F449154

General Info

Members Datasets Scaffolds Average Seq Length
463 173 926 107

Family's Representative Sequence

Representative Sequence 3300042005|Ga0439448_0081646|Ga0439448_0081646_619_966
Length 115
Sequence MRRNGKAAAMLAALSLTSAAMSLCPALAAEPRSHHTYTVVINKMRFGPLPSGLRVGDTIIWENRDLFRHTATARDGSFDIDLMPTKKGKLVLKQAGTFRFSCTYHPGMKGELVVR

Samples

Sample ID Description Type Environment
1 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
76 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
142 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
143 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
144 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
171 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.98
Metatranscriptomes 3.02
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 1.3
Rhizosphere 97.84
Stem 0
Stem Tuber 0
Unclassified 9.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439448_0081646 3300042005 Bacteria 1086
2 JGI24736J21556_1000117 3300001904 Bacteria 13577
3 JGI24741J21665_1000086 3300001915 Bacteria 23662
4 JGI24741J21665_1010128 3300001915 Bacteria 1702
5 JGI24740J21852_10001689 3300001979 Bacteria 10132
6 JGI24740J21852_10004032 3300001979 Bacteria 6358
7 JGI24740J21852_10071554 3300001979 Bacteria 928
8 JGI24740J21852_10121152 3300001979 Bacteria 655
9 JGI24737J22298_10045660 3300001990 Bacteria 1338
10 JGI24735J21928_10002477 3300002067 Bacteria 6411
11 JGI24735J21928_10036645 3300002067 Bacteria 1439
12 rootH2_10003120 3300003320 Bacteria 3255
13 Ga0055542_1038168 3300003762 Bacteria 578
14 Ga0058863_11863976 3300004799 Bacteria 999
15 Ga0070658_10000876 3300005327 Bacteria 25753
16 Ga0070658_10002895 3300005327 Bacteria 14246
17 Ga0070658_10004333 3300005327 Bacteria 11591
18 Ga0070658_10009991 3300005327 Bacteria 7623
19 Ga0070658_10045139 3300005327 Bacteria 3562
20 Ga0070658_10066209 3300005327 Bacteria 2951
21 Ga0070658_10125826 3300005327 Bacteria 2133
22 Ga0070658_10174463 3300005327 Bacteria 1807
23 Ga0070658_10210349 3300005327 Unclassified 1643
24 Ga0070658_10220889 3300005327 Bacteria 1602
25 Ga0070658_10418032 3300005327 Unclassified 1153
26 Ga0070658_10536811 3300005327 Unclassified 1012
27 Ga0070658_10688134 3300005327 Unclassified 887
28 Ga0070658_11133503 3300005327 Bacteria 680
29 Ga0070676_10104970 3300005328 Bacteria 1751
30 Ga0070683_100010109 3300005329 Bacteria 8096
31 Ga0070683_100029813 3300005329 Bacteria 4944
32 Ga0070683_100259377 3300005329 Bacteria 1653
33 Ga0070683_102087561 3300005329 Unclassified 544
34 Ga0070690_100396724 3300005330 Bacteria 1012
35 Ga0070690_100803362 3300005330 Bacteria 730
36 Ga0070670_100000350 3300005331 Bacteria 38698
37 Ga0070670_100087725 3300005331 Bacteria 2674
38 Ga0070670_101904824 3300005331 Unclassified 548
39 Ga0070677_10014798 3300005333 Bacteria 2753
40 Ga0070677_10024197 3300005333 Bacteria 2256
41 Ga0068869_100289087 3300005334 Bacteria 1320
42 Ga0070666_10048528 3300005335 Bacteria 2853
43 Ga0070666_10109560 3300005335 Bacteria 1909
44 Ga0070680_100081304 3300005336 Bacteria 2673
45 Ga0070680_100098394 3300005336 Bacteria 2426
46 Ga0070680_100509030 3300005336 Unclassified 1030
47 Ga0070682_101724676 3300005337 Bacteria 545
48 Ga0070660_100000487 3300005339 Bacteria 26540
49 Ga0070660_100001158 3300005339 Bacteria 17811
50 Ga0070660_100001347 3300005339 Bacteria 16688
51 Ga0070660_100002825 3300005339 Bacteria 11947
52 Ga0070660_100003460 3300005339 Bacteria 10868
53 Ga0070660_100020422 3300005339 Bacteria 4866
54 Ga0070660_100048825 3300005339 Unclassified 3251
55 Ga0070660_100086963 3300005339 Bacteria 2460
56 Ga0070660_100100856 3300005339 Bacteria 2287
57 Ga0070660_100124398 3300005339 Bacteria 2060
58 Ga0070660_100124609 3300005339 Bacteria 2058
59 Ga0070660_100837421 3300005339 Unclassified 774
60 Ga0070691_10003062 3300005341 Bacteria 7487
61 Ga0070661_100023216 3300005344 Bacteria 4445
62 Ga0070661_100034152 3300005344 Bacteria 3688
63 Ga0070661_100056574 3300005344 Bacteria 2874
64 Ga0070661_100102420 3300005344 Unclassified 2131
65 Ga0070661_100119074 3300005344 Bacteria 1976
66 Ga0070661_100221933 3300005344 Bacteria 1450
67 Ga0070661_100669722 3300005344 Bacteria 843
68 Ga0070661_101329724 3300005344 Bacteria 603
69 Ga0070692_10015183 3300005345 Bacteria 3637
70 Ga0070692_10020675 3300005345 Bacteria 3193
71 Ga0070692_10035727 3300005345 Bacteria 2517
72 Ga0070692_10125395 3300005345 Bacteria 1437
73 Ga0070669_100026397 3300005353 Bacteria 4179
74 Ga0070675_100001857 3300005354 Bacteria 15581
75 Ga0070671_100001032 3300005355 Bacteria 20490
76 Ga0070671_100024364 3300005355 Bacteria 4953
77 Ga0070671_100190451 3300005355 Bacteria 1738
78 Ga0070671_101721547 3300005355 Unclassified 556
79 Ga0070673_100003253 3300005364 Bacteria 10079
80 Ga0070673_100079938 3300005364 Bacteria 2648
81 Ga0070659_100001753 3300005366 Bacteria 15585
82 Ga0070659_100005514 3300005366 Bacteria 9088
83 Ga0070659_100016535 3300005366 Bacteria 5539
84 Ga0070659_100031769 3300005366 Bacteria 4091
85 Ga0070659_100066291 3300005366 Bacteria 2861
86 Ga0070659_100290272 3300005366 Bacteria 1362
87 Ga0070659_100786129 3300005366 Bacteria 827
88 Ga0070659_101109473 3300005366 Unclassified 697
89 Ga0070667_100098706 3300005367 Bacteria 2520
90 Ga0070667_100140880 3300005367 Bacteria 2112
91 Ga0070703_10304587 3300005406 Unclassified 665
92 Ga0070663_100007970 3300005455 Bacteria 6491
93 Ga0070663_100018655 3300005455 Bacteria 4553
94 Ga0070663_100073794 3300005455 Bacteria 2489
95 Ga0070663_100182382 3300005455 Bacteria 1629
96 Ga0070663_100227285 3300005455 Bacteria 1468
97 Ga0070663_101068355 3300005455 Unclassified 704
98 Ga0070678_100237869 3300005456 Bacteria 1521
99 Ga0070662_100008923 3300005457 Bacteria 6536
100 Ga0070662_100063945 3300005457 Bacteria 2693
101 Ga0070662_100159328 3300005457 Bacteria 1764
102 Ga0070662_101427450 3300005457 Unclassified 596
103 Ga0070681_10118510 3300005458 Bacteria 2584
104 Ga0070681_10171116 3300005458 Bacteria 2094
105 Ga0070681_10283650 3300005458 Bacteria 1567
106 Ga0068867_100650633 3300005459 Unclassified 925
107 Ga0070699_100768640 3300005518 Bacteria 881
108 Ga0070679_100134002 3300005530 Bacteria 2458
109 Ga0070679_100183733 3300005530 Bacteria 2062
110 Ga0070679_100243853 3300005530 Bacteria 1754
111 Ga0070679_100351869 3300005530 Unclassified 1421
112 Ga0070679_100377724 3300005530 Bacteria 1364
113 Ga0070684_100001830 3300005535 Bacteria 15561
114 Ga0070684_100068323 3300005535 Bacteria 3123
115 Ga0070684_100132628 3300005535 Bacteria 2248
116 Ga0068853_100004017 3300005539 Bacteria 11320
117 Ga0068853_100056982 3300005539 Bacteria 3371
118 Ga0068853_100407462 3300005539 Bacteria 1273
119 Ga0068853_101815079 3300005539 Unclassified 591
120 Ga0070672_100005889 3300005543 Bacteria 8177
121 Ga0070696_100141995 3300005546 Bacteria 1756
122 Ga0070696_100246173 3300005546 Bacteria 1350
123 Ga0070696_101244168 3300005546 Unclassified 630
124 Ga0070693_100834999 3300005547 Bacteria 686
125 Ga0070665_100412069 3300005548 Bacteria 1360
126 Ga0068855_100000079 3300005563 Bacteria 117264
127 Ga0068855_100015129 3300005563 Bacteria 9291
128 Ga0068855_100180150 3300005563 Bacteria 2389
129 Ga0068855_100182939 3300005563 Bacteria 2368
130 Ga0068855_100700158 3300005563 Bacteria 1084
131 Ga0068855_101903014 3300005563 Bacteria 602
132 Ga0070664_100003170 3300005564 Bacteria 13292
133 Ga0070664_100004435 3300005564 Bacteria 11273
134 Ga0070664_100038561 3300005564 Bacteria 4023
135 Ga0070664_100769631 3300005564 Bacteria 899
136 Ga0070664_101872809 3300005564 Bacteria 569
137 Ga0068857_100020042 3300005577 Bacteria 5879
138 Ga0068857_100022379 3300005577 Bacteria 5561
139 Ga0068857_100042493 3300005577 Bacteria 4033
140 Ga0068857_100089401 3300005577 Unclassified 2756
141 Ga0068857_100255816 3300005577 Bacteria 1606
142 Ga0068854_100001146 3300005578 Bacteria 15933
143 Ga0068854_100119141 3300005578 Bacteria 2001
144 Ga0068854_100120496 3300005578 Bacteria 1991
145 Ga0068854_100150411 3300005578 Unclassified 1794
146 Ga0068854_100299260 3300005578 Bacteria 1301
147 Ga0068854_100493444 3300005578 Bacteria 1030
148 Ga0068854_100860685 3300005578 Bacteria 794
149 Ga0068854_101054242 3300005578 Bacteria 722
150 Ga0068854_101311342 3300005578 Bacteria 652
151 Ga0068856_100022339 3300005614 Bacteria 6149
152 Ga0068856_100062965 3300005614 Bacteria 3664
153 Ga0068856_100185796 3300005614 Bacteria 2092
154 Ga0068856_100624681 3300005614 Bacteria 1098
155 Ga0068856_101070213 3300005614 Bacteria 824
156 Ga0068856_101494215 3300005614 Bacteria 689
157 Ga0070702_100844090 3300005615 Bacteria 712
158 Ga0068852_100019828 3300005616 Bacteria 5333
159 Ga0068852_100025625 3300005616 Bacteria 4781
160 Ga0068852_100036896 3300005616 Bacteria 4095
161 Ga0068852_101949679 3300005616 Bacteria 609
162 Ga0068852_102372585 3300005616 Unclassified 551
163 Ga0068852_102454332 3300005616 Unclassified 542
164 Ga0068864_100192337 3300005618 Bacteria 1871
165 Ga0068851_10066505 3300005834 Bacteria 1857
166 Ga0068851_10133379 3300005834 Bacteria 1345
167 Ga0068863_102240324 3300005841 Unclassified 556
168 Ga0068858_100489698 3300005842 Unclassified 1187
169 Ga0068860_102217685 3300005843 Archaea 570
170 Ga0068871_100621133 3300006358 Bacteria 984
171 Ga0105240_10006152 3300009093 Bacteria 17700
172 Ga0105240_10007155 3300009093 Bacteria 16257
173 Ga0105243_10157261 3300009148 Bacteria 1956
174 Ga0105241_10159554 3300009174 Bacteria 1852
175 Ga0105248_10008720 3300009177 Bacteria 11138
176 Ga0105248_10753662 3300009177 Bacteria 1099
177 Ga0105237_10022017 3300009545 Bacteria 6541
178 Ga0105237_10130338 3300009545 Bacteria 2509
179 Ga0105237_10385939 3300009545 Bacteria 1405
180 Ga0105237_10826026 3300009545 Bacteria 933
181 Ga0105238_10004239 3300009551 Bacteria 14247
182 Ga0105238_10026814 3300009551 Bacteria 5874
183 Ga0105239_10436892 3300010375 Bacteria 1484
184 Ga0157373_10003029 3300013100 Bacteria 12666
185 Ga0157373_10003770 3300013100 Bacteria 11467
186 Ga0157373_10010908 3300013100 Bacteria 6690
187 Ga0157373_10021117 3300013100 Bacteria 4726
188 Ga0157373_10048905 3300013100 Bacteria 3015
189 Ga0157373_10104794 3300013100 Bacteria 1989
190 Ga0157373_10247265 3300013100 Bacteria 1261
191 Ga0157371_10000261 3300013102 Bacteria 72525
192 Ga0157371_10010561 3300013102 Bacteria 7177
193 Ga0157371_10027348 3300013102 Bacteria 4138
194 Ga0157371_10031157 3300013102 Bacteria 3842
195 Ga0157371_10097465 3300013102 Bacteria 2084
196 Ga0157371_10132181 3300013102 Bacteria 1776
197 Ga0157371_10490143 3300013102 Bacteria 907
198 Ga0157371_10740748 3300013102 Bacteria 737
199 Ga0157370_10009252 3300013104 Bacteria 10558
200 Ga0157370_10015810 3300013104 Bacteria 7658
201 Ga0157370_10021618 3300013104 Bacteria 6410
202 Ga0157370_10434083 3300013104 Bacteria 1208
203 Ga0157370_10472216 3300013104 Bacteria 1153
204 Ga0157370_10607283 3300013104 Bacteria 1001
205 Ga0157370_11863806 3300013104 Unclassified 539
206 Ga0157369_10015792 3300013105 Bacteria 8506
207 Ga0157369_10066536 3300013105 Bacteria 3876
208 Ga0157369_10114879 3300013105 Bacteria 2859
209 Ga0157369_10217104 3300013105 Bacteria 2003
210 Ga0157369_10246392 3300013105 Unclassified 1866
211 Ga0157369_11944525 3300013105 Bacteria 597
212 Ga0157374_10047489 3300013296 Bacteria 3981
213 Ga0157374_11261620 3300013296 Unclassified 761
214 Ga0157378_10431625 3300013297 Bacteria 1304
215 Ga0157372_10026860 3300013307 Bacteria 6267
216 Ga0157372_10076275 3300013307 Bacteria 3785
217 Ga0157372_10113929 3300013307 Bacteria 3099
218 Ga0157372_10442948 3300013307 Bacteria 1514
219 Ga0157372_10768126 3300013307 Unclassified 1120
220 Ga0157372_11852901 3300013307 Bacteria 694
221 Ga0157375_10055112 3300013308 Bacteria 3919
222 Ga0163163_10273323 3300014325 Bacteria 1741
223 Ga0163163_12457713 3300014325 Bacteria 579
224 Ga0163161_10020224 3300017792 Bacteria 4669
225 Ga0206356_10267260 3300020070 Bacteria 1599
226 Ga0206356_10583009 3300020070 Bacteria 1425
227 Ga0206355_1185753 3300020076 Bacteria 1255
228 Ga0206355_1378246 3300020076 Bacteria 679
229 Ga0206351_10505324 3300020077 Bacteria 979
230 Ga0206351_10608247 3300020077 Bacteria 1200
231 Ga0206351_10797287 3300020077 Bacteria 1297
232 Ga0206352_10130232 3300020078 Bacteria 1000
233 Ga0206353_10241471 3300020082 Bacteria 1287
234 Ga0154015_1120478 3300020610 Bacteria 1789
235 Ga0154015_1206154 3300020610 Bacteria 1635
236 Ga0224712_10013540 3300022467 Bacteria 2600
237 Ga0224712_10119128 3300022467 Bacteria 1141
238 Ga0209148_1000146 3300025254 Bacteria 160734
239 Ga0209455_1018488 3300025272 Bacteria 1430
240 Ga0207656_10007269 3300025321 Bacteria 4024
241 Ga0207682_10017878 3300025893 Bacteria 2768
242 Ga0207688_10673827 3300025901 Bacteria 653
243 Ga0207680_10177765 3300025903 Bacteria 1437
244 Ga0207647_10002290 3300025904 Bacteria 14586
245 Ga0207647_10002620 3300025904 Bacteria 13601
246 Ga0207647_10020613 3300025904 Bacteria 4417
247 Ga0207647_10026471 3300025904 Bacteria 3794
248 Ga0207647_10083526 3300025904 Bacteria 1912
249 Ga0207647_10098768 3300025904 Bacteria 1734
250 Ga0207647_10200830 3300025904 Bacteria 1153
251 Ga0207647_10517903 3300025904 Bacteria 664
252 Ga0207645_10014332 3300025907 Bacteria 5308
253 Ga0207705_10000003 3300025909 Bacteria 709270
254 Ga0207705_10000125 3300025909 Bacteria 84812
255 Ga0207705_10000749 3300025909 Bacteria 26722
256 Ga0207705_10002384 3300025909 Bacteria 14522
257 Ga0207705_10003398 3300025909 Bacteria 12103
258 Ga0207705_10004946 3300025909 Bacteria 10005
259 Ga0207705_10017120 3300025909 Bacteria 5192
260 Ga0207705_10052745 3300025909 Bacteria 2929
261 Ga0207705_10084534 3300025909 Bacteria 2317
262 Ga0207705_10179707 3300025909 Bacteria 1596
263 Ga0207705_10538292 3300025909 Unclassified 908
264 Ga0207705_10700402 3300025909 Bacteria 787
265 Ga0207654_10110228 3300025911 Bacteria 1711
266 Ga0207707_10124693 3300025912 Bacteria 2253
267 Ga0207707_10253949 3300025912 Bacteria 1527
268 Ga0207707_11016904 3300025912 Unclassified 679
269 Ga0207707_11658229 3300025912 Unclassified 502
270 Ga0207695_10004896 3300025913 Bacteria 18049
271 Ga0207695_10009694 3300025913 Bacteria 11858
272 Ga0207695_10014439 3300025913 Bacteria 9356
273 Ga0207671_10605160 3300025914 Bacteria 873
274 Ga0207660_10031084 3300025917 Bacteria 3674
275 Ga0207660_10068517 3300025917 Bacteria 2574
276 Ga0207660_10286268 3300025917 Bacteria 1309
277 Ga0207660_10716391 3300025917 Unclassified 816
278 Ga0207657_10000167 3300025919 Bacteria 67075
279 Ga0207657_10000431 3300025919 Bacteria 44557
280 Ga0207657_10002665 3300025919 Bacteria 19265
281 Ga0207657_10002957 3300025919 Bacteria 18228
282 Ga0207657_10003327 3300025919 Bacteria 17194
283 Ga0207657_10007729 3300025919 Bacteria 10978
284 Ga0207657_10017579 3300025919 Bacteria 6850
285 Ga0207657_10023542 3300025919 Bacteria 5732
286 Ga0207657_10027574 3300025919 Bacteria 5201
287 Ga0207657_10137998 3300025919 Bacteria 1994
288 Ga0207657_10191909 3300025919 Bacteria 1647
289 Ga0207649_10003373 3300025920 Bacteria 8740
290 Ga0207649_10007823 3300025920 Bacteria 5815
291 Ga0207649_10007890 3300025920 Bacteria 5792
292 Ga0207649_10169901 3300025920 Bacteria 1518
293 Ga0207652_10245060 3300025921 Unclassified 1616
294 Ga0207652_10352084 3300025921 Bacteria 1329
295 Ga0207652_10806986 3300025921 Bacteria 833
296 Ga0207652_11219849 3300025921 Bacteria 654
297 Ga0207681_10020618 3300025923 Bacteria 4180
298 Ga0207694_10073033 3300025924 Bacteria 2683
299 Ga0207694_10081653 3300025924 Bacteria 2540
300 Ga0207659_10002256 3300025926 Bacteria 11474
301 Ga0207664_10716238 3300025929 Bacteria 900
302 Ga0207644_10007270 3300025931 Bacteria 7207
303 Ga0207644_11068245 3300025931 Unclassified 678
304 Ga0207690_10002554 3300025932 Bacteria 11002
305 Ga0207690_10016955 3300025932 Bacteria 4442
306 Ga0207690_10029992 3300025932 Bacteria 3464
307 Ga0207690_10975601 3300025932 Bacteria 704
308 Ga0207690_11078515 3300025932 Bacteria 669
309 Ga0207690_11220598 3300025932 Bacteria 628
310 Ga0207706_10001609 3300025933 Bacteria 22407
311 Ga0207706_10018320 3300025933 Bacteria 6301
312 Ga0207706_10069641 3300025933 Bacteria 3094
313 Ga0207709_10219028 3300025935 Bacteria 1371
314 Ga0207691_10012970 3300025940 Bacteria 7981
315 Ga0207711_10029142 3300025941 Bacteria 4653
316 Ga0207661_10002656 3300025944 Bacteria 12300
317 Ga0207661_10055597 3300025944 Bacteria 3175
318 Ga0207661_10536241 3300025944 Bacteria 1071
319 Ga0207661_11138772 3300025944 Bacteria 718
320 Ga0207679_10004108 3300025945 Bacteria 9035
321 Ga0207679_10029566 3300025945 Bacteria 3816
322 Ga0207667_10003195 3300025949 Bacteria 20251
323 Ga0207667_10016249 3300025949 Bacteria 8410
324 Ga0207667_10022365 3300025949 Bacteria 6987
325 Ga0207667_10114757 3300025949 Bacteria 2776
326 Ga0207651_10002735 3300025960 Bacteria 8469
327 Ga0207651_10566753 3300025960 Unclassified 989
328 Ga0207668_11052015 3300025972 Unclassified 729
329 Ga0207640_10018303 3300025981 Bacteria 4115
330 Ga0207640_10018863 3300025981 Bacteria 4062
331 Ga0207640_10875930 3300025981 Bacteria 783
332 Ga0207640_11362824 3300025981 Bacteria 635
333 Ga0207658_10054700 3300025986 Bacteria 2954
334 Ga0207677_10372319 3300026023 Bacteria 1203
335 Ga0207639_10014469 3300026041 Bacteria 5550
336 Ga0207639_10048961 3300026041 Bacteria 3202
337 Ga0207639_11681811 3300026041 Unclassified 595
338 Ga0207678_10006856 3300026067 Bacteria 10100
339 Ga0207678_10015645 3300026067 Bacteria 6668
340 Ga0207678_10024785 3300026067 Bacteria 5237
341 Ga0207678_10028356 3300026067 Bacteria 4887
342 Ga0207678_10037300 3300026067 Bacteria 4227
343 Ga0207678_10072949 3300026067 Unclassified 2942
344 Ga0207678_10077225 3300026067 Bacteria 2853
345 Ga0207678_10102181 3300026067 Bacteria 2447
346 Ga0207702_10004728 3300026078 Bacteria 12029
347 Ga0207702_10015728 3300026078 Bacteria 6264
348 Ga0207702_10046986 3300026078 Bacteria 3636
349 Ga0207702_10063532 3300026078 Bacteria 3157
350 Ga0207702_10079131 3300026078 Bacteria 2848
351 Ga0207702_11410151 3300026078 Bacteria 690
352 Ga0207702_11443337 3300026078 Bacteria 682
353 Ga0207641_10674970 3300026088 Bacteria 1016
354 Ga0207648_10065272 3300026089 Bacteria 3173
355 Ga0207676_10164412 3300026095 Bacteria 1926
356 Ga0207674_10002263 3300026116 Bacteria 24396
357 Ga0207674_10015574 3300026116 Bacteria 8350
358 Ga0207674_10094403 3300026116 Unclassified 2978
359 Ga0207674_10134849 3300026116 Bacteria 2431
360 Ga0207674_10635375 3300026116 Bacteria 1031
361 Ga0207683_10274699 3300026121 Bacteria 1540
362 Ga0207698_10002762 3300026142 Bacteria 10472
363 Ga0207698_10005143 3300026142 Bacteria 8042
364 Ga0207698_10012876 3300026142 Bacteria 5494
365 Ga0209974_10017367 3300027876 Unclassified 2386
366 Ga0268266_10021435 3300028379 Bacteria 5504
367 Ga0268266_10534813 3300028379 Bacteria 1122
368 Ga0307408_100304612 3300031548 Bacteria 1336
369 Ga0307410_10030530 3300031852 Bacteria 3445
370 Ga0307410_10093859 3300031852 Bacteria 2136
371 Ga0307410_10633194 3300031852 Bacteria 895
372 Ga0307410_10854793 3300031852 Bacteria 777
373 Ga0307410_11548716 3300031852 Bacteria 585
374 Ga0307410_11967320 3300031852 Bacteria 521
375 Ga0307406_10076152 3300031901 Bacteria 2216
376 Ga0307407_10407837 3300031903 Bacteria 977
377 Ga0307407_10993416 3300031903 Bacteria 648
378 Ga0307412_10030936 3300031911 Bacteria 3376
379 Ga0307409_100229342 3300031995 Bacteria 1682
380 Ga0307409_100344178 3300031995 Bacteria 1404
381 Ga0307416_100047749 3300032002 Bacteria 3391
382 Ga0307416_100187560 3300032002 Bacteria 1946
383 Ga0307414_10246087 3300032004 Bacteria 1483
384 Ga0307414_10247490 3300032004 Bacteria 1480
385 Ga0307414_10598913 3300032004 Bacteria 988
386 Ga0307414_10729571 3300032004 Bacteria 899
387 Ga0307411_10057840 3300032005 Bacteria 2563
388 Ga0395899_0001008 3300037312 Bacteria 25798
389 Ga0395899_0011331 3300037312 Bacteria 6830
390 Ga0395899_0026185 3300037312 Bacteria 4401
391 Ga0395899_0063427 3300037312 Bacteria 2718
392 Ga0395899_0064052 3300037312 Bacteria 2703
393 Ga0395899_0075828 3300037312 Bacteria 2455
394 Ga0395899_0285089 3300037312 Bacteria 1122
395 Ga0395900_0000547 3300037418 Bacteria 52367
396 Ga0395900_0021017 3300037418 Bacteria 6670
397 Ga0395900_0023164 3300037418 Bacteria 6356
398 Ga0395900_0038603 3300037418 Bacteria 4923
399 Ga0395900_0049937 3300037418 Bacteria 4309
400 Ga0395900_0281558 3300037418 Bacteria 1654
401 Ga0395900_0300204 3300037418 Bacteria 1592
402 Ga0395900_0410423 3300037418 Bacteria 1316
403 Ga0395900_0603268 3300037418 Bacteria 1038
404 Ga0395900_0800408 3300037418 Bacteria 870
405 Ga0395898_0033353 3300037466 Bacteria 5139
406 Ga0395898_0034888 3300037466 Bacteria 5006
407 Ga0395898_0076728 3300037466 Bacteria 3226
408 Ga0395898_0105132 3300037466 Bacteria 2707
409 Ga0395898_0166002 3300037466 Bacteria 2111
410 Ga0395898_0183688 3300037466 Bacteria 1998
411 Ga0395898_0706055 3300037466 Bacteria 950
412 Ga0395905_0036681 3300037471 Bacteria 4605
413 Ga0395905_0114179 3300037471 Bacteria 2538
414 Ga0395905_0170937 3300037471 Bacteria 2041
415 Ga0395905_0561610 3300037471 Bacteria 1042
416 Ga0395901_0000390 3300038443 Bacteria 52341
417 Ga0395901_0035043 3300038443 Bacteria 5186
418 Ga0395901_0036495 3300038443 Bacteria 5081
419 Ga0395901_0106245 3300038443 Bacteria 2947
420 Ga0395901_0129446 3300038443 Bacteria 2652
421 Ga0395901_0230120 3300038443 Bacteria 1935
422 Ga0395901_0298488 3300038443 Bacteria 1670
423 Ga0395901_0335195 3300038443 Bacteria 1563
424 Ga0395901_0492025 3300038443 Bacteria 1249
425 Ga0395901_1079948 3300038443 Bacteria 774
426 Ga0395901_1216205 3300038443 Bacteria 718
427 Ga0439458_0076413 3300042157 Bacteria 850
428 Ga0466969_0002081 3300044656 Bacteria 10681
429 Ga0466972_0285335 3300044658 Bacteria 771
430 Ga0466965_0285829 3300044683 Bacteria 892
431 Ga0466966_0002468 3300044684 Bacteria 12107
432 Ga0466961_0100659 3300044693 Bacteria 1820
433 Ga0466963_0224301 3300044694 Bacteria 1316
434 Ga0466964_0194437 3300044706 Bacteria 970
435 Ga0466970_0107602 3300044765 Bacteria 1521
436 Ga0466957_0006888 3300044842 Bacteria 6422
437 Ga0466959_0675936 3300045049 Bacteria 692
438 Ga0466959_1127061 3300045049 Bacteria 521
439 Ga0466958_0002165 3300045836 Bacteria 9784
440 Ga0495669_0000602 3300046684 Bacteria 15746
441 Ga0495677_0042888 3300047445 Bacteria 1658
442 Ga0496101_1165174 3300048904 Unclassified 604
443 Ga0496107_0261320 3300048910 Bacteria 1288
444 Ga0496108_0243808 3300048911 Bacteria 1563
445 Ga0496109_0025686 3300048912 Bacteria 5250
446 Ga0496110_0001413 3300048913 Bacteria 17353
447 Ga0496111_0011130 3300048914 Bacteria 6055
448 Ga0501032_0009949 3300049569 Bacteria 6866
449 Ga0501032_0070379 3300049569 Bacteria 2333
450 Ga0501034_0059076 3300049571 Bacteria 3852
451 Ga0501037_0185165 3300049573 Bacteria 1476
452 Ga0501043_0017818 3300049579 Bacteria 5567
453 Ga0501046_0039450 3300049580 Bacteria 3781
454 Ga0501046_0093928 3300049580 Bacteria 2305
455 Ga0501047_0000560 3300049581 Bacteria 39989
456 Ga0501048_0171391 3300049582 Bacteria 1537
457 Ga0501068_1025366 3300049584 Unclassified 545
458 Ga0501070_0007352 3300049586 Bacteria 9353
459 Ga0501239_023830 3300049672 Bacteria 768
460 Ga0501234_092786 3300049707 Bacteria 543
461 Ga0501035_0025259 3300049822 Bacteria 5446
462 Ga0501035_0106500 3300049822 Bacteria 2458
463 Ga0501044_1411818 3300049823 Bacteria 562
464 Ga0439448_0081646
465 JGI24736J21556_1000117
466 JGI24741J21665_1000086
467 JGI24741J21665_1010128
468 JGI24740J21852_10001689
469 JGI24740J21852_10004032
470 JGI24740J21852_10071554
471 JGI24740J21852_10121152
472 JGI24737J22298_10045660
473 JGI24735J21928_10002477
474 JGI24735J21928_10036645
475 rootH2_10003120
476 Ga0055542_1038168
477 Ga0058863_11863976
478 Ga0070658_10000876
479 Ga0070658_10002895
480 Ga0070658_10004333
481 Ga0070658_10009991
482 Ga0070658_10045139
483 Ga0070658_10066209
484 Ga0070658_10125826
485 Ga0070658_10174463
486 Ga0070658_10210349
487 Ga0070658_10220889
488 Ga0070658_10418032
489 Ga0070658_10536811
490 Ga0070658_10688134
491 Ga0070658_11133503
492 Ga0070676_10104970
493 Ga0070683_100010109
494 Ga0070683_100029813
495 Ga0070683_100259377
496 Ga0070683_102087561
497 Ga0070690_100396724
498 Ga0070690_100803362
499 Ga0070670_100000350
500 Ga0070670_100087725
501 Ga0070670_101904824
502 Ga0070677_10014798
503 Ga0070677_10024197
504 Ga0068869_100289087
505 Ga0070666_10048528
506 Ga0070666_10109560
507 Ga0070680_100081304
508 Ga0070680_100098394
509 Ga0070680_100509030
510 Ga0070682_101724676
511 Ga0070660_100000487
512 Ga0070660_100001158
513 Ga0070660_100001347
514 Ga0070660_100002825
515 Ga0070660_100003460
516 Ga0070660_100020422
517 Ga0070660_100048825
518 Ga0070660_100086963
519 Ga0070660_100100856
520 Ga0070660_100124398
521 Ga0070660_100124609
522 Ga0070660_100837421
523 Ga0070691_10003062
524 Ga0070661_100023216
525 Ga0070661_100034152
526 Ga0070661_100056574
527 Ga0070661_100102420
528 Ga0070661_100119074
529 Ga0070661_100221933
530 Ga0070661_100669722
531 Ga0070661_101329724
532 Ga0070692_10015183
533 Ga0070692_10020675
534 Ga0070692_10035727
535 Ga0070692_10125395
536 Ga0070669_100026397
537 Ga0070675_100001857
538 Ga0070671_100001032
539 Ga0070671_100024364
540 Ga0070671_100190451
541 Ga0070671_101721547
542 Ga0070673_100003253
543 Ga0070673_100079938
544 Ga0070659_100001753
545 Ga0070659_100005514
546 Ga0070659_100016535
547 Ga0070659_100031769
548 Ga0070659_100066291
549 Ga0070659_100290272
550 Ga0070659_100786129
551 Ga0070659_101109473
552 Ga0070667_100098706
553 Ga0070667_100140880
554 Ga0070703_10304587
555 Ga0070663_100007970
556 Ga0070663_100018655
557 Ga0070663_100073794
558 Ga0070663_100182382
559 Ga0070663_100227285
560 Ga0070663_101068355
561 Ga0070678_100237869
562 Ga0070662_100008923
563 Ga0070662_100063945
564 Ga0070662_100159328
565 Ga0070662_101427450
566 Ga0070681_10118510
567 Ga0070681_10171116
568 Ga0070681_10283650
569 Ga0068867_100650633
570 Ga0070699_100768640
571 Ga0070679_100134002
572 Ga0070679_100183733
573 Ga0070679_100243853
574 Ga0070679_100351869
575 Ga0070679_100377724
576 Ga0070684_100001830
577 Ga0070684_100068323
578 Ga0070684_100132628
579 Ga0068853_100004017
580 Ga0068853_100056982
581 Ga0068853_100407462
582 Ga0068853_101815079
583 Ga0070672_100005889
584 Ga0070696_100141995
585 Ga0070696_100246173
586 Ga0070696_101244168
587 Ga0070693_100834999
588 Ga0070665_100412069
589 Ga0068855_100000079
590 Ga0068855_100015129
591 Ga0068855_100180150
592 Ga0068855_100182939
593 Ga0068855_100700158
594 Ga0068855_101903014
595 Ga0070664_100003170
596 Ga0070664_100004435
597 Ga0070664_100038561
598 Ga0070664_100769631
599 Ga0070664_101872809
600 Ga0068857_100020042
601 Ga0068857_100022379
602 Ga0068857_100042493
603 Ga0068857_100089401
604 Ga0068857_100255816
605 Ga0068854_100001146
606 Ga0068854_100119141
607 Ga0068854_100120496
608 Ga0068854_100150411
609 Ga0068854_100299260
610 Ga0068854_100493444
611 Ga0068854_100860685
612 Ga0068854_101054242
613 Ga0068854_101311342
614 Ga0068856_100022339
615 Ga0068856_100062965
616 Ga0068856_100185796
617 Ga0068856_100624681
618 Ga0068856_101070213
619 Ga0068856_101494215
620 Ga0070702_100844090
621 Ga0068852_100019828
622 Ga0068852_100025625
623 Ga0068852_100036896
624 Ga0068852_101949679
625 Ga0068852_102372585
626 Ga0068852_102454332
627 Ga0068864_100192337
628 Ga0068851_10066505
629 Ga0068851_10133379
630 Ga0068863_102240324
631 Ga0068858_100489698
632 Ga0068860_102217685
633 Ga0068871_100621133
634 Ga0105240_10006152
635 Ga0105240_10007155
636 Ga0105243_10157261
637 Ga0105241_10159554
638 Ga0105248_10008720
639 Ga0105248_10753662
640 Ga0105237_10022017
641 Ga0105237_10130338
642 Ga0105237_10385939
643 Ga0105237_10826026
644 Ga0105238_10004239
645 Ga0105238_10026814
646 Ga0105239_10436892
647 Ga0157373_10003029
648 Ga0157373_10003770
649 Ga0157373_10010908
650 Ga0157373_10021117
651 Ga0157373_10048905
652 Ga0157373_10104794
653 Ga0157373_10247265
654 Ga0157371_10000261
655 Ga0157371_10010561
656 Ga0157371_10027348
657 Ga0157371_10031157
658 Ga0157371_10097465
659 Ga0157371_10132181
660 Ga0157371_10490143
661 Ga0157371_10740748
662 Ga0157370_10009252
663 Ga0157370_10015810
664 Ga0157370_10021618
665 Ga0157370_10434083
666 Ga0157370_10472216
667 Ga0157370_10607283
668 Ga0157370_11863806
669 Ga0157369_10015792
670 Ga0157369_10066536
671 Ga0157369_10114879
672 Ga0157369_10217104
673 Ga0157369_10246392
674 Ga0157369_11944525
675 Ga0157374_10047489
676 Ga0157374_11261620
677 Ga0157378_10431625
678 Ga0157372_10026860
679 Ga0157372_10076275
680 Ga0157372_10113929
681 Ga0157372_10442948
682 Ga0157372_10768126
683 Ga0157372_11852901
684 Ga0157375_10055112
685 Ga0163163_10273323
686 Ga0163163_12457713
687 Ga0163161_10020224
688 Ga0206356_10267260
689 Ga0206356_10583009
690 Ga0206355_1185753
691 Ga0206355_1378246
692 Ga0206351_10505324
693 Ga0206351_10608247
694 Ga0206351_10797287
695 Ga0206352_10130232
696 Ga0206353_10241471
697 Ga0154015_1120478
698 Ga0154015_1206154
699 Ga0224712_10013540
700 Ga0224712_10119128
701 Ga0209148_1000146
702 Ga0209455_1018488
703 Ga0207656_10007269
704 Ga0207682_10017878
705 Ga0207688_10673827
706 Ga0207680_10177765
707 Ga0207647_10002290
708 Ga0207647_10002620
709 Ga0207647_10020613
710 Ga0207647_10026471
711 Ga0207647_10083526
712 Ga0207647_10098768
713 Ga0207647_10200830
714 Ga0207647_10517903
715 Ga0207645_10014332
716 Ga0207705_10000003
717 Ga0207705_10000125
718 Ga0207705_10000749
719 Ga0207705_10002384
720 Ga0207705_10003398
721 Ga0207705_10004946
722 Ga0207705_10017120
723 Ga0207705_10052745
724 Ga0207705_10084534
725 Ga0207705_10179707
726 Ga0207705_10538292
727 Ga0207705_10700402
728 Ga0207654_10110228
729 Ga0207707_10124693
730 Ga0207707_10253949
731 Ga0207707_11016904
732 Ga0207707_11658229
733 Ga0207695_10004896
734 Ga0207695_10009694
735 Ga0207695_10014439
736 Ga0207671_10605160
737 Ga0207660_10031084
738 Ga0207660_10068517
739 Ga0207660_10286268
740 Ga0207660_10716391
741 Ga0207657_10000167
742 Ga0207657_10000431
743 Ga0207657_10002665
744 Ga0207657_10002957
745 Ga0207657_10003327
746 Ga0207657_10007729
747 Ga0207657_10017579
748 Ga0207657_10023542
749 Ga0207657_10027574
750 Ga0207657_10137998
751 Ga0207657_10191909
752 Ga0207649_10003373
753 Ga0207649_10007823
754 Ga0207649_10007890
755 Ga0207649_10169901
756 Ga0207652_10245060
757 Ga0207652_10352084
758 Ga0207652_10806986
759 Ga0207652_11219849
760 Ga0207681_10020618
761 Ga0207694_10073033
762 Ga0207694_10081653
763 Ga0207659_10002256
764 Ga0207664_10716238
765 Ga0207644_10007270
766 Ga0207644_11068245
767 Ga0207690_10002554
768 Ga0207690_10016955
769 Ga0207690_10029992
770 Ga0207690_10975601
771 Ga0207690_11078515
772 Ga0207690_11220598
773 Ga0207706_10001609
774 Ga0207706_10018320
775 Ga0207706_10069641
776 Ga0207709_10219028
777 Ga0207691_10012970
778 Ga0207711_10029142
779 Ga0207661_10002656
780 Ga0207661_10055597
781 Ga0207661_10536241
782 Ga0207661_11138772
783 Ga0207679_10004108
784 Ga0207679_10029566
785 Ga0207667_10003195
786 Ga0207667_10016249
787 Ga0207667_10022365
788 Ga0207667_10114757
789 Ga0207651_10002735
790 Ga0207651_10566753
791 Ga0207668_11052015
792 Ga0207640_10018303
793 Ga0207640_10018863
794 Ga0207640_10875930
795 Ga0207640_11362824
796 Ga0207658_10054700
797 Ga0207677_10372319
798 Ga0207639_10014469
799 Ga0207639_10048961
800 Ga0207639_11681811
801 Ga0207678_10006856
802 Ga0207678_10015645
803 Ga0207678_10024785
804 Ga0207678_10028356
805 Ga0207678_10037300
806 Ga0207678_10072949
807 Ga0207678_10077225
808 Ga0207678_10102181
809 Ga0207702_10004728
810 Ga0207702_10015728
811 Ga0207702_10046986
812 Ga0207702_10063532
813 Ga0207702_10079131
814 Ga0207702_11410151
815 Ga0207702_11443337
816 Ga0207641_10674970
817 Ga0207648_10065272
818 Ga0207676_10164412
819 Ga0207674_10002263
820 Ga0207674_10015574
821 Ga0207674_10094403
822 Ga0207674_10134849
823 Ga0207674_10635375
824 Ga0207683_10274699
825 Ga0207698_10002762
826 Ga0207698_10005143
827 Ga0207698_10012876
828 Ga0209974_10017367
829 Ga0268266_10021435
830 Ga0268266_10534813
831 Ga0307408_100304612
832 Ga0307410_10030530
833 Ga0307410_10093859
834 Ga0307410_10633194
835 Ga0307410_10854793
836 Ga0307410_11548716
837 Ga0307410_11967320
838 Ga0307406_10076152
839 Ga0307407_10407837
840 Ga0307407_10993416
841 Ga0307412_10030936
842 Ga0307409_100229342
843 Ga0307409_100344178
844 Ga0307416_100047749
845 Ga0307416_100187560
846 Ga0307414_10246087
847 Ga0307414_10247490
848 Ga0307414_10598913
849 Ga0307414_10729571
850 Ga0307411_10057840
851 Ga0395899_0001008
852 Ga0395899_0011331
853 Ga0395899_0026185
854 Ga0395899_0063427
855 Ga0395899_0064052
856 Ga0395899_0075828
857 Ga0395899_0285089
858 Ga0395900_0000547
859 Ga0395900_0021017
860 Ga0395900_0023164
861 Ga0395900_0038603
862 Ga0395900_0049937
863 Ga0395900_0281558
864 Ga0395900_0300204
865 Ga0395900_0410423
866 Ga0395900_0603268
867 Ga0395900_0800408
868 Ga0395898_0033353
869 Ga0395898_0034888
870 Ga0395898_0076728
871 Ga0395898_0105132
872 Ga0395898_0166002
873 Ga0395898_0183688
874 Ga0395898_0706055
875 Ga0395905_0036681
876 Ga0395905_0114179
877 Ga0395905_0170937
878 Ga0395905_0561610
879 Ga0395901_0000390
880 Ga0395901_0035043
881 Ga0395901_0036495
882 Ga0395901_0106245
883 Ga0395901_0129446
884 Ga0395901_0230120
885 Ga0395901_0298488
886 Ga0395901_0335195
887 Ga0395901_0492025
888 Ga0395901_1079948
889 Ga0395901_1216205
890 Ga0439458_0076413
891 Ga0466969_0002081
892 Ga0466972_0285335
893 Ga0466965_0285829
894 Ga0466966_0002468
895 Ga0466961_0100659
896 Ga0466963_0224301
897 Ga0466964_0194437
898 Ga0466970_0107602
899 Ga0466957_0006888
900 Ga0466959_0675936
901 Ga0466959_1127061
902 Ga0466958_0002165
903 Ga0495669_0000602
904 Ga0495677_0042888
905 Ga0496101_1165174
906 Ga0496107_0261320
907 Ga0496108_0243808
908 Ga0496109_0025686
909 Ga0496110_0001413
910 Ga0496111_0011130
911 Ga0501032_0009949
912 Ga0501032_0070379
913 Ga0501034_0059076
914 Ga0501037_0185165
915 Ga0501043_0017818
916 Ga0501046_0039450
917 Ga0501046_0093928
918 Ga0501047_0000560
919 Ga0501048_0171391
920 Ga0501068_1025366
921 Ga0501070_0007352
922 Ga0501239_023830
923 Ga0501234_092786
924 Ga0501035_0025259
925 Ga0501035_0106500
926 Ga0501044_1411818

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13473

Cupredoxin_1

Cupredoxin-like domain

7

114

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hbe-assembly1.cif.gz_B cu-containing nitrite reductase (nirk) from thermus scotoductus sa-01 0.8793 27 106
1id2-assembly3.cif.gz_C crystal structure of amicyanin from paracoccus versutus (thiobacillus versutus) 0.8546 27 105
2uxg-assembly1.cif.gz_A pseudoazurin with engineered amicyanin ligand loop, reduced form, ph 5.5 0.8396 27 105
5fc9-assembly1.cif.gz_D novel purple cupredoxin from nitrosopumilus maritimus 0.8393 28 105
5yw3-assembly3.cif.gz_C x-ray crystal structure of pseudoazurin thr36lys variant 0.8342 27 105
ID Description Score Start End Superfamily
2bzcA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8305 29 105 2.60.40.420
5fc9B00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8285 28 105 2.60.40.420
4hcfA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8059 26 105 2.60.40.420
af_P22698_19_105_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8029 24 105 2.60.40.420
1jxdA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8 27 105 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A7W5LKI2-F1-model_v4 Plastocyanin 0.9543 23 106
AF-A0A502Y172-F1-model_v4 Amicyanin 0.9533 21 106
AF-A0A436BJB7-F1-model_v4 Amicyanin 0.9527 22 106
AF-A0A503XHC7-F1-model_v4 Amicyanin 0.9516 22 106
AF-A0A531KTJ7-F1-model_v4 deleted 0.9513 26 106

Map