219 | Ga0501072_0039219_2884_3168 | 90 |
| 386 | 3300049588 | Ga0501072_0175200 | Ga0501072_0175200_514_786 | 90 |
| 387 | 3300049588 | Ga0501072_0477579 | Ga0501072_0477579_484_756 | 90 |
| 388 | 3300049588 | Ga0501072_0615837 | Ga0501072_0615837_496_780 | 90 |
| 389 | 3300049589 | Ga0501073_0643487 | Ga0501073_0643487_224_496 | 90 |
| 390 | 3300049590 | Ga0501074_1126309 | Ga0501074_1126309_255_527 | 90 |
| 391 | 3300049590 | Ga0501074_1314408 | Ga0501074_1314408_107_391 | 90 |
| 392 | 3300049591 | Ga0501075_0121984 | Ga0501075_0121984_447_731 | 90 |
| 393 | 3300049591 | Ga0501075_0397648 | Ga0501075_0397648_144_416 | 90 |
| 394 | 3300049591 | Ga0501075_0454804 | Ga0501075_0454804_72_344 | 90 |
| 395 | 3300049591 | Ga0501075_0546499 | Ga0501075_0546499_348_620 | 90 |
| 396 | 3300049591 | Ga0501075_1110678 | Ga0501075_1110678_23_295 | 90 |
| 397 | 3300049592 | Ga0501076_0020659 | Ga0501076_0020659_2123_2407 | 90 |
| 398 | 3300049592 | Ga0501076_0153112 | Ga0501076_0153112_49_321 | 90 |
| 399 | 3300049592 | Ga0501076_0156324 | Ga0501076_0156324_1361_1633 | 90 |
| 400 | 3300049592 | Ga0501076_0466284 | Ga0501076_0466284_528_812 | 90 |
| 401 | 3300049592 | Ga0501076_1084512 | Ga0501076_1084512_342_614 | 90 |
| 402 | 3300049592 | Ga0501076_1520891 | Ga0501076_1520891_30_314 | 90 |
| 403 | 3300049593 | Ga0501077_0358004 | Ga0501077_0358004_448_720 | 90 |
| 404 | 3300049593 | Ga0501077_1149267 | Ga0501077_1149267_55_339 | 90 |
| 405 | 3300049652 | Ga0501202_057959 | Ga0501202_057959_518_790 | 90 |
| 406 | 3300049741 | Ga0501079_0077688 | Ga0501079_0077688_1633_1905 | 90 |
| 407 | 3300049741 | Ga0501079_0139611 | Ga0501079_0139611_1088_1372 | 90 |
| 408 | 3300049741 | Ga0501079_0352880 | Ga0501079_0352880_663_935 | 90 |
| 409 | 3300049741 | Ga0501079_0387821 | Ga0501079_0387821_437_721 | 90 |
| 410 | 3300049742 | Ga0501080_0211407 | Ga0501080_0211407_729_1001 | 90 |
| 411 | 3300049742 | Ga0501080_0232990 | Ga0501080_0232990_833_1117 | 90 |
| 412 | 3300049742 | Ga0501080_0821576 | Ga0501080_0821576_220_492 | 90 |
| 413 | 3300049742 | Ga0501080_1208029 | Ga0501080_1208029_219_491 | 90 |
| 414 | 3300049743 | Ga0501081_0036584 | Ga0501081_0036584_2918_3202 | 90 |
| 415 | 3300049743 | Ga0501081_0119321 | Ga0501081_0119321_268_552 | 90 |
| 416 | 3300049743 | Ga0501081_0295357 | Ga0501081_0295357_598_870 | 90 |
| 417 | 3300049743 | Ga0501081_0347512 | Ga0501081_0347512_370_642 | 90 |
| 418 | 3300049743 | Ga0501081_0371529 | Ga0501081_0371529_340_612 | 90 |
| 419 | 3300049743 | Ga0501081_0502870 | Ga0501081_0502870_56_340 | 90 |
| 420 | 3300049767 | Ga0501270_069460 | Ga0501270_069460_369_641 | 90 |
| 421 | 3300049822 | Ga0501035_1097250 | Ga0501035_1097250_289_561 | 90 |
| 422 | 3300049823 | Ga0501044_1336677 | Ga0501044_1336677_53_337 | 90 |
| 423 | 3300049823 | Ga0501044_1628064 | Ga0501044_1628064_156_428 | 90 |
| 424 | 3300049824 | Ga0501045_0026214 | Ga0501045_0026214_1050_1334 | 90 |
| 425 | 3300049824 | Ga0501045_0212114 | Ga0501045_0212114_726_998 | 90 |
| 426 | 3300049824 | Ga0501045_0288839 | Ga0501045_0288839_334_606 | 90 |
| 427 | 3300049824 | Ga0501045_0642537 | Ga0501045_0642537_159_431 | 90 |
| 428 | 3300050507 | nmdc:mga05p37_221260_c1 | nmdc:mga05p37_221260_c1_429_701 | 90 |
| 429 | 3300050507 | nmdc:mga05p37_893748_c1 | nmdc:mga05p37_893748_c1_302_574 | 90 |
| 430 | 3300050510 | nmdc:mga06r32_395639_c1 | nmdc:mga06r32_395639_c1_846_1118 | 90 |
| 431 | 3300050511 | nmdc:mga08y16_190706_c1 | nmdc:mga08y16_190706_c1_831_1103 | 90 |
| 432 | 3300050511 | nmdc:mga08y16_239947_c1 | nmdc:mga08y16_239947_c1_470_742 | 90 |
| 433 | 3300050511 | nmdc:mga08y16_980943_c1 | nmdc:mga08y16_980943_c1_434_706 | 90 |
| 434 | 3300050512 | nmdc:mga0n895_51529_c1 | nmdc:mga0n895_51529_c1_2300_2572 | 90 |
| 435 | 3300050513 | nmdc:mga0rr50_116696_c1 | nmdc:mga0rr50_116696_c1_1653_1925 | 90 |
| 436 | 3300050513 | nmdc:mga0rr50_242902_c1 | nmdc:mga0rr50_242902_c1_720_992 | 90 |
| 437 | 3300050513 | nmdc:mga0rr50_931374_c1 | nmdc:mga0rr50_931374_c1_273_545 | 90 |
| 438 | 3300050514 | nmdc:mga08x19_148064_c1 | nmdc:mga08x19_148064_c1_744_1016 | 90 |
| 439 | 3300050515 | nmdc:mga0a205_425056_c1 | nmdc:mga0a205_425056_c1_853_1125 | 90 |
| 440 | 3300050515 | nmdc:mga0a205_79891_c1 | nmdc:mga0a205_79891_c1_2596_2868 | 90 |
| 441 | 3300050515 | nmdc:mga0a205_812978_c1 | nmdc:mga0a205_812978_c1_321_593 | 90 |
| 442 | 3300053077 | Ga0495601_0017799 | Ga0495601_0017799_1098_1370 | 90 |
| 443 | 3300053078 | Ga0495612_0000038 | Ga0495612_0000038_28629_28901 | 90 |
| 444 | 3300053078 | Ga0495612_0083122 | Ga0495612_0083122_335_607 | 90 |
| 445 | 3300053084 | Ga0495595_0045150 | Ga0495595_0045150_1071_1343 | 90 |
| 446 | 3300053084 | Ga0495595_0173556 | Ga0495595_0173556_505_777 | 90 |
| 447 | 3300053085 | Ga0495619_0162759 | Ga0495619_0162759_965_1237 | 90 |
| 448 | 3300054114 | Ga0501084_0020040 | Ga0501084_0020040_5016_5300 | 90 |
| 449 | 3300054114 | Ga0501084_0081838 | Ga0501084_0081838_1533_1805 | 90 |
| 450 | 3300054114 | Ga0501084_0090840 | Ga0501084_0090840_2169_2453 | 90 |
| 451 | 3300054114 | Ga0501084_0290605 | Ga0501084_0290605_607_879 | 90 |
| 452 | 3300054114 | Ga0501084_0307554 | Ga0501084_0307554_517_789 | 90 |
| 453 | 3300054114 | Ga0501084_0872842 | Ga0501084_0872842_301_573 | 90 |
| 454 | 3300059423 | Ga0590074_009669 | Ga0590074_009669_1127_1399 | 90 |
| 455 | 3300059424 | Ga0590075_010118 | Ga0590075_010118_960_1232 | 90 |
| 456 | 3300060353 | Ga0501082_0080617 | Ga0501082_0080617_1320_1604 | 90 |
| 457 | 3300060353 | Ga0501082_0652425 | Ga0501082_0652425_117_389 | 90 |
| 458 | 3300060353 | Ga0501082_0655699 | Ga0501082_0655699_515_787 | 90 |
| 459 | 3300060353 | Ga0501082_0902750 | Ga0501082_0902750_67_339 | 90 |
| 460 | 3300061734 | Ga0530510_0015123 | Ga0530510_0015123_1062_1334 | 90 |
| 461 | 3300061734 | Ga0530510_0049143 | Ga0530510_0049143_756_1040 | 90 |
| 462 | 3300061734 | Ga0530510_0080057 | Ga0530510_0080057_1690_1974 | 90 |
| 463 | 3300061734 | Ga0530510_1086134 | Ga0530510_1086134_187_471 | 90 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8pv6-assembly1.cif.gz_LA | chaetomium thermophilum pre-60s state 3 - post-5s rotation with rix1 complex with foot - composite structure | 0.6396 | 63 | 89 |
| 5zr6-assembly1.cif.gz_B | manganese-dependent transcriptional repressor complex with manganese | 0.6353 | 61 | 89 |
| 5zr6-assembly1.cif.gz_A | manganese-dependent transcriptional repressor complex with manganese | 0.6263 | 61 | 90 |
| 1g5v-assembly1.cif.gz_A | solution structure of the tudor domain of the human smn protein | 0.6176 | 52 | 90 |
| 3hru-assembly1.cif.gz_A | crystal structure of scar with bound zn2+ | 0.6103 | 61 | 90 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6Y1Q2_151_228_2.30.30.90 | Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) | 0.6511 | 61 | 90 | 2.30.30.90 |
| af_Q6Z3Y5_52_136_2.30.30.140 | Mainly Beta;Roll;SH3 type barrels.; | 0.6411 | 52 | 90 | 2.30.30.140 |
| af_Q9C5X4_207_256_2.30.30.140 | Mainly Beta;Roll;SH3 type barrels.; | 0.6239 | 55 | 90 | 2.30.30.140 |
| 1g5vA00 | Mainly Beta;Roll;SH3 type barrels.; | 0.6176 | 52 | 90 | 2.30.30.140 |
| af_Q4DW33_797_931_3.90.70.30 | Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Phytochelatin synthase, N-terminal domain | 0.6139 | 63 | 90 | 3.90.70.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6J4TD14-F1-model_v4 | Uncharacterized protein | 0.9171 | 24 | 90 |
|
| AF-A0A1F8S927-F1-model_v4 | Uncharacterized protein | 0.9129 | 1 | 90 |
|
| AF-A0A521RZM6-F1-model_v4 | Uncharacterized protein | 0.9111 | 1 | 90 |
|
| AF-A0A1F8S927-F1-model_v4 | Uncharacterized protein | 0.9031 | 1 | 90 |
|
| AF-A0A6J4TD14-F1-model_v4 | Uncharacterized protein | 0.8919 | 24 | 90 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar