F449138

General Info

Members Datasets Scaffolds Average Seq Length
463 275 463 90

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0484409|Ga0316574_0484409_456_746
Length 96
Sequence VSSNVSQNYPYSSESEAARAAAVTAAFSANEGLQEKVEAESTPLGDVQPADHGAPVTWWIWVCHACIVGRLHVAGYARDRHAVYTVCDKCGQTSLR

Samples

Sample ID Description Type Environment
1 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
152 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
162 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
163 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
164 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
165 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
168 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
176 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
177 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
178 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
179 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
180 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
181 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
182 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
183 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
191 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
192 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
193 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
194 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
199 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
200 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
201 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
202 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
203 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
204 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
213 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
244 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
245 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
246 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
247 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
248 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
249 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
250 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
251 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
252 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
269 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
273 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 3.89
Rhizosphere 95.46
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10017991 3300002077 Unclassified 1402
2 JGI24033J26618_1029978 3300002155 Unclassified 729
3 JGI24034J26672_10100102 3300002239 Bacteria 546
4 JGI25406J46586_10027042 3300003203 Bacteria 2205
5 rootL2_10230045 3300003322 Unclassified 1112
6 Ga0070676_10376871 3300005328 Bacteria 981
7 Ga0070676_10600223 3300005328 Unclassified 794
8 Ga0070683_100173427 3300005329 Unclassified 2047
9 Ga0070683_100395975 3300005329 Unclassified 1317
10 Ga0070690_100114866 3300005330 Bacteria 1801
11 Ga0070670_100342454 3300005331 Bacteria 1313
12 Ga0070677_10562541 3300005333 Archaea 626
13 Ga0068869_101093839 3300005334 Bacteria 697
14 Ga0070666_10800500 3300005335 Bacteria 694
15 Ga0070680_100488093 3300005336 Unclassified 1053
16 Ga0070682_100012609 3300005337 Bacteria 4849
17 Ga0070682_100036972 3300005337 Bacteria 2987
18 Ga0068868_100137613 3300005338 Bacteria 2003
19 Ga0070660_100024235 3300005339 Bacteria 4502
20 Ga0070689_100078025 3300005340 Unclassified 2596
21 Ga0070687_100002534 3300005343 Bacteria 6882
22 Ga0070661_100324372 3300005344 Bacteria 1203
23 Ga0070692_10019368 3300005345 Bacteria 3284
24 Ga0070668_100140729 3300005347 Bacteria 1944
25 Ga0070668_100519510 3300005347 Unclassified 1033
26 Ga0070669_100404151 3300005353 Bacteria 1118
27 Ga0070675_100036549 3300005354 Bacteria 3998
28 Ga0070674_100001461 3300005356 Bacteria 12594
29 Ga0070674_100007430 3300005356 Bacteria 6463
30 Ga0070673_100017805 3300005364 Bacteria 5063
31 Ga0070673_101017675 3300005364 Bacteria 772
32 Ga0070688_100088312 3300005365 Bacteria 2021
33 Ga0070659_100215447 3300005366 Unclassified 1583
34 Ga0070713_100978467 3300005436 Bacteria 816
35 Ga0070713_102129272 3300005436 Unclassified 544
36 Ga0070701_10079006 3300005438 Unclassified 1777
37 Ga0070705_100433431 3300005440 Unclassified 982
38 Ga0070705_100616986 3300005440 Bacteria 841
39 Ga0070705_101579021 3300005440 Bacteria 552
40 Ga0070700_100064761 3300005441 Bacteria 2315
41 Ga0070700_100115488 3300005441 Unclassified 1791
42 Ga0070700_100146689 3300005441 Bacteria 1609
43 Ga0070694_100058793 3300005444 Bacteria 2616
44 Ga0070694_100694550 3300005444 Bacteria 827
45 Ga0070694_101304007 3300005444 Unclassified 611
46 Ga0070694_101583979 3300005444 Unclassified 555
47 Ga0070708_100021184 3300005445 Bacteria 5493
48 Ga0070708_100021271 3300005445 Bacteria 5483
49 Ga0070708_100025853 3300005445 Bacteria 5020
50 Ga0070708_100326255 3300005445 Bacteria 1446
51 Ga0070663_100106348 3300005455 Bacteria 2102
52 Ga0070663_100986261 3300005455 Bacteria 732
53 Ga0070678_100070393 3300005456 Bacteria 2615
54 Ga0070678_100614454 3300005456 Bacteria 972
55 Ga0070662_100123376 3300005457 Bacteria 1988
56 Ga0070681_11411413 3300005458 Bacteria 620
57 Ga0068867_100011299 3300005459 Bacteria 6299
58 Ga0068867_100104691 3300005459 Bacteria 2166
59 Ga0068867_100160936 3300005459 Bacteria 1770
60 Ga0068867_100619474 3300005459 Unclassified 946
61 Ga0068867_101538248 3300005459 Unclassified 620
62 Ga0070685_10012464 3300005466 Bacteria 4467
63 Ga0070685_10356086 3300005466 Unclassified 1002
64 Ga0070706_100050898 3300005467 Bacteria 3822
65 Ga0070706_100607812 3300005467 Unclassified 1016
66 Ga0070706_100640497 3300005467 Archaea 987
67 Ga0070706_100822885 3300005467 Unclassified 859
68 Ga0070707_100001009 3300005468 Bacteria 27892
69 Ga0070707_100026690 3300005468 Bacteria 5486
70 Ga0070707_100036581 3300005468 Bacteria 4684
71 Ga0070707_100795352 3300005468 Unclassified 909
72 Ga0070698_100151294 3300005471 Bacteria 2268
73 Ga0070699_100028561 3300005518 Archaea 4810
74 Ga0070699_100032705 3300005518 Bacteria 4492
75 Ga0070699_100063885 3300005518 Bacteria 3192
76 Ga0070699_100942395 3300005518 Unclassified 791
77 Ga0070679_100820248 3300005530 Bacteria 873
78 Ga0070684_100035666 3300005535 Bacteria 4258
79 Ga0070684_100381444 3300005535 Unclassified 1298
80 Ga0070697_100021612 3300005536 Bacteria 5100
81 Ga0070697_100561774 3300005536 Unclassified 1001
82 Ga0070697_101047462 3300005536 Bacteria 726
83 Ga0068853_100972563 3300005539 Bacteria 817
84 Ga0070672_102061216 3300005543 Bacteria 514
85 Ga0070686_100007488 3300005544 Bacteria 6092
86 Ga0070695_100021965 3300005545 Bacteria 3910
87 Ga0070695_100023249 3300005545 Bacteria 3807
88 Ga0070695_100222412 3300005545 Bacteria 1361
89 Ga0070695_100669695 3300005545 Unclassified 821
90 Ga0070696_100063003 3300005546 Bacteria 2597
91 Ga0070696_100340970 3300005546 Unclassified 1158
92 Ga0070693_100039445 3300005547 Bacteria 2645
93 Ga0070693_101119777 3300005547 Bacteria 601
94 Ga0070704_100052164 3300005549 Bacteria 2884
95 Ga0070704_100056808 3300005549 Bacteria 2780
96 Ga0070704_100262294 3300005549 Unclassified 1424
97 Ga0070664_100291888 3300005564 Bacteria 1472
98 Ga0068857_100137377 3300005577 Unclassified 2207
99 Ga0068854_100007542 3300005578 Bacteria 6952
100 Ga0068854_101985439 3300005578 Bacteria 536
101 Ga0070702_100002645 3300005615 Bacteria 7810
102 Ga0070702_100754558 3300005615 Unclassified 748
103 Ga0068852_100157380 3300005616 Bacteria 2118
104 Ga0068859_100172981 3300005617 Unclassified 2241
105 Ga0068859_100419157 3300005617 Bacteria 1435
106 Ga0068864_100014152 3300005618 Bacteria 6621
107 Ga0068866_10011362 3300005718 Bacteria 3850
108 Ga0068861_100119568 3300005719 Unclassified 2123
109 Ga0068861_100415824 3300005719 Bacteria 1197
110 Ga0068851_10552038 3300005834 Unclassified 696
111 Ga0068870_10229625 3300005840 Bacteria 1140
112 Ga0068870_10706283 3300005840 Unclassified 696
113 Ga0068863_100743416 3300005841 Unclassified 976
114 Ga0068858_100268694 3300005842 Bacteria 1622
115 Ga0068860_100073876 3300005843 Bacteria 3241
116 Ga0068860_101758946 3300005843 Unclassified 642
117 Ga0068862_100321359 3300005844 Unclassified 1429
118 Ga0081539_10003460 3300005985 Bacteria 19336
119 Ga0075365_10066178 3300006038 Bacteria 2424
120 Ga0075432_10287323 3300006058 Bacteria 679
121 Ga0075428_100898310 3300006844 Bacteria 940
122 Ga0075431_100406993 3300006847 Bacteria 1361
123 Ga0075431_101171791 3300006847 Bacteria 732
124 Ga0075433_10008221 3300006852 Bacteria 8313
125 Ga0075433_10413449 3300006852 Bacteria 1190
126 Ga0075433_10505540 3300006852 Bacteria 1063
127 Ga0075434_100529599 3300006871 Bacteria 1199
128 Ga0075434_101692566 3300006871 Unclassified 640
129 Ga0068865_100003323 3300006881 Bacteria 9635
130 Ga0075436_100359650 3300006914 Bacteria 1050
131 Ga0097620_100172996 3300006931 Unclassified 2241
132 Ga0097620_100419108 3300006931 Bacteria 1435
133 Ga0075435_100275175 3300007076 Unclassified 1437
134 Ga0075435_100719912 3300007076 Bacteria 868
135 Ga0105251_10274053 3300009011 Unclassified 762
136 Ga0105244_10094482 3300009036 Bacteria 1468
137 Ga0111539_10020328 3300009094 Bacteria 8178
138 Ga0111539_10117766 3300009094 Bacteria 3113
139 Ga0111539_10913438 3300009094 Unclassified 1021
140 Ga0105245_10026836 3300009098 Bacteria 5071
141 Ga0105245_10733264 3300009098 Unclassified 1023
142 Ga0105247_10398576 3300009101 Bacteria 980
143 Ga0114129_10446219 3300009147 Bacteria 1697
144 Ga0114129_10979224 3300009147 Bacteria 1066
145 Ga0105243_10073588 3300009148 Bacteria 2769
146 Ga0105243_10901361 3300009148 Unclassified 880
147 Ga0105243_11354425 3300009148 Bacteria 731
148 Ga0105242_10019629 3300009176 Bacteria 5298
149 Ga0105242_10540592 3300009176 Bacteria 1115
150 Ga0105242_11870444 3300009176 Unclassified 640
151 Ga0105248_10337716 3300009177 Unclassified 1696
152 Ga0105248_11826080 3300009177 Bacteria 689
153 Ga0105237_10303552 3300009545 Bacteria 1599
154 Ga0105238_10835521 3300009551 Bacteria 938
155 Ga0105249_10011568 3300009553 Bacteria 7754
156 Ga0105249_10577604 3300009553 Unclassified 1177
157 Ga0105249_10895749 3300009553 Unclassified 954
158 Ga0099796_10332410 3300010159 Unclassified 651
159 Ga0099796_10574615 3300010159 Unclassified 507
160 Ga0105239_10036633 3300010375 Bacteria 5385
161 Ga0105246_10176212 3300011119 Bacteria 1642
162 Ga0105246_12447808 3300011119 Unclassified 513
163 Ga0157378_10021356 3300013297 Bacteria 5692
164 Ga0163162_10933670 3300013306 Bacteria 979
165 Ga0163162_12024273 3300013306 Unclassified 660
166 Ga0157372_13366306 3300013307 Bacteria 509
167 Ga0157375_10008137 3300013308 Bacteria 9175
168 Ga0157375_10898729 3300013308 Bacteria 1030
169 Ga0163163_10018899 3300014325 Bacteria 6465
170 Ga0163163_10477786 3300014325 Unclassified 1307
171 Ga0163163_10805815 3300014325 Unclassified 1003
172 Ga0157380_10016123 3300014326 Bacteria 5504
173 Ga0157380_10182771 3300014326 Bacteria 1844
174 Ga0157377_10001871 3300014745 Bacteria 9216
175 Ga0157379_10059263 3300014968 Bacteria 3423
176 Ga0157376_10958911 3300014969 Unclassified 876
177 Ga0207697_10104681 3300025315 Bacteria 1209
178 Ga0207642_10060743 3300025899 Unclassified 1754
179 Ga0207710_10320223 3300025900 Bacteria 786
180 Ga0207688_10242661 3300025901 Unclassified 1090
181 Ga0207645_10266169 3300025907 Unclassified 1136
182 Ga0207645_10681526 3300025907 Bacteria 698
183 Ga0207643_10004561 3300025908 Bacteria 7443
184 Ga0207684_10022072 3300025910 Bacteria 5436
185 Ga0207684_10403686 3300025910 Archaea 1175
186 Ga0207660_10439840 3300025917 Unclassified 1054
187 Ga0207662_10012310 3300025918 Bacteria 4761
188 Ga0207657_10023977 3300025919 Bacteria 5665
189 Ga0207657_11221383 3300025919 Unclassified 571
190 Ga0207649_10524376 3300025920 Bacteria 903
191 Ga0207646_10002036 3300025922 Bacteria 24288
192 Ga0207646_10012048 3300025922 Bacteria 8327
193 Ga0207646_10016705 3300025922 Bacteria 6884
194 Ga0207646_11734832 3300025922 Unclassified 536
195 Ga0207681_10024491 3300025923 Bacteria 3875
196 Ga0207694_10077664 3300025924 Bacteria 2602
197 Ga0207650_10062714 3300025925 Bacteria 2778
198 Ga0207659_10399537 3300025926 Bacteria 1149
199 Ga0207687_10901767 3300025927 Unclassified 756
200 Ga0207706_10035925 3300025933 Bacteria 4403
201 Ga0207686_10016970 3300025934 Bacteria 4093
202 Ga0207709_10016662 3300025935 Bacteria 4090
203 Ga0207709_10679351 3300025935 Unclassified 822
204 Ga0207709_11272139 3300025935 Unclassified 607
205 Ga0207670_10656674 3300025936 Bacteria 865
206 Ga0207669_10030336 3300025937 Bacteria 3004
207 Ga0207669_10033555 3300025937 Unclassified 2898
208 Ga0207669_10168542 3300025937 Unclassified 1556
209 Ga0207704_10267625 3300025938 Bacteria 1292
210 Ga0207691_11687880 3300025940 Unclassified 513
211 Ga0207661_11164649 3300025944 Unclassified 710
212 Ga0207661_11711926 3300025944 Unclassified 574
213 Ga0207679_10023805 3300025945 Bacteria 4192
214 Ga0207651_10651955 3300025960 Bacteria 924
215 Ga0207712_10615472 3300025961 Unclassified 941
216 Ga0207668_10394879 3300025972 Bacteria 1168
217 Ga0207668_10601775 3300025972 Unclassified 958
218 Ga0207640_10018979 3300025981 Bacteria 4052
219 Ga0207640_10875684 3300025981 Bacteria 783
220 Ga0207677_10545879 3300026023 Unclassified 1009
221 Ga0207703_10028330 3300026035 Bacteria 4415
222 Ga0207639_11070336 3300026041 Bacteria 756
223 Ga0207678_10021470 3300026067 Bacteria 5661
224 Ga0207708_10003005 3300026075 Bacteria 12424
225 Ga0207708_10058992 3300026075 Bacteria 2928
226 Ga0207708_10092031 3300026075 Bacteria 2339
227 Ga0207641_10595179 3300026088 Unclassified 1082
228 Ga0207648_10003422 3300026089 Bacteria 16653
229 Ga0207648_10227771 3300026089 Bacteria 1658
230 Ga0207648_10303772 3300026089 Bacteria 1431
231 Ga0207676_10243515 3300026095 Unclassified 1615
232 Ga0207676_10341602 3300026095 Unclassified 1381
233 Ga0207674_10009525 3300026116 Bacteria 11085
234 Ga0207675_100038773 3300026118 Bacteria 4446
235 Ga0207683_10015985 3300026121 Bacteria 6386
236 Ga0207683_10393981 3300026121 Bacteria 1274
237 Ga0207683_11026919 3300026121 Bacteria 765
238 Ga0207698_10226283 3300026142 Bacteria 1694
239 Ga0209998_10025011 3300027717 Bacteria 1299
240 Ga0207428_10272781 3300027907 Unclassified 1257
241 Ga0268266_10387225 3300028379 Bacteria 1320
242 Ga0268265_10464531 3300028380 Bacteria 1185
243 Ga0268264_10092179 3300028381 Unclassified 2615
244 Ga0268264_12011677 3300028381 Unclassified 587
245 Ga0265337_1010279 3300028556 Unclassified 3286
246 Ga0316576_10032170 3300031727 Bacteria 3727
247 Ga0307405_10055016 3300031731 Bacteria 2488
248 Ga0307405_10170464 3300031731 Bacteria 1552
249 Ga0307410_10170401 3300031852 Bacteria 1640
250 Ga0307410_10178821 3300031852 Unclassified 1604
251 Ga0307406_10169796 3300031901 Unclassified 1577
252 Ga0307406_10563964 3300031901 Unclassified 933
253 Ga0307407_10430220 3300031903 Unclassified 953
254 Ga0307412_10199536 3300031911 Unclassified 1518
255 Ga0307412_11579590 3300031911 Unclassified 598
256 Ga0307409_100030286 3300031995 Bacteria 3886
257 Ga0307409_100325000 3300031995 Bacteria 1441
258 Ga0307416_100002960 3300032002 Bacteria 9902
259 Ga0307416_101386972 3300032002 Viruses 808
260 Ga0307415_100009017 3300032126 Bacteria 5564
261 Ga0307415_101144535 3300032126 Unclassified 730
262 Ga0373950_0046322 3300034818 Bacteria 844
263 Ga0373959_0039341 3300034820 Unclassified 986
264 Ga0373928_0129327 3300035084 Bacteria 683
265 Ga0373929_0084312 3300035085 Unclassified 779
266 Ga0373941_0244853 3300035115 Bacteria 698
267 Ga0373943_0635320 3300035170 Bacteria 630
268 Ga0373962_0057454 3300035242 Unclassified 1135
269 Ga0316574_0484409 3300035398 Bacteria 773
270 Ga0373931_0227053 3300035691 Unclassified 1126
271 Ga0373935_1485995 3300035692 Unclassified 507
272 Ga0373937_1608042 3300036401 Bacteria 597
273 Ga0395899_0837354 3300037312 Unclassified 566
274 Ga0395905_1624125 3300037471 Unclassified 551
275 Ga0395901_0202427 3300038443 Unclassified 2081
276 Ga0395901_0564705 3300038443 Unclassified 1152
277 Ga0395901_1611586 3300038443 Unclassified 602
278 Ga0451841_1258803 3300041498 Bacteria 540
279 Ga0439441_023056 3300042001 Bacteria 1161
280 Ga0439448_0233382 3300042005 Bacteria 648
281 Ga0450905_091397 3300042142 Unclassified 538
282 Ga0450910_013640 3300042147 Bacteria 1184
283 Ga0439458_0069317 3300042157 Bacteria 889
284 Ga0439459_0119647 3300042438 Unclassified 663
285 Ga0439440_0141668 3300042993 Unclassified 683
286 Ga0466972_0141854 3300044658 Unclassified 1131
287 Ga0466968_0073517 3300044735 Bacteria 1492
288 Ga0466960_0402086 3300044901 Unclassified 789
289 Ga0451576_2630143 3300045051 Unclassified 513
290 Ga0495641_0081293 3300046461 Bacteria 1451
291 Ga0495651_0019074 3300046462 Bacteria 5315
292 Ga0495653_0160494 3300046463 Bacteria 1561
293 Ga0495639_0633335 3300046475 Bacteria 551
294 Ga0495662_0083556 3300046476 Bacteria 1554
295 Ga0495664_0192132 3300046477 Bacteria 1237
296 Ga0495596_0400014 3300046500 Unclassified 535
297 Ga0495608_0512855 3300046511 Unclassified 725
298 Ga0495618_0156439 3300046514 Bacteria 1455
299 Ga0495628_0094295 3300046516 Bacteria 2314
300 Ga0495628_0566542 3300046516 Bacteria 814
301 Ga0495630_0345100 3300046517 Bacteria 1139
302 Ga0495630_1330737 3300046517 Unclassified 541
303 Ga0495637_0361299 3300046520 Archaea 508
304 Ga0495640_0027776 3300046533 Bacteria 4078
305 Ga0495587_0265827 3300046536 Unclassified 963
306 Ga0495609_0409999 3300046538 Archaea 542
307 Ga0495621_0536677 3300046539 Unclassified 507
308 Ga0495633_0564965 3300046558 Unclassified 512
309 Ga0495667_0674549 3300046559 Archaea 641
310 Ga0495667_0705064 3300046559 Unclassified 625
311 Ga0495635_0249373 3300046663 Bacteria 1197
312 Ga0495659_0144497 3300046664 Unclassified 952
313 Ga0495657_0174349 3300046675 Bacteria 1323
314 Ga0495657_0362362 3300046675 Bacteria 857
315 Ga0495657_0733689 3300046675 Unclassified 567
316 Ga0495599_0590593 3300046678 Bacteria 647
317 Ga0495623_0161615 3300046679 Unclassified 1316
318 Ga0495613_0357524 3300046689 Bacteria 1002
319 Ga0495624_0202939 3300046690 Bacteria 1204
320 Ga0495670_0572218 3300046691 Unclassified 615
321 Ga0495600_0172165 3300046809 Bacteria 1397
322 Ga0495604_0224544 3300047317 Bacteria 1291
323 Ga0495674_0376955 3300047319 Bacteria 1148
324 Ga0495674_0488743 3300047319 Archaea 986
325 Ga0495680_0102568 3300047322 Bacteria 2130
326 Ga0495684_0141457 3300047471 Bacteria 1804
327 Ga0495593_0205231 3300047673 Bacteria 990
328 Ga0495602_0246172 3300048088 Bacteria 1335
329 Ga0496100_0705906 3300048903 Bacteria 787
330 Ga0496101_0068185 3300048904 Unclassified 2600
331 Ga0496101_0148286 3300048904 Bacteria 1793
332 Ga0496102_0104013 3300048905 Bacteria 2641
333 Ga0496102_0116152 3300048905 Bacteria 2497
334 Ga0496102_0244132 3300048905 Bacteria 1693
335 Ga0496102_1062333 3300048905 Bacteria 730
336 Ga0496103_0214486 3300048906 Bacteria 1238
337 Ga0496106_0117047 3300048909 Bacteria 2079
338 Ga0496106_0919368 3300048909 Bacteria 690
339 Ga0496108_0139343 3300048911 Unclassified 2089
340 Ga0496109_0117680 3300048912 Unclassified 2474
341 Ga0496109_1000808 3300048912 Bacteria 773
342 Ga0496111_0129419 3300048914 Bacteria 1867
343 Ga0496112_0075314 3300048915 Unclassified 3338
344 Ga0496112_1883124 3300048915 Bacteria 510
345 Ga0496113_0042521 3300048916 Bacteria 3359
346 Ga0496114_0721933 3300048917 Bacteria 873
347 Ga0501031_0151233 3300049568 Unclassified 1517
348 Ga0501031_0235193 3300049568 Bacteria 1192
349 Ga0501032_0412654 3300049569 Bacteria 867
350 Ga0501036_0020106 3300049572 Bacteria 5606
351 Ga0501037_0449708 3300049573 Unclassified 879
352 Ga0501037_0615889 3300049573 Bacteria 728
353 Ga0501037_0629348 3300049573 Unclassified 719
354 Ga0501037_0720238 3300049573 Bacteria 663
355 Ga0501038_0435746 3300049574 Unclassified 1010
356 Ga0501038_0735699 3300049574 Bacteria 737
357 Ga0501039_0063103 3300049575 Bacteria 2871
358 Ga0501039_0140789 3300049575 Bacteria 1895
359 Ga0501039_0996963 3300049575 Bacteria 651
360 Ga0501040_0008058 3300049576 Bacteria 6843
361 Ga0501040_0452559 3300049576 Bacteria 924
362 Ga0501040_0533984 3300049576 Unclassified 846
363 Ga0501040_0661459 3300049576 Bacteria 755
364 Ga0501040_0899616 3300049576 Bacteria 641
365 Ga0501041_0251402 3300049577 Bacteria 1111
366 Ga0501041_0511217 3300049577 Bacteria 764
367 Ga0501041_0667304 3300049577 Unclassified 665
368 Ga0501042_0461868 3300049578 Bacteria 921
369 Ga0501042_1338060 3300049578 Bacteria 522
370 Ga0501042_1423607 3300049578 Bacteria 506
371 Ga0501043_1097860 3300049579 Bacteria 562
372 Ga0501046_0344387 3300049580 Bacteria 1083
373 Ga0501046_1148961 3300049580 Unclassified 535
374 Ga0501048_0150187 3300049582 Bacteria 1648
375 Ga0501048_0397226 3300049582 Bacteria 985
376 Ga0501048_0640137 3300049582 Bacteria 763
377 Ga0501048_0693586 3300049582 Unclassified 731
378 Ga0501048_0869490 3300049582 Unclassified 648
379 Ga0501068_0401656 3300049584 Bacteria 884
380 Ga0501068_0419878 3300049584 Unclassified 864
381 Ga0501069_0048314 3300049585 Unclassified 2363
382 Ga0501071_0160917 3300049587 Bacteria 1678
383 Ga0501071_0452814 3300049587 Bacteria 982
384 Ga0501071_0568508 3300049587 Archaea 871
385 Ga0501072_0039219 3300049588 Bacteria 3719
386 Ga0501072_0175200 3300049588 Bacteria 1711
387 Ga0501072_0477579 3300049588 Unclassified 986
388 Ga0501072_0615837 3300049588 Unclassified 855
389 Ga0501073_0643487 3300049589 Bacteria 732
390 Ga0501074_1126309 3300049590 Viruses 551
391 Ga0501074_1314408 3300049590 Bacteria 507
392 Ga0501075_0121984 3300049591 Unclassified 1984
393 Ga0501075_0397648 3300049591 Unclassified 1050
394 Ga0501075_0454804 3300049591 Bacteria 976
395 Ga0501075_0546499 3300049591 Bacteria 884
396 Ga0501075_1110678 3300049591 Bacteria 600
397 Ga0501076_0020659 3300049592 Bacteria 5042
398 Ga0501076_0153112 3300049592 Bacteria 1876
399 Ga0501076_0156324 3300049592 Bacteria 1856
400 Ga0501076_0466284 3300049592 Bacteria 1040
401 Ga0501076_1084512 3300049592 Bacteria 659
402 Ga0501076_1520891 3300049592 Bacteria 549
403 Ga0501077_0358004 3300049593 Bacteria 932
404 Ga0501077_1149267 3300049593 Bacteria 500
405 Ga0501202_057959 3300049652 Unclassified 870
406 Ga0501079_0077688 3300049741 Bacteria 2568
407 Ga0501079_0139611 3300049741 Bacteria 1887
408 Ga0501079_0352880 3300049741 Bacteria 1152
409 Ga0501079_0387821 3300049741 Bacteria 1095
410 Ga0501080_0211407 3300049742 Unclassified 1778
411 Ga0501080_0232990 3300049742 Bacteria 1683
412 Ga0501080_0821576 3300049742 Unclassified 814
413 Ga0501080_1208029 3300049742 Bacteria 650
414 Ga0501081_0036584 3300049743 Bacteria 3348
415 Ga0501081_0119321 3300049743 Bacteria 1877
416 Ga0501081_0295357 3300049743 Unclassified 1188
417 Ga0501081_0347512 3300049743 Bacteria 1093
418 Ga0501081_0371529 3300049743 Unclassified 1056
419 Ga0501081_0502870 3300049743 Bacteria 903
420 Ga0501270_069460 3300049767 Viruses 678
421 Ga0501035_1097250 3300049822 Unclassified 622
422 Ga0501044_1336677 3300049823 Bacteria 583
423 Ga0501044_1628064 3300049823 Unclassified 511
424 Ga0501045_0026214 3300049824 Bacteria 4191
425 Ga0501045_0212114 3300049824 Unclassified 1442
426 Ga0501045_0288839 3300049824 Unclassified 1220
427 Ga0501045_0642537 3300049824 Bacteria 784
428 nmdc:mga05p37_221260_c1 3300050507 Bacteria 2284
429 nmdc:mga05p37_893748_c1 3300050507 Bacteria 959
430 nmdc:mga06r32_395639_c1 3300050510 Bacteria 1364
431 nmdc:mga08y16_190706_c1 3300050511 Bacteria 2126
432 nmdc:mga08y16_239947_c1 3300050511 Bacteria 1874
433 nmdc:mga08y16_980943_c1 3300050511 Unclassified 826
434 nmdc:mga0n895_51529_c1 3300050512 Unclassified 4038
435 nmdc:mga0rr50_116696_c1 3300050513 Unclassified 2119
436 nmdc:mga0rr50_242902_c1 3300050513 Unclassified 1493
437 nmdc:mga0rr50_931374_c1 3300050513 Bacteria 741
438 nmdc:mga08x19_148064_c1 3300050514 Bacteria 1588
439 nmdc:mga0a205_425056_c1 3300050515 Bacteria 1190
440 nmdc:mga0a205_79891_c1 3300050515 Bacteria 3161
441 nmdc:mga0a205_812978_c1 3300050515 Bacteria 782
442 Ga0495601_0017799 3300053077 Bacteria 4317
443 Ga0495612_0000038 3300053078 Bacteria 63146
444 Ga0495612_0083122 3300053078 Bacteria 1347
445 Ga0495595_0045150 3300053084 Bacteria 2026
446 Ga0495595_0173556 3300053084 Bacteria 1068
447 Ga0495619_0162759 3300053085 Bacteria 1541
448 Ga0501084_0020040 3300054114 Bacteria 5576
449 Ga0501084_0081838 3300054114 Unclassified 2709
450 Ga0501084_0090840 3300054114 Bacteria 2564
451 Ga0501084_0290605 3300054114 Unclassified 1381
452 Ga0501084_0307554 3300054114 Bacteria 1339
453 Ga0501084_0872842 3300054114 Unclassified 757
454 Ga0590074_009669 3300059423 Bacteria 1607
455 Ga0590075_010118 3300059424 Bacteria 2268
456 Ga0501082_0080617 3300060353 Bacteria 2809
457 Ga0501082_0652425 3300060353 Bacteria 921
458 Ga0501082_0655699 3300060353 Bacteria 918
459 Ga0501082_0902750 3300060353 Unclassified 773
460 Ga0530510_0015123 3300061734 Bacteria 5450
461 Ga0530510_0049143 3300061734 Bacteria 3048
462 Ga0530510_0080057 3300061734 Bacteria 2377
463 Ga0530510_1086134 3300061734 Bacteria 613

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042147 Ga0450910_013640 Ga0450910_013640_224_532 77
2 3300031727 Ga0316576_10032170 Ga0316576_100321703 87
3 3300035398 Ga0316574_0484409 Ga0316574_0484409_456_746 87
4 3300028556 Ga0265337_1010279 Ga0265337_10102793 89
5 3300002077 JGI24744J21845_10017991 JGI24744J21845_100179912 90
6 3300002155 JGI24033J26618_1029978 JGI24033J26618_10299782 90
7 3300002239 JGI24034J26672_10100102 JGI24034J26672_101001022 90
8 3300003203 JGI25406J46586_10027042 JGI25406J46586_100270422 90
9 3300003322 rootL2_10230045 rootL2_102300452 90
10 3300005328 Ga0070676_10376871 Ga0070676_103768712 90
11 3300005328 Ga0070676_10600223 Ga0070676_106002231 90
12 3300005329 Ga0070683_100173427 Ga0070683_1001734273 90
13 3300005329 Ga0070683_100395975 Ga0070683_1003959751 90
14 3300005330 Ga0070690_100114866 Ga0070690_1001148661 90
15 3300005331 Ga0070670_100342454 Ga0070670_1003424542 90
16 3300005333 Ga0070677_10562541 Ga0070677_105625411 90
17 3300005334 Ga0068869_101093839 Ga0068869_1010938391 90
18 3300005335 Ga0070666_10800500 Ga0070666_108005001 90
19 3300005336 Ga0070680_100488093 Ga0070680_1004880932 90
20 3300005337 Ga0070682_100012609 Ga0070682_1000126091 90
21 3300005337 Ga0070682_100036972 Ga0070682_1000369725 90
22 3300005338 Ga0068868_100137613 Ga0068868_1001376132 90
23 3300005339 Ga0070660_100024235 Ga0070660_1000242354 90
24 3300005340 Ga0070689_100078025 Ga0070689_1000780252 90
25 3300005343 Ga0070687_100002534 Ga0070687_1000025347 90
26 3300005344 Ga0070661_100324372 Ga0070661_1003243722 90
27 3300005345 Ga0070692_10019368 Ga0070692_100193682 90
28 3300005347 Ga0070668_100140729 Ga0070668_1001407292 90
29 3300005347 Ga0070668_100519510 Ga0070668_1005195101 90
30 3300005353 Ga0070669_100404151 Ga0070669_1004041512 90
31 3300005354 Ga0070675_100036549 Ga0070675_1000365493 90
32 3300005356 Ga0070674_100001461 Ga0070674_1000014616 90
33 3300005356 Ga0070674_100007430 Ga0070674_1000074304 90
34 3300005364 Ga0070673_100017805 Ga0070673_1000178054 90
35 3300005364 Ga0070673_101017675 Ga0070673_1010176752 90
36 3300005365 Ga0070688_100088312 Ga0070688_1000883122 90
37 3300005366 Ga0070659_100215447 Ga0070659_1002154472 90
38 3300005436 Ga0070713_100978467 Ga0070713_1009784671 90
39 3300005436 Ga0070713_102129272 Ga0070713_1021292721 90
40 3300005438 Ga0070701_10079006 Ga0070701_100790061 90
41 3300005440 Ga0070705_100433431 Ga0070705_1004334312 90
42 3300005440 Ga0070705_100616986 Ga0070705_1006169862 90
43 3300005440 Ga0070705_101579021 Ga0070705_1015790211 90
44 3300005441 Ga0070700_100064761 Ga0070700_1000647612 90
45 3300005441 Ga0070700_100115488 Ga0070700_1001154882 90
46 3300005441 Ga0070700_100146689 Ga0070700_1001466893 90
47 3300005444 Ga0070694_100058793 Ga0070694_1000587936 90
48 3300005444 Ga0070694_100694550 Ga0070694_1006945501 90
49 3300005444 Ga0070694_101304007 Ga0070694_1013040071 90
50 3300005444 Ga0070694_101583979 Ga0070694_1015839791 90
51 3300005445 Ga0070708_100021184 Ga0070708_1000211844 90
52 3300005445 Ga0070708_100021271 Ga0070708_1000212713 90
53 3300005445 Ga0070708_100025853 Ga0070708_1000258533 90
54 3300005445 Ga0070708_100326255 Ga0070708_1003262552 90
55 3300005455 Ga0070663_100106348 Ga0070663_1001063482 90
56 3300005455 Ga0070663_100986261 Ga0070663_1009862612 90
57 3300005456 Ga0070678_100070393 Ga0070678_1000703934 90
58 3300005456 Ga0070678_100614454 Ga0070678_1006144542 90
59 3300005457 Ga0070662_100123376 Ga0070662_1001233764 90
60 3300005458 Ga0070681_11411413 Ga0070681_114114131 90
61 3300005459 Ga0068867_100011299 Ga0068867_1000112995 90
62 3300005459 Ga0068867_100104691 Ga0068867_1001046912 90
63 3300005459 Ga0068867_100160936 Ga0068867_1001609363 90
64 3300005459 Ga0068867_100619474 Ga0068867_1006194742 90
65 3300005459 Ga0068867_101538248 Ga0068867_1015382481 90
66 3300005466 Ga0070685_10012464 Ga0070685_100124642 90
67 3300005466 Ga0070685_10356086 Ga0070685_103560862 90
68 3300005467 Ga0070706_100050898 Ga0070706_1000508983 90
69 3300005467 Ga0070706_100607812 Ga0070706_1006078121 90
70 3300005467 Ga0070706_100640497 Ga0070706_1006404972 90
71 3300005467 Ga0070706_100822885 Ga0070706_1008228852 90
72 3300005468 Ga0070707_100001009 Ga0070707_1000010095 90
73 3300005468 Ga0070707_100026690 Ga0070707_1000266905 90
74 3300005468 Ga0070707_100036581 Ga0070707_1000365812 90
75 3300005468 Ga0070707_100795352 Ga0070707_1007953522 90
76 3300005471 Ga0070698_100151294 Ga0070698_1001512941 90
77 3300005518 Ga0070699_100028561 Ga0070699_1000285613 90
78 3300005518 Ga0070699_100032705 Ga0070699_1000327053 90
79 3300005518 Ga0070699_100063885 Ga0070699_1000638852 90
80 3300005518 Ga0070699_100942395 Ga0070699_1009423952 90
81 3300005530 Ga0070679_100820248 Ga0070679_1008202481 90
82 3300005535 Ga0070684_100035666 Ga0070684_1000356666 90
83 3300005535 Ga0070684_100381444 Ga0070684_1003814442 90
84 3300005536 Ga0070697_100021612 Ga0070697_1000216122 90
85 3300005536 Ga0070697_100561774 Ga0070697_1005617743 90
86 3300005536 Ga0070697_101047462 Ga0070697_1010474621 90
87 3300005539 Ga0068853_100972563 Ga0068853_1009725632 90
88 3300005543 Ga0070672_102061216 Ga0070672_1020612161 90
89 3300005544 Ga0070686_100007488 Ga0070686_1000074886 90
90 3300005545 Ga0070695_100021965 Ga0070695_1000219656 90
91 3300005545 Ga0070695_100023249 Ga0070695_1000232493 90
92 3300005545 Ga0070695_100222412 Ga0070695_1002224121 90
93 3300005545 Ga0070695_100669695 Ga0070695_1006696952 90
94 3300005546 Ga0070696_100063003 Ga0070696_1000630035 90
95 3300005546 Ga0070696_100340970 Ga0070696_1003409702 90
96 3300005547 Ga0070693_100039445 Ga0070693_1000394451 90
97 3300005547 Ga0070693_101119777 Ga0070693_1011197771 90
98 3300005549 Ga0070704_100052164 Ga0070704_1000521642 90
99 3300005549 Ga0070704_100056808 Ga0070704_1000568081 90
100 3300005549 Ga0070704_100262294 Ga0070704_1002622942 90
101 3300005564 Ga0070664_100291888 Ga0070664_1002918882 90
102 3300005577 Ga0068857_100137377 Ga0068857_1001373772 90
103 3300005578 Ga0068854_100007542 Ga0068854_1000075425 90
104 3300005578 Ga0068854_101985439 Ga0068854_1019854391 90
105 3300005615 Ga0070702_100002645 Ga0070702_1000026456 90
106 3300005615 Ga0070702_100754558 Ga0070702_1007545581 90
107 3300005616 Ga0068852_100157380 Ga0068852_1001573802 90
108 3300005617 Ga0068859_100172981 Ga0068859_1001729814 90
109 3300005617 Ga0068859_100419157 Ga0068859_1004191573 90
110 3300005618 Ga0068864_100014152 Ga0068864_1000141528 90
111 3300005718 Ga0068866_10011362 Ga0068866_100113625 90
112 3300005719 Ga0068861_100119568 Ga0068861_1001195684 90
113 3300005719 Ga0068861_100415824 Ga0068861_1004158242 90
114 3300005834 Ga0068851_10552038 Ga0068851_105520382 90
115 3300005840 Ga0068870_10229625 Ga0068870_102296252 90
116 3300005840 Ga0068870_10706283 Ga0068870_107062831 90
117 3300005841 Ga0068863_100743416 Ga0068863_1007434162 90
118 3300005842 Ga0068858_100268694 Ga0068858_1002686942 90
119 3300005843 Ga0068860_100073876 Ga0068860_1000738762 90
120 3300005843 Ga0068860_101758946 Ga0068860_1017589461 90
121 3300005844 Ga0068862_100321359 Ga0068862_1003213592 90
122 3300005985 Ga0081539_10003460 Ga0081539_1000346017 90
123 3300006038 Ga0075365_10066178 Ga0075365_100661783 90
124 3300006058 Ga0075432_10287323 Ga0075432_102873232 90
125 3300006844 Ga0075428_100898310 Ga0075428_1008983102 90
126 3300006847 Ga0075431_100406993 Ga0075431_1004069932 90
127 3300006847 Ga0075431_101171791 Ga0075431_1011717912 90
128 3300006852 Ga0075433_10008221 Ga0075433_100082217 90
129 3300006852 Ga0075433_10413449 Ga0075433_104134492 90
130 3300006852 Ga0075433_10505540 Ga0075433_105055402 90
131 3300006871 Ga0075434_100529599 Ga0075434_1005295992 90
132 3300006871 Ga0075434_101692566 Ga0075434_1016925662 90
133 3300006881 Ga0068865_100003323 Ga0068865_1000033235 90
134 3300006914 Ga0075436_100359650 Ga0075436_1003596502 90
135 3300006931 Ga0097620_100172996 Ga0097620_1001729962 90
136 3300006931 Ga0097620_100419108 Ga0097620_1004191083 90
137 3300007076 Ga0075435_100275175 Ga0075435_1002751752 90
138 3300007076 Ga0075435_100719912 Ga0075435_1007199122 90
139 3300009011 Ga0105251_10274053 Ga0105251_102740532 90
140 3300009036 Ga0105244_10094482 Ga0105244_100944822 90
141 3300009094 Ga0111539_10020328 Ga0111539_100203286 90
142 3300009094 Ga0111539_10117766 Ga0111539_101177662 90
143 3300009094 Ga0111539_10913438 Ga0111539_109134381 90
144 3300009098 Ga0105245_10026836 Ga0105245_100268363 90
145 3300009098 Ga0105245_10733264 Ga0105245_107332642 90
146 3300009101 Ga0105247_10398576 Ga0105247_103985762 90
147 3300009147 Ga0114129_10446219 Ga0114129_104462192 90
148 3300009147 Ga0114129_10979224 Ga0114129_109792242 90
149 3300009148 Ga0105243_10073588 Ga0105243_100735884 90
150 3300009148 Ga0105243_10901361 Ga0105243_109013611 90
151 3300009148 Ga0105243_11354425 Ga0105243_113544252 90
152 3300009176 Ga0105242_10019629 Ga0105242_100196294 90
153 3300009176 Ga0105242_10540592 Ga0105242_105405922 90
154 3300009176 Ga0105242_11870444 Ga0105242_118704442 90
155 3300009177 Ga0105248_10337716 Ga0105248_103377162 90
156 3300009177 Ga0105248_11826080 Ga0105248_118260801 90
157 3300009545 Ga0105237_10303552 Ga0105237_103035522 90
158 3300009551 Ga0105238_10835521 Ga0105238_108355212 90
159 3300009553 Ga0105249_10011568 Ga0105249_100115686 90
160 3300009553 Ga0105249_10577604 Ga0105249_105776042 90
161 3300009553 Ga0105249_10895749 Ga0105249_108957492 90
162 3300010159 Ga0099796_10332410 Ga0099796_103324102 90
163 3300010159 Ga0099796_10574615 Ga0099796_105746151 90
164 3300010375 Ga0105239_10036633 Ga0105239_100366332 90
165 3300011119 Ga0105246_10176212 Ga0105246_101762122 90
166 3300011119 Ga0105246_12447808 Ga0105246_124478081 90
167 3300013297 Ga0157378_10021356 Ga0157378_100213564 90
168 3300013306 Ga0163162_10933670 Ga0163162_109336702 90
169 3300013306 Ga0163162_12024273 Ga0163162_120242732 90
170 3300013307 Ga0157372_13366306 Ga0157372_133663061 90
171 3300013308 Ga0157375_10008137 Ga0157375_100081374 90
172 3300013308 Ga0157375_10898729 Ga0157375_108987292 90
173 3300014325 Ga0163163_10018899 Ga0163163_100188992 90
174 3300014325 Ga0163163_10477786 Ga0163163_104777861 90
175 3300014325 Ga0163163_10805815 Ga0163163_108058151 90
176 3300014326 Ga0157380_10016123 Ga0157380_100161232 90
177 3300014326 Ga0157380_10182771 Ga0157380_101827712 90
178 3300014745 Ga0157377_10001871 Ga0157377_100018716 90
179 3300014968 Ga0157379_10059263 Ga0157379_100592633 90
180 3300014969 Ga0157376_10958911 Ga0157376_109589112 90
181 3300025315 Ga0207697_10104681 Ga0207697_101046812 90
182 3300025899 Ga0207642_10060743 Ga0207642_100607432 90
183 3300025900 Ga0207710_10320223 Ga0207710_103202231 90
184 3300025901 Ga0207688_10242661 Ga0207688_102426612 90
185 3300025907 Ga0207645_10266169 Ga0207645_102661693 90
186 3300025907 Ga0207645_10681526 Ga0207645_106815262 90
187 3300025908 Ga0207643_10004561 Ga0207643_100045619 90
188 3300025910 Ga0207684_10022072 Ga0207684_100220725 90
189 3300025910 Ga0207684_10403686 Ga0207684_104036862 90
190 3300025917 Ga0207660_10439840 Ga0207660_104398402 90
191 3300025918 Ga0207662_10012310 Ga0207662_100123102 90
192 3300025919 Ga0207657_10023977 Ga0207657_100239776 90
193 3300025919 Ga0207657_11221383 Ga0207657_112213831 90
194 3300025920 Ga0207649_10524376 Ga0207649_105243761 90
195 3300025922 Ga0207646_10002036 Ga0207646_100020362 90
196 3300025922 Ga0207646_10012048 Ga0207646_100120485 90
197 3300025922 Ga0207646_10016705 Ga0207646_100167054 90
198 3300025922 Ga0207646_11734832 Ga0207646_117348322 90
199 3300025923 Ga0207681_10024491 Ga0207681_100244914 90
200 3300025924 Ga0207694_10077664 Ga0207694_100776644 90
201 3300025925 Ga0207650_10062714 Ga0207650_100627142 90
202 3300025926 Ga0207659_10399537 Ga0207659_103995372 90
203 3300025927 Ga0207687_10901767 Ga0207687_109017672 90
204 3300025933 Ga0207706_10035925 Ga0207706_100359255 90
205 3300025934 Ga0207686_10016970 Ga0207686_100169704 90
206 3300025935 Ga0207709_10016662 Ga0207709_100166623 90
207 3300025935 Ga0207709_10679351 Ga0207709_106793512 90
208 3300025935 Ga0207709_11272139 Ga0207709_112721392 90
209 3300025936 Ga0207670_10656674 Ga0207670_106566741 90
210 3300025937 Ga0207669_10030336 Ga0207669_100303363 90
211 3300025937 Ga0207669_10033555 Ga0207669_100335555 90
212 3300025937 Ga0207669_10168542 Ga0207669_101685422 90
213 3300025938 Ga0207704_10267625 Ga0207704_102676252 90
214 3300025940 Ga0207691_11687880 Ga0207691_116878802 90
215 3300025944 Ga0207661_11164649 Ga0207661_111646491 90
216 3300025944 Ga0207661_11711926 Ga0207661_117119262 90
217 3300025945 Ga0207679_10023805 Ga0207679_100238055 90
218 3300025960 Ga0207651_10651955 Ga0207651_106519552 90
219 3300025961 Ga0207712_10615472 Ga0207712_106154722 90
220 3300025972 Ga0207668_10394879 Ga0207668_103948792 90
221 3300025972 Ga0207668_10601775 Ga0207668_106017752 90
222 3300025981 Ga0207640_10018979 Ga0207640_100189792 90
223 3300025981 Ga0207640_10875684 Ga0207640_108756841 90
224 3300026023 Ga0207677_10545879 Ga0207677_105458792 90
225 3300026035 Ga0207703_10028330 Ga0207703_100283304 90
226 3300026041 Ga0207639_11070336 Ga0207639_110703362 90
227 3300026067 Ga0207678_10021470 Ga0207678_100214705 90
228 3300026075 Ga0207708_10003005 Ga0207708_100030052 90
229 3300026075 Ga0207708_10058992 Ga0207708_100589925 90
230 3300026075 Ga0207708_10092031 Ga0207708_100920312 90
231 3300026088 Ga0207641_10595179 Ga0207641_105951792 90
232 3300026089 Ga0207648_10003422 Ga0207648_100034226 90
233 3300026089 Ga0207648_10227771 Ga0207648_102277711 90
234 3300026089 Ga0207648_10303772 Ga0207648_103037722 90
235 3300026095 Ga0207676_10243515 Ga0207676_102435152 90
236 3300026095 Ga0207676_10341602 Ga0207676_103416022 90
237 3300026116 Ga0207674_10009525 Ga0207674_100095257 90
238 3300026118 Ga0207675_100038773 Ga0207675_1000387733 90
239 3300026121 Ga0207683_10015985 Ga0207683_100159854 90
240 3300026121 Ga0207683_10393981 Ga0207683_103939812 90
241 3300026121 Ga0207683_11026919 Ga0207683_110269192 90
242 3300026142 Ga0207698_10226283 Ga0207698_102262832 90
243 3300027717 Ga0209998_10025011 Ga0209998_100250112 90
244 3300027907 Ga0207428_10272781 Ga0207428_102727812 90
245 3300028379 Ga0268266_10387225 Ga0268266_103872252 90
246 3300028380 Ga0268265_10464531 Ga0268265_104645312 90
247 3300028381 Ga0268264_10092179 Ga0268264_100921792 90
248 3300028381 Ga0268264_12011677 Ga0268264_120116771 90
249 3300031731 Ga0307405_10055016 Ga0307405_100550162 90
250 3300031731 Ga0307405_10170464 Ga0307405_101704642 90
251 3300031852 Ga0307410_10170401 Ga0307410_101704012 90
252 3300031852 Ga0307410_10178821 Ga0307410_101788211 90
253 3300031901 Ga0307406_10169796 Ga0307406_101697961 90
254 3300031901 Ga0307406_10563964 Ga0307406_105639642 90
255 3300031903 Ga0307407_10430220 Ga0307407_104302202 90
256 3300031911 Ga0307412_10199536 Ga0307412_101995362 90
257 3300031911 Ga0307412_11579590 Ga0307412_115795902 90
258 3300031995 Ga0307409_100030286 Ga0307409_1000302865 90
259 3300031995 Ga0307409_100325000 Ga0307409_1003250002 90
260 3300032002 Ga0307416_100002960 Ga0307416_10000296011 90
261 3300032002 Ga0307416_101386972 Ga0307416_1013869722 90
262 3300032126 Ga0307415_100009017 Ga0307415_1000090176 90
263 3300032126 Ga0307415_101144535 Ga0307415_1011445351 90
264 3300034818 Ga0373950_0046322 Ga0373950_0046322_108_380 90
265 3300034820 Ga0373959_0039341 Ga0373959_0039341_454_726 90
266 3300035084 Ga0373928_0129327 Ga0373928_0129327_160_432 90
267 3300035085 Ga0373929_0084312 Ga0373929_0084312_66_338 90
268 3300035115 Ga0373941_0244853 Ga0373941_0244853_329_601 90
269 3300035170 Ga0373943_0635320 Ga0373943_0635320_68_340 90
270 3300035242 Ga0373962_0057454 Ga0373962_0057454_396_668 90
271 3300035691 Ga0373931_0227053 Ga0373931_0227053_283_555 90
272 3300035692 Ga0373935_1485995 Ga0373935_1485995_124_396 90
273 3300036401 Ga0373937_1608042 Ga0373937_1608042_150_422 90
274 3300037312 Ga0395899_0837354 Ga0395899_0837354_144_416 90
275 3300037471 Ga0395905_1624125 Ga0395905_1624125_174_446 90
276 3300038443 Ga0395901_0202427 Ga0395901_0202427_355_627 90
277 3300038443 Ga0395901_0564705 Ga0395901_0564705_277_549 90
278 3300038443 Ga0395901_1611586 Ga0395901_1611586_86_358 90
279 3300041498 Ga0451841_1258803 Ga0451841_1258803_59_331 90
280 3300042001 Ga0439441_023056 Ga0439441_023056_545_817 90
281 3300042005 Ga0439448_0233382 Ga0439448_0233382_360_632 90
282 3300042142 Ga0450905_091397 Ga0450905_091397_121_393 90
283 3300042157 Ga0439458_0069317 Ga0439458_0069317_97_369 90
284 3300042438 Ga0439459_0119647 Ga0439459_0119647_109_381 90
285 3300042993 Ga0439440_0141668 Ga0439440_0141668_315_587 90
286 3300044658 Ga0466972_0141854 Ga0466972_0141854_600_872 90
287 3300044735 Ga0466968_0073517 Ga0466968_0073517_838_1110 90
288 3300044901 Ga0466960_0402086 Ga0466960_0402086_439_711 90
289 3300045051 Ga0451576_2630143 Ga0451576_2630143_114_386 90
290 3300046461 Ga0495641_0081293 Ga0495641_0081293_290_562 90
291 3300046462 Ga0495651_0019074 Ga0495651_0019074_3897_4169 90
292 3300046463 Ga0495653_0160494 Ga0495653_0160494_986_1258 90
293 3300046475 Ga0495639_0633335 Ga0495639_0633335_203_475 90
294 3300046476 Ga0495662_0083556 Ga0495662_0083556_965_1237 90
295 3300046477 Ga0495664_0192132 Ga0495664_0192132_123_395 90
296 3300046500 Ga0495596_0400014 Ga0495596_0400014_41_313 90
297 3300046511 Ga0495608_0512855 Ga0495608_0512855_89_361 90
298 3300046514 Ga0495618_0156439 Ga0495618_0156439_1168_1440 90
299 3300046516 Ga0495628_0094295 Ga0495628_0094295_1079_1351 90
300 3300046516 Ga0495628_0566542 Ga0495628_0566542_365_637 90
301 3300046517 Ga0495630_0345100 Ga0495630_0345100_151_423 90
302 3300046517 Ga0495630_1330737 Ga0495630_1330737_144_416 90
303 3300046520 Ga0495637_0361299 Ga0495637_0361299_175_447 90
304 3300046533 Ga0495640_0027776 Ga0495640_0027776_966_1238 90
305 3300046536 Ga0495587_0265827 Ga0495587_0265827_426_698 90
306 3300046538 Ga0495609_0409999 Ga0495609_0409999_242_514 90
307 3300046539 Ga0495621_0536677 Ga0495621_0536677_160_432 90
308 3300046558 Ga0495633_0564965 Ga0495633_0564965_140_481 90
309 3300046559 Ga0495667_0674549 Ga0495667_0674549_312_584 90
310 3300046559 Ga0495667_0705064 Ga0495667_0705064_72_344 90
311 3300046663 Ga0495635_0249373 Ga0495635_0249373_35_307 90
312 3300046664 Ga0495659_0144497 Ga0495659_0144497_589_861 90
313 3300046675 Ga0495657_0174349 Ga0495657_0174349_360_632 90
314 3300046675 Ga0495657_0362362 Ga0495657_0362362_72_344 90
315 3300046675 Ga0495657_0733689 Ga0495657_0733689_264_536 90
316 3300046678 Ga0495599_0590593 Ga0495599_0590593_79_351 90
317 3300046679 Ga0495623_0161615 Ga0495623_0161615_574_846 90
318 3300046689 Ga0495613_0357524 Ga0495613_0357524_474_746 90
319 3300046690 Ga0495624_0202939 Ga0495624_0202939_301_573 90
320 3300046691 Ga0495670_0572218 Ga0495670_0572218_296_568 90
321 3300046809 Ga0495600_0172165 Ga0495600_0172165_89_361 90
322 3300047317 Ga0495604_0224544 Ga0495604_0224544_432_704 90
323 3300047319 Ga0495674_0376955 Ga0495674_0376955_712_984 90
324 3300047319 Ga0495674_0488743 Ga0495674_0488743_82_354 90
325 3300047322 Ga0495680_0102568 Ga0495680_0102568_1717_1989 90
326 3300047471 Ga0495684_0141457 Ga0495684_0141457_888_1160 90
327 3300047673 Ga0495593_0205231 Ga0495593_0205231_584_856 90
328 3300048088 Ga0495602_0246172 Ga0495602_0246172_298_570 90
329 3300048903 Ga0496100_0705906 Ga0496100_0705906_501_773 90
330 3300048904 Ga0496101_0068185 Ga0496101_0068185_1961_2233 90
331 3300048904 Ga0496101_0148286 Ga0496101_0148286_1232_1504 90
332 3300048905 Ga0496102_0104013 Ga0496102_0104013_154_426 90
333 3300048905 Ga0496102_0116152 Ga0496102_0116152_17_289 90
334 3300048905 Ga0496102_0244132 Ga0496102_0244132_242_514 90
335 3300048905 Ga0496102_1062333 Ga0496102_1062333_78_350 90
336 3300048906 Ga0496103_0214486 Ga0496103_0214486_671_943 90
337 3300048909 Ga0496106_0117047 Ga0496106_0117047_343_615 90
338 3300048909 Ga0496106_0919368 Ga0496106_0919368_233_505 90
339 3300048911 Ga0496108_0139343 Ga0496108_0139343_1576_1848 90
340 3300048912 Ga0496109_0117680 Ga0496109_0117680_546_818 90
341 3300048912 Ga0496109_1000808 Ga0496109_1000808_468_740 90
342 3300048914 Ga0496111_0129419 Ga0496111_0129419_256_528 90
343 3300048915 Ga0496112_0075314 Ga0496112_0075314_2114_2386 90
344 3300048915 Ga0496112_1883124 Ga0496112_1883124_189_461 90
345 3300048916 Ga0496113_0042521 Ga0496113_0042521_690_962 90
346 3300048917 Ga0496114_0721933 Ga0496114_0721933_355_639 90
347 3300049568 Ga0501031_0151233 Ga0501031_0151233_916_1188 90
348 3300049568 Ga0501031_0235193 Ga0501031_0235193_45_317 90
349 3300049569 Ga0501032_0412654 Ga0501032_0412654_318_590 90
350 3300049572 Ga0501036_0020106 Ga0501036_0020106_5117_5389 90
351 3300049573 Ga0501037_0449708 Ga0501037_0449708_206_478 90
352 3300049573 Ga0501037_0615889 Ga0501037_0615889_16_288 90
353 3300049573 Ga0501037_0629348 Ga0501037_0629348_342_614 90
354 3300049573 Ga0501037_0720238 Ga0501037_0720238_276_548 90
355 3300049574 Ga0501038_0435746 Ga0501038_0435746_71_343 90
356 3300049574 Ga0501038_0735699 Ga0501038_0735699_335_607 90
357 3300049575 Ga0501039_0063103 Ga0501039_0063103_300_584 90
358 3300049575 Ga0501039_0140789 Ga0501039_0140789_1414_1686 90
359 3300049575 Ga0501039_0996963 Ga0501039_0996963_12_284 90
360 3300049576 Ga0501040_0008058 Ga0501040_0008058_6094_6378 90
361 3300049576 Ga0501040_0452559 Ga0501040_0452559_16_288 90
362 3300049576 Ga0501040_0533984 Ga0501040_0533984_230_502 90
363 3300049576 Ga0501040_0661459 Ga0501040_0661459_274_546 90
364 3300049576 Ga0501040_0899616 Ga0501040_0899616_161_445 90
365 3300049577 Ga0501041_0251402 Ga0501041_0251402_64_336 90
366 3300049577 Ga0501041_0511217 Ga0501041_0511217_221_505 90
367 3300049577 Ga0501041_0667304 Ga0501041_0667304_288_572 90
368 3300049578 Ga0501042_0461868 Ga0501042_0461868_250_522 90
369 3300049578 Ga0501042_1338060 Ga0501042_1338060_66_338 90
370 3300049578 Ga0501042_1423607 Ga0501042_1423607_170_454 90
371 3300049579 Ga0501043_1097860 Ga0501043_1097860_118_402 90
372 3300049580 Ga0501046_0344387 Ga0501046_0344387_538_810 90
373 3300049580 Ga0501046_1148961 Ga0501046_1148961_88_372 90
374 3300049582 Ga0501048_0150187 Ga0501048_0150187_101_385 90
375 3300049582 Ga0501048_0397226 Ga0501048_0397226_451_723 90
376 3300049582 Ga0501048_0640137 Ga0501048_0640137_411_683 90
377 3300049582 Ga0501048_0693586 Ga0501048_0693586_426_698 90
378 3300049582 Ga0501048_0869490 Ga0501048_0869490_179_451 90
379 3300049584 Ga0501068_0401656 Ga0501068_0401656_235_519 90
380 3300049584 Ga0501068_0419878 Ga0501068_0419878_452_724 90
381 3300049585 Ga0501069_0048314 Ga0501069_0048314_1262_1534 90
382 3300049587 Ga0501071_0160917 Ga0501071_0160917_1086_1358 90
383 3300049587 Ga0501071_0452814 Ga0501071_0452814_557_829 90
384 3300049587 Ga0501071_0568508 Ga0501071_0568508_130_402 90
385 3300049588 Ga0501072_0039219 Ga0501072_0039219_2884_3168 90
386 3300049588 Ga0501072_0175200 Ga0501072_0175200_514_786 90
387 3300049588 Ga0501072_0477579 Ga0501072_0477579_484_756 90
388 3300049588 Ga0501072_0615837 Ga0501072_0615837_496_780 90
389 3300049589 Ga0501073_0643487 Ga0501073_0643487_224_496 90
390 3300049590 Ga0501074_1126309 Ga0501074_1126309_255_527 90
391 3300049590 Ga0501074_1314408 Ga0501074_1314408_107_391 90
392 3300049591 Ga0501075_0121984 Ga0501075_0121984_447_731 90
393 3300049591 Ga0501075_0397648 Ga0501075_0397648_144_416 90
394 3300049591 Ga0501075_0454804 Ga0501075_0454804_72_344 90
395 3300049591 Ga0501075_0546499 Ga0501075_0546499_348_620 90
396 3300049591 Ga0501075_1110678 Ga0501075_1110678_23_295 90
397 3300049592 Ga0501076_0020659 Ga0501076_0020659_2123_2407 90
398 3300049592 Ga0501076_0153112 Ga0501076_0153112_49_321 90
399 3300049592 Ga0501076_0156324 Ga0501076_0156324_1361_1633 90
400 3300049592 Ga0501076_0466284 Ga0501076_0466284_528_812 90
401 3300049592 Ga0501076_1084512 Ga0501076_1084512_342_614 90
402 3300049592 Ga0501076_1520891 Ga0501076_1520891_30_314 90
403 3300049593 Ga0501077_0358004 Ga0501077_0358004_448_720 90
404 3300049593 Ga0501077_1149267 Ga0501077_1149267_55_339 90
405 3300049652 Ga0501202_057959 Ga0501202_057959_518_790 90
406 3300049741 Ga0501079_0077688 Ga0501079_0077688_1633_1905 90
407 3300049741 Ga0501079_0139611 Ga0501079_0139611_1088_1372 90
408 3300049741 Ga0501079_0352880 Ga0501079_0352880_663_935 90
409 3300049741 Ga0501079_0387821 Ga0501079_0387821_437_721 90
410 3300049742 Ga0501080_0211407 Ga0501080_0211407_729_1001 90
411 3300049742 Ga0501080_0232990 Ga0501080_0232990_833_1117 90
412 3300049742 Ga0501080_0821576 Ga0501080_0821576_220_492 90
413 3300049742 Ga0501080_1208029 Ga0501080_1208029_219_491 90
414 3300049743 Ga0501081_0036584 Ga0501081_0036584_2918_3202 90
415 3300049743 Ga0501081_0119321 Ga0501081_0119321_268_552 90
416 3300049743 Ga0501081_0295357 Ga0501081_0295357_598_870 90
417 3300049743 Ga0501081_0347512 Ga0501081_0347512_370_642 90
418 3300049743 Ga0501081_0371529 Ga0501081_0371529_340_612 90
419 3300049743 Ga0501081_0502870 Ga0501081_0502870_56_340 90
420 3300049767 Ga0501270_069460 Ga0501270_069460_369_641 90
421 3300049822 Ga0501035_1097250 Ga0501035_1097250_289_561 90
422 3300049823 Ga0501044_1336677 Ga0501044_1336677_53_337 90
423 3300049823 Ga0501044_1628064 Ga0501044_1628064_156_428 90
424 3300049824 Ga0501045_0026214 Ga0501045_0026214_1050_1334 90
425 3300049824 Ga0501045_0212114 Ga0501045_0212114_726_998 90
426 3300049824 Ga0501045_0288839 Ga0501045_0288839_334_606 90
427 3300049824 Ga0501045_0642537 Ga0501045_0642537_159_431 90
428 3300050507 nmdc:mga05p37_221260_c1 nmdc:mga05p37_221260_c1_429_701 90
429 3300050507 nmdc:mga05p37_893748_c1 nmdc:mga05p37_893748_c1_302_574 90
430 3300050510 nmdc:mga06r32_395639_c1 nmdc:mga06r32_395639_c1_846_1118 90
431 3300050511 nmdc:mga08y16_190706_c1 nmdc:mga08y16_190706_c1_831_1103 90
432 3300050511 nmdc:mga08y16_239947_c1 nmdc:mga08y16_239947_c1_470_742 90
433 3300050511 nmdc:mga08y16_980943_c1 nmdc:mga08y16_980943_c1_434_706 90
434 3300050512 nmdc:mga0n895_51529_c1 nmdc:mga0n895_51529_c1_2300_2572 90
435 3300050513 nmdc:mga0rr50_116696_c1 nmdc:mga0rr50_116696_c1_1653_1925 90
436 3300050513 nmdc:mga0rr50_242902_c1 nmdc:mga0rr50_242902_c1_720_992 90
437 3300050513 nmdc:mga0rr50_931374_c1 nmdc:mga0rr50_931374_c1_273_545 90
438 3300050514 nmdc:mga08x19_148064_c1 nmdc:mga08x19_148064_c1_744_1016 90
439 3300050515 nmdc:mga0a205_425056_c1 nmdc:mga0a205_425056_c1_853_1125 90
440 3300050515 nmdc:mga0a205_79891_c1 nmdc:mga0a205_79891_c1_2596_2868 90
441 3300050515 nmdc:mga0a205_812978_c1 nmdc:mga0a205_812978_c1_321_593 90
442 3300053077 Ga0495601_0017799 Ga0495601_0017799_1098_1370 90
443 3300053078 Ga0495612_0000038 Ga0495612_0000038_28629_28901 90
444 3300053078 Ga0495612_0083122 Ga0495612_0083122_335_607 90
445 3300053084 Ga0495595_0045150 Ga0495595_0045150_1071_1343 90
446 3300053084 Ga0495595_0173556 Ga0495595_0173556_505_777 90
447 3300053085 Ga0495619_0162759 Ga0495619_0162759_965_1237 90
448 3300054114 Ga0501084_0020040 Ga0501084_0020040_5016_5300 90
449 3300054114 Ga0501084_0081838 Ga0501084_0081838_1533_1805 90
450 3300054114 Ga0501084_0090840 Ga0501084_0090840_2169_2453 90
451 3300054114 Ga0501084_0290605 Ga0501084_0290605_607_879 90
452 3300054114 Ga0501084_0307554 Ga0501084_0307554_517_789 90
453 3300054114 Ga0501084_0872842 Ga0501084_0872842_301_573 90
454 3300059423 Ga0590074_009669 Ga0590074_009669_1127_1399 90
455 3300059424 Ga0590075_010118 Ga0590075_010118_960_1232 90
456 3300060353 Ga0501082_0080617 Ga0501082_0080617_1320_1604 90
457 3300060353 Ga0501082_0652425 Ga0501082_0652425_117_389 90
458 3300060353 Ga0501082_0655699 Ga0501082_0655699_515_787 90
459 3300060353 Ga0501082_0902750 Ga0501082_0902750_67_339 90
460 3300061734 Ga0530510_0015123 Ga0530510_0015123_1062_1334 90
461 3300061734 Ga0530510_0049143 Ga0530510_0049143_756_1040 90
462 3300061734 Ga0530510_0080057 Ga0530510_0080057_1690_1974 90
463 3300061734 Ga0530510_1086134 Ga0530510_1086134_187_471 90

Structural Annotation

Top 5 Hits

ID Description Score Start End
8pv6-assembly1.cif.gz_LA chaetomium thermophilum pre-60s state 3 - post-5s rotation with rix1 complex with foot - composite structure 0.6396 63 89
5zr6-assembly1.cif.gz_B manganese-dependent transcriptional repressor complex with manganese 0.6353 61 89
5zr6-assembly1.cif.gz_A manganese-dependent transcriptional repressor complex with manganese 0.6263 61 90
1g5v-assembly1.cif.gz_A solution structure of the tudor domain of the human smn protein 0.6176 52 90
3hru-assembly1.cif.gz_A crystal structure of scar with bound zn2+ 0.6103 61 90
ID Description Score Start End Superfamily
af_I6Y1Q2_151_228_2.30.30.90 Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) 0.6511 61 90 2.30.30.90
af_Q6Z3Y5_52_136_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.6411 52 90 2.30.30.140
af_Q9C5X4_207_256_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.6239 55 90 2.30.30.140
1g5vA00 Mainly Beta;Roll;SH3 type barrels.; 0.6176 52 90 2.30.30.140
af_Q4DW33_797_931_3.90.70.30 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Phytochelatin synthase, N-terminal domain 0.6139 63 90 3.90.70.30
ID Description Score Start End GO Terms
AF-A0A6J4TD14-F1-model_v4 Uncharacterized protein 0.9171 24 90
AF-A0A1F8S927-F1-model_v4 Uncharacterized protein 0.9129 1 90
AF-A0A521RZM6-F1-model_v4 Uncharacterized protein 0.9111 1 90
AF-A0A1F8S927-F1-model_v4 Uncharacterized protein 0.9031 1 90
AF-A0A6J4TD14-F1-model_v4 Uncharacterized protein 0.8919 24 90

Feature Viewer

pLDDT pTM Quality
87.95 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map