F449209

General Info

Members Datasets Scaffolds Average Seq Length
463 316 926 347

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2857576091|2857577537
Length 411
Sequence KLVLLLIILVVVAVLVYVGMKFIPGSSSGPTPPPTTGKNAEAKPAGNPSLTVATVLPQRVQLPISLAANGNVMAWQEAVIGSEANGLRLKEVRVNVGDTVKAGQVLAIFASETVNADVAQARAAVTEANATAADASANAKRAQTLQRTGALSEQQINQYLTTADTARARVESARATLEAQQLRLTQTRVLAPDDGVISSRTATVGSVVGVGTELFKMIRKGRLEWRAEVTSAELGRLAPGTKVKVTAPSGATLDGTVRMIAPTVDPQTRNAMVYVDLPVTADSAMPVKAGMFAHGEFVLGESSAVTVPQQAVLLRDGFSYVFQLRDRSGETGHVSQAKVQTGRRLGEQVEIIEGLAPDAQVVVRGAAFLTDGDLVRVVDEAAPAAVPGAVTSPPPAAPLSTTSPVVPGAKP

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
13 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
86 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
87 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
88 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
100 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
101 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
104 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
105 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
106 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
163 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
167 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
168 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
169 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
173 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
181 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
182 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
183 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
184 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
185 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
186 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
187 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
188 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
189 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
190 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
191 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
192 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
193 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
194 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
197 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
198 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
199 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
200 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
201 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
202 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
206 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
213 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
214 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
215 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
218 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
221 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
229 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
230 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
231 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
232 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
244 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
245 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
246 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
247 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
248 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
249 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
253 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
254 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
255 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
259 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
260 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
263 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
264 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
265 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
266 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
267 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
268 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
269 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
270 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
271 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
272 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
273 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
274 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
275 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
276 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
277 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
278 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
279 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
280 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
281 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
282 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
283 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
284 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
285 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
286 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
287 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
288 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
289 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
290 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
291 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
292 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
293 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
294 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
295 2643221585 Pelomonas sp. Root662 Isolate Unclassified
296 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
297 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
298 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
299 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
300 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
301 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
302 2643221656 Pelomonas sp. Root405 Isolate Unclassified
303 2643221660 Methylibium sp. Root1272 Isolate Unclassified
304 2738541337 Pelomonas sp. BT06 Isolate Unclassified
305 2738543013 Variovorax sp. BT01 Isolate Unclassified
306 2818991436 Collimonas arenae 515 Isolate Unclassified
307 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
308 2857564685 Duganella sp. R-74599 Isolate Unclassified
309 2885266251 Ralstonia sp. SET104 Isolate Nodule
310 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
311 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
312 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
313 2928058823 Ralstonia sp. 1138 Isolate Unclassified
314 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
315 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
316 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.28
Metatranscriptomes 0.65
Isolates 9.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.52
Nodule 0.22
Rhizoplane 5.4
Rhizosphere 65.66
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000448 3300001915 Bacteria 12506
2 JGI24740J21852_10000149 3300001979 Bacteria 27167
3 JGI24740J21852_10000159 3300001979 Bacteria 26704
4 JGI25162J39368_1000025 3300002737 Bacteria 228879
5 JGI25162J39368_1000263 3300002737 Bacteria 50433
6 JGI25152J39213_1004332 3300002773 Bacteria 4507
7 JGI25165J46597_1000054 3300003214 Bacteria 228891
8 JGI25153J46596_10000006 3300003215 Bacteria 447760
9 JGI25153J46596_10004907 3300003215 Bacteria 7110
10 rootH1_10015820 3300003316 Bacteria 9106
11 rootL2_10045667 3300003322 Bacteria 4170
12 rootL2_10166950 3300003322 Bacteria 2910
13 rootL2_10212651 3300003322 Bacteria 2251
14 Ga0055538_1000026 3300003751 Bacteria 228891
15 Ga0055538_1002449 3300003751 Bacteria 2717
16 Ga0055538_1004594 3300003751 Bacteria 1542
17 Ga0055539_1000033 3300003752 Bacteria 228891
18 Ga0055539_1000086 3300003752 Bacteria 117621
19 Ga0055533_1000044 3300003756 Bacteria 228891
20 Ga0055533_1000694 3300003756 Bacteria 11041
21 Ga0055533_1004738 3300003756 Bacteria 2364
22 Ga0055532_1000041 3300003758 Bacteria 195749
23 Ga0055525_1000052 3300003759 Bacteria 228891
24 Ga0055525_1000537 3300003759 Bacteria 18089
25 Ga0055535_1000030 3300003761 Bacteria 195749
26 Ga0055542_1000628 3300003762 Bacteria 29630
27 Ga0055529_1000058 3300003763 Bacteria 195735
28 Ga0055526_1000475 3300003771 Bacteria 31936
29 Ga0055534_1000581 3300003784 Bacteria 19193
30 Ga0055531_10000007 3300003794 Bacteria 225289
31 Ga0055541_1000069 3300003841 Bacteria 94648
32 Ga0055541_1001179 3300003841 Bacteria 5832
33 Ga0055541_1009313 3300003841 Bacteria 1524
34 Ga0065165_1000863 3300005262 Bacteria 39623
35 Ga0070676_10079234 3300005328 Bacteria 1989
36 Ga0070683_100040450 3300005329 Bacteria 4287
37 Ga0070683_100042386 3300005329 Bacteria 4191
38 Ga0070683_100049742 3300005329 Bacteria 3878
39 Ga0070670_100010447 3300005331 Bacteria 7922
40 Ga0070677_10002086 3300005333 Bacteria 6368
41 Ga0068869_100000109 3300005334 Bacteria 39248
42 Ga0070666_10043113 3300005335 Bacteria 3020
43 Ga0070666_10079575 3300005335 Bacteria 2238
44 Ga0070682_100010460 3300005337 Bacteria 5266
45 Ga0070682_100075994 3300005337 Bacteria 2161
46 Ga0068868_100000895 3300005338 Bacteria 20275
47 Ga0068868_100035945 3300005338 Bacteria 3831
48 Ga0070660_100005137 3300005339 Bacteria 9047
49 Ga0070660_100108469 3300005339 Bacteria 2207
50 Ga0070661_100000072 3300005344 Bacteria 82584
51 Ga0070661_100011993 3300005344 Bacteria 6055
52 Ga0070661_100065151 3300005344 Bacteria 2677
53 Ga0070661_100103835 3300005344 Bacteria 2117
54 Ga0070668_100029724 3300005347 Bacteria 4152
55 Ga0070668_100088128 3300005347 Bacteria 2443
56 Ga0070669_100017130 3300005353 Bacteria 5170
57 Ga0070669_100022290 3300005353 Bacteria 4530
58 Ga0070675_100000621 3300005354 Bacteria 24557
59 Ga0070675_100010564 3300005354 Bacteria 7216
60 Ga0070671_100044570 3300005355 Bacteria 3686
61 Ga0070671_100062233 3300005355 Bacteria 3108
62 Ga0070674_100113799 3300005356 Unclassified 1991
63 Ga0070673_100023166 3300005364 Bacteria 4534
64 Ga0070688_100039243 3300005365 Bacteria 2897
65 Ga0070659_100017393 3300005366 Bacteria 5409
66 Ga0070659_100295927 3300005366 Bacteria 1348
67 Ga0070667_100004338 3300005367 Bacteria 11962
68 Ga0070663_100000015 3300005455 Bacteria 131905
69 Ga0070663_100003719 3300005455 Bacteria 8843
70 Ga0070662_100001965 3300005457 Bacteria 12626
71 Ga0068867_100001189 3300005459 Bacteria 17854
72 Ga0070685_10020898 3300005466 Bacteria 3549
73 Ga0070679_100009359 3300005530 Bacteria 9265
74 Ga0070684_100055993 3300005535 Bacteria 3439
75 Ga0070684_100070918 3300005535 Bacteria 3067
76 Ga0068853_100006482 3300005539 Bacteria 9309
77 Ga0070672_100000163 3300005543 Bacteria 36844
78 Ga0070672_100008125 3300005543 Bacteria 7172
79 Ga0070672_100105021 3300005543 Bacteria 2296
80 Ga0070693_100070363 3300005547 Bacteria 2059
81 Ga0070693_100079681 3300005547 Bacteria 1949
82 Ga0070665_100034040 3300005548 Bacteria 5123
83 Ga0070664_100000058 3300005564 Bacteria 67966
84 Ga0070664_100012851 3300005564 Bacteria 6811
85 Ga0070664_100014025 3300005564 Bacteria 6536
86 Ga0068857_100029891 3300005577 Bacteria 4808
87 Ga0068857_100103925 3300005577 Bacteria 2550
88 Ga0068854_100000025 3300005578 Bacteria 123547
89 Ga0068854_100020625 3300005578 Bacteria 4464
90 Ga0068856_100000084 3300005614 Bacteria 87749
91 Ga0068856_100029175 3300005614 Bacteria 5389
92 Ga0068856_100166708 3300005614 Bacteria 2214
93 Ga0068856_100206696 3300005614 Bacteria 1978
94 Ga0068852_100003094 3300005616 Bacteria 11584
95 Ga0068852_100016740 3300005616 Bacteria 5729
96 Ga0068852_100053997 3300005616 Bacteria 3461
97 Ga0068852_100063852 3300005616 Bacteria 3207
98 Ga0068852_100160114 3300005616 Bacteria 2101
99 Ga0068859_100010952 3300005617 Bacteria 9127
100 Ga0068859_100049787 3300005617 Bacteria 4208
101 Ga0068864_100004021 3300005618 Bacteria 12083
102 Ga0068864_100020937 3300005618 Bacteria 5474
103 Ga0068861_100000126 3300005719 Bacteria 39277
104 Ga0068863_100012220 3300005841 Bacteria 8291
105 Ga0068863_100023051 3300005841 Bacteria 5950
106 Ga0068858_100010727 3300005842 Bacteria 8668
107 Ga0068858_100150840 3300005842 Bacteria 2186
108 Ga0068860_100076801 3300005843 Bacteria 3176
109 Ga0075366_10004679 3300006195 Bacteria 7362
110 Ga0097621_100004823 3300006237 Bacteria 9444
111 Ga0075370_10006053 3300006353 Bacteria 6061
112 Ga0075370_10091239 3300006353 Bacteria 1757
113 Ga0068871_100017048 3300006358 Bacteria 5488
114 Ga0068871_100029265 3300006358 Bacteria 4324
115 Ga0068871_100112782 3300006358 Bacteria 2289
116 Ga0075430_100204068 3300006846 Bacteria 1641
117 Ga0068865_100206653 3300006881 Bacteria 1527
118 Ga0097620_100010952 3300006931 Bacteria 9127
119 Ga0097620_100049787 3300006931 Bacteria 4208
120 Ga0105240_10218069 3300009093 Bacteria 2224
121 Ga0105240_10309461 3300009093 Bacteria 1804
122 Ga0105245_10004379 3300009098 Bacteria 12497
123 Ga0105245_10023026 3300009098 Bacteria 5466
124 Ga0105248_10446105 3300009177 Bacteria 1458
125 Ga0105237_10191789 3300009545 Bacteria 2043
126 Ga0105238_10013310 3300009551 Bacteria 8299
127 Ga0105239_10110940 3300010375 Bacteria 3040
128 Ga0157373_10061038 3300013100 Bacteria 2670
129 Ga0157373_10163496 3300013100 Bacteria 1566
130 Ga0157371_10000100 3300013102 Bacteria 131924
131 Ga0157370_10000004 3300013104 Bacteria 366426
132 Ga0157369_10000809 3300013105 Bacteria 39990
133 Ga0157369_10173407 3300013105 Bacteria 2271
134 Ga0157372_10000279 3300013307 Bacteria 56725
135 Ga0157372_10009183 3300013307 Bacteria 10510
136 Ga0157372_10025361 3300013307 Bacteria 6445
137 Ga0157375_10005134 3300013308 Bacteria 11369
138 Ga0157375_10013596 3300013308 Bacteria 7251
139 Ga0157375_10017755 3300013308 Bacteria 6432
140 Ga0157375_10022735 3300013308 Bacteria 5775
141 Ga0157375_10373457 3300013308 Bacteria 1592
142 Ga0182008_10000421 3300014497 Bacteria 32709
143 Ga0182008_10063458 3300014497 Bacteria 1819
144 Ga0157377_10001137 3300014745 Bacteria 11282
145 Ga0157379_10005980 3300014968 Bacteria 10491
146 Ga0157379_10010227 3300014968 Bacteria 8171
147 Ga0157379_10018220 3300014968 Bacteria 6188
148 Ga0157376_10006475 3300014969 Bacteria 8275
149 Ga0157376_10006935 3300014969 Bacteria 8029
150 Ga0182006_1005758 3300015261 Bacteria 5848
151 Ga0182006_1017978 3300015261 Bacteria 2993
152 Ga0182006_1021250 3300015261 Bacteria 2709
153 Ga0182007_10001289 3300015262 Bacteria 13564
154 Ga0182007_10009797 3300015262 Bacteria 3829
155 Ga0182007_10016887 3300015262 Bacteria 2681
156 Ga0182007_10025805 3300015262 Bacteria 2043
157 Ga0182005_1000995 3300015265 Bacteria 12216
158 Ga0183362_10001 3300015683 Bacteria 2046624
159 Ga0163161_10032865 3300017792 Bacteria 3706
160 Ga0209760_101443 3300025207 Bacteria 2515
161 Ga0209784_100020 3300025224 Bacteria 412353
162 Ga0209784_100029 3300025224 Bacteria 347315
163 Ga0209784_100508 3300025224 Bacteria 15150
164 Ga0209566_100020 3300025225 Bacteria 412353
165 Ga0209566_100030 3300025225 Bacteria 347329
166 Ga0209566_100277 3300025225 Bacteria 47887
167 Ga0209674_100035 3300025226 Bacteria 412353
168 Ga0209674_100081 3300025226 Bacteria 201146
169 Ga0209674_100089 3300025226 Bacteria 178751
170 Ga0209674_100123 3300025226 Bacteria 131438
171 Ga0209674_100289 3300025226 Bacteria 36645
172 Ga0209672_100247 3300025228 Bacteria 40787
173 Ga0209147_100008 3300025229 Bacteria 777096
174 Ga0209563_100038 3300025230 Bacteria 412353
175 Ga0209563_100091 3300025230 Bacteria 168320
176 Ga0209563_100092 3300025230 Bacteria 167669
177 Ga0209563_101162 3300025230 Bacteria 7390
178 Ga0209437_100066 3300025233 Bacteria 327883
179 Ga0209258_100013 3300025242 Bacteria 777096
180 Ga0207425_1012551 3300025245 Bacteria 1983
181 Ga0209646_1000065 3300025246 Bacteria 245452
182 Ga0209677_100030 3300025253 Bacteria 347314
183 Ga0209677_100031 3300025253 Bacteria 329719
184 Ga0209677_102538 3300025253 Bacteria 6754
185 Ga0209148_1000113 3300025254 Bacteria 195646
186 Ga0209148_1004805 3300025254 Bacteria 3232
187 Ga0209759_1000492 3300025256 Bacteria 43562
188 Ga0209129_1000038 3300025258 Bacteria 322778
189 Ga0209233_1000060 3300025261 Bacteria 412379
190 Ga0209455_1000106 3300025272 Bacteria 195801
191 Ga0209673_1001320 3300025273 Bacteria 24966
192 Ga0209673_1020829 3300025273 Bacteria 2309
193 Ga0209675_1006002 3300025291 Bacteria 4970
194 Ga0209676_1006611 3300025292 Bacteria 5668
195 Ga0209564_1000129 3300025295 Bacteria 195163
196 Ga0209758_1000001 3300025297 Bacteria 1981790
197 Ga0209758_1000089 3300025297 Bacteria 251523
198 Ga0209758_1000600 3300025297 Bacteria 55923
199 Ga0209050_1002913 3300025298 Bacteria 13434
200 Ga0209050_1014738 3300025298 Bacteria 3340
201 Ga0209051_1003740 3300025303 Bacteria 9783
202 Ga0209257_1000021 3300025304 Bacteria 771986
203 Ga0209257_1006298 3300025304 Bacteria 7744
204 Ga0209257_1021236 3300025304 Bacteria 2368
205 Ga0207697_10008487 3300025315 Bacteria 4490
206 Ga0207682_10003347 3300025893 Bacteria 6991
207 Ga0207688_10042533 3300025901 Bacteria 2529
208 Ga0207680_10118030 3300025903 Bacteria 1731
209 Ga0207643_10024010 3300025908 Bacteria 3364
210 Ga0207695_10000535 3300025913 Bacteria 79187
211 Ga0207671_10194597 3300025914 Bacteria 1582
212 Ga0207662_10099781 3300025918 Bacteria 1798
213 Ga0207657_10008286 3300025919 Bacteria 10576
214 Ga0207657_10023461 3300025919 Bacteria 5744
215 Ga0207649_10000222 3300025920 Bacteria 46190
216 Ga0207649_10007761 3300025920 Bacteria 5836
217 Ga0207649_10010503 3300025920 Bacteria 5089
218 Ga0207652_10110087 3300025921 Bacteria 2442
219 Ga0207681_10011548 3300025923 Bacteria 5426
220 Ga0207681_10075133 3300025923 Bacteria 2369
221 Ga0207694_10015923 3300025924 Bacteria 5674
222 Ga0207650_10000887 3300025925 Bacteria 22633
223 Ga0207659_10003612 3300025926 Bacteria 9317
224 Ga0207687_10011547 3300025927 Bacteria 5773
225 Ga0207644_10003968 3300025931 Bacteria 9606
226 Ga0207644_10036294 3300025931 Bacteria 3459
227 Ga0207644_10043077 3300025931 Bacteria 3202
228 Ga0207690_10003347 3300025932 Bacteria 9578
229 Ga0207690_10006695 3300025932 Bacteria 6829
230 Ga0207706_10000736 3300025933 Bacteria 34115
231 Ga0207709_10035457 3300025935 Bacteria 2949
232 Ga0207669_10018827 3300025937 Bacteria 3580
233 Ga0207691_10005598 3300025940 Bacteria 12141
234 Ga0207711_10002545 3300025941 Bacteria 16235
235 Ga0207689_10000259 3300025942 Bacteria 47474
236 Ga0207661_10042324 3300025944 Bacteria 3591
237 Ga0207679_10000038 3300025945 Bacteria 131935
238 Ga0207679_10027441 3300025945 Bacteria 3937
239 Ga0207651_10004962 3300025960 Bacteria 6785
240 Ga0207668_10030926 3300025972 Bacteria 3522
241 Ga0207640_10000096 3300025981 Bacteria 68105
242 Ga0207640_10016404 3300025981 Bacteria 4308
243 Ga0207658_10031397 3300025986 Bacteria 3771
244 Ga0207677_10004015 3300026023 Bacteria 7852
245 Ga0207677_10026152 3300026023 Bacteria 3655
246 Ga0207703_10009860 3300026035 Bacteria 7492
247 Ga0207703_10016236 3300026035 Bacteria 5803
248 Ga0207703_10109441 3300026035 Bacteria 2355
249 Ga0207639_10024668 3300026041 Bacteria 4355
250 Ga0207678_10000021 3300026067 Bacteria 131877
251 Ga0207678_10007496 3300026067 Bacteria 9645
252 Ga0207702_10000203 3300026078 Bacteria 70226
253 Ga0207702_10023380 3300026078 Bacteria 5125
254 Ga0207702_10069259 3300026078 Bacteria 3033
255 Ga0207641_10021159 3300026088 Bacteria 5347
256 Ga0207641_10030693 3300026088 Bacteria 4452
257 Ga0207641_10062488 3300026088 Bacteria 3178
258 Ga0207648_10196449 3300026089 Bacteria 1789
259 Ga0207676_10008910 3300026095 Bacteria 7139
260 Ga0207676_10011244 3300026095 Bacteria 6395
261 Ga0207674_10030619 3300026116 Bacteria 5657
262 Ga0207674_10057191 3300026116 Bacteria 3954
263 Ga0207675_100000307 3300026118 Bacteria 46857
264 Ga0207698_10010835 3300026142 Bacteria 5884
265 Ga0207698_10015293 3300026142 Bacteria 5135
266 Ga0268264_10030553 3300028381 Bacteria 4416
267 Ga0268264_10123725 3300028381 Bacteria 2283
268 Ga0307515_10016569 3300028794 Bacteria 13487
269 Ga0307515_10073001 3300028794 Bacteria 4620
270 Ga0307515_10244857 3300028794 Bacteria 1556
271 Ga0265327_10031965 3300031251 Bacteria 2952
272 Ga0265316_10007164 3300031344 Bacteria 10538
273 Ga0307513_10200053 3300031456 Bacteria 1840
274 Ga0307408_100000040 3300031548 Bacteria 175456
275 Ga0316579_10000226 3300031691 Bacteria 17150
276 Ga0316576_10016405 3300031727 Bacteria 5000
277 Ga0307413_10000647 3300031824 Bacteria 11775
278 Ga0307414_10033857 3300032004 Bacteria 3381
279 Ga0307414_10133648 3300032004 Bacteria 1930
280 Ga0316583_10035536 3300032133 Bacteria 1768
281 Ga0316585_10039642 3300032137 Bacteria 1498
282 Ga0316580_10000277 3300032139 Bacteria 11029
283 Ga0316588_1000768 3300033528 Bacteria 4774
284 Ga0316587_1002934 3300033529 Bacteria 2334
285 Ga0316596_1004783 3300033541 Bacteria 3059
286 Ga0373956_0022375 3300035119 Bacteria 2705
287 Ga0316574_0000171 3300035398 Bacteria 21585
288 Ga0373931_0049829 3300035691 Bacteria 2226
289 Ga0373933_0106271 3300035724 Unclassified 1747
290 Ga0373937_0001785 3300036401 Bacteria 18065
291 Ga0316584_0166153 3300036712 Bacteria 1638
292 Ga0395900_0032985 3300037418 Bacteria 5329
293 Ga0395900_0103357 3300037418 Bacteria 2926
294 Ga0395905_0021202 3300037471 Bacteria 6149
295 Ga0439439_0018848 3300041406 Bacteria 1708
296 Ga0439466_0018269 3300041411 Bacteria 2517
297 Ga0439465_0001136 3300041413 Bacteria 8524
298 Ga0439465_0001491 3300041413 Bacteria 7591
299 Ga0439442_005508 3300042002 Bacteria 2531
300 Ga0439432_000543 3300042006 Bacteria 14052
301 Ga0439449_0000317 3300042007 Bacteria 17464
302 Ga0439452_020629 3300042010 Bacteria 1726
303 Ga0439457_004029 3300042014 Bacteria 3897
304 Ga0450911_001703 3300042115 Bacteria 4828
305 Ga0450923_008456 3300042125 Bacteria 1773
306 Ga0450891_002786 3300042129 Bacteria 1730
307 Ga0450898_012884 3300042134 Bacteria 1387
308 Ga0439446_0000499 3300042156 Bacteria 7855
309 Ga0439434_0003962 3300042435 Bacteria 4323
310 Ga0439464_0007301 3300042439 Bacteria 2889
311 Ga0451577_0072726 3300042876 Bacteria 3068
312 Ga0451577_0211148 3300042876 Bacteria 1753
313 Ga0466986_0024952 3300044650 Bacteria 4001
314 Ga0466969_0077342 3300044656 Bacteria 1592
315 Ga0466969_0114025 3300044656 Bacteria 1263
316 Ga0466978_0028381 3300044671 Bacteria 3388
317 Ga0453683_0246639 3300044673 Bacteria 1138
318 Ga0466965_0020032 3300044683 Bacteria 3213
319 Ga0466966_0050390 3300044684 Bacteria 2649
320 Ga0466961_0000404 3300044693 Bacteria 27732
321 Ga0466964_0018176 3300044706 Bacteria 2695
322 Ga0453684_0000826 3300044712 Bacteria 104663
323 Ga0453684_0007549 3300044712 Bacteria 19936
324 Ga0453684_0067601 3300044712 Bacteria 4543
325 Ga0466968_0013647 3300044735 Bacteria 3196
326 Ga0466970_0002930 3300044765 Bacteria 8269
327 Ga0466959_0045822 3300045049 Bacteria 3219
328 Ga0451576_0021302 3300045051 Bacteria 7046
329 Ga0451576_0097165 3300045051 Bacteria 3063
330 Ga0451576_0134877 3300045051 Bacteria 2574
331 Ga0451576_0159505 3300045051 Bacteria 2353
332 Ga0451576_0218268 3300045051 Bacteria 1991
333 Ga0451576_0531546 3300045051 Bacteria 1235
334 Ga0466967_0216722 3300045976 Bacteria 1817
335 Ga0495617_001271 3300046452 Bacteria 11259
336 Ga0495603_0083705 3300046455 Bacteria 1868
337 Ga0495638_0036279 3300046460 Bacteria 3142
338 Ga0495651_0010259 3300046462 Bacteria 7194
339 Ga0495651_0027368 3300046462 Bacteria 4440
340 Ga0495653_0020739 3300046463 Bacteria 5323
341 Ga0495607_0000007 3300046501 Bacteria 272517
342 Ga0495607_0000023 3300046501 Bacteria 159908
343 Ga0495628_0010495 3300046516 Bacteria 7866
344 Ga0495628_0015237 3300046516 Bacteria 6422
345 Ga0495628_0088328 3300046516 Bacteria 2402
346 Ga0495632_0001338 3300046519 Bacteria 20700
347 Ga0495632_0007969 3300046519 Bacteria 6577
348 Ga0495643_0000007 3300046522 Bacteria 383435
349 Ga0495652_0019178 3300046529 Bacteria 6093
350 Ga0495654_0003758 3300046530 Bacteria 9193
351 Ga0495645_0067075 3300046543 Bacteria 2591
352 Ga0495634_0195265 3300046642 Bacteria 1260
353 Ga0495599_0018022 3300046678 Bacteria 4397
354 Ga0495623_0015624 3300046679 Bacteria 4907
355 Ga0495646_0024693 3300046680 Bacteria 3784
356 Ga0495600_0008801 3300046809 Bacteria 6216
357 Ga0495604_0031506 3300047317 Bacteria 4205
358 Ga0495676_0256266 3300047321 Bacteria 1192
359 Ga0495687_000242 3300047443 Bacteria 75081
360 Ga0495687_019385 3300047443 Bacteria 3341
361 Ga0495602_0024377 3300048088 Bacteria 5871
362 Ga0495615_0023418 3300048090 Bacteria 1415
363 Ga0495626_0029796 3300048091 Bacteria 2637
364 Ga0496101_0008217 3300048904 Bacteria 6815
365 Ga0496102_0000706 3300048905 Bacteria 33087
366 Ga0496106_0011434 3300048909 Bacteria 6567
367 Ga0496106_0203166 3300048909 Bacteria 1577
368 Ga0496108_0031370 3300048911 Bacteria 4410
369 Ga0496109_0024773 3300048912 Bacteria 5338
370 Ga0496109_0035237 3300048912 Bacteria 4513
371 Ga0496110_0005584 3300048913 Bacteria 9874
372 Ga0496110_0018404 3300048913 Bacteria 5858
373 Ga0496111_0031950 3300048914 Bacteria 3752
374 Ga0496112_0003117 3300048915 Bacteria 13592
375 Ga0496113_0056357 3300048916 Bacteria 2950
376 Ga0496113_0288157 3300048916 Bacteria 1313
377 Ga0496114_0001178 3300048917 Bacteria 19806
378 Ga0496114_0009654 3300048917 Bacteria 7665
379 Ga0496118_0072342 3300048921 Bacteria 2477
380 Ga0496121_0019293 3300048924 Bacteria 6824
381 Ga0496124_0014401 3300048927 Bacteria 7646
382 Ga0496125_0005647 3300048928 Bacteria 13812
383 Ga0496125_0008735 3300048928 Bacteria 10541
384 Ga0501294_001662 3300049517 Bacteria 2204
385 Ga0501300_001892 3300049523 Bacteria 3122
386 Ga0501032_0072071 3300049569 Bacteria 2302
387 Ga0501033_0000035 3300049570 Bacteria 150558
388 Ga0501034_0270585 3300049571 Bacteria 1640
389 Ga0501211_002300 3300049658 Bacteria 2030
390 Ga0501235_001717 3300049669 Bacteria 4704
391 Ga0501221_000078 3300049704 Bacteria 11020
392 Ga0501267_000061 3300049764 Bacteria 6240
393 Ga0501035_0000388 3300049822 Bacteria 50606
394 Ga0501035_0265227 3300049822 Bacteria 1455
395 Ga0501044_0157826 3300049823 Bacteria 2247
396 nmdc:mga0k408_111685_c1 3300050493 Bacteria 1615
397 nmdc:mga0k408_2643_c1 3300050493 Bacteria 9515
398 nmdc:mga07m45_56611_c1 3300050496 Bacteria 2216
399 nmdc:mga07m45_587_c2 3300050496 Bacteria 15224
400 nmdc:mga07m45_6580_c1 3300050496 Bacteria 5886
401 nmdc:mga0a205_329004_c1 3300050515 Archaea 1398
402 Ga0495601_0031288 3300053077 Bacteria 3307
403 Ga0495601_0054607 3300053077 Bacteria 2528
404 Ga0500578_0000622 3300053086 Bacteria 43056
405 Ga0500644_0028828 3300053088 Bacteria 1740
406 Ga0500646_0007026 3300053090 Bacteria 2870
407 Ga0500595_003252 3300053119 Bacteria 7669
408 Ga0500607_019200 3300053121 Bacteria 3872
409 Ga0500617_007001 3300053124 Bacteria 4474
410 Ga0500642_0018256 3300053130 Bacteria 2709
411 Ga0500652_000085 3300053131 Bacteria 39352
412 Ga0500568_0055179 3300053139 Bacteria 1551
413 Ga0500574_000787 3300053141 Bacteria 4265
414 Ga0500577_0023599 3300053142 Bacteria 2057
415 Ga0500604_0014150 3300053151 Bacteria 2170
416 Ga0500619_005672 3300053154 Bacteria 2808
417 Ga0500622_0000019 3300053156 Bacteria 275028
418 Ga0500622_0000534 3300053156 Bacteria 35246
419 Ga0500622_0003635 3300053156 Bacteria 10140
420 Ga0500645_003311 3300053730 Bacteria 6628
421 Ga0466962_0001461 3300061719 Bacteria 11036
422 2857577537 2857576091 Bacteria 5465855
423 2523108136 2522572158 Bacteria 6514390
424 2587729896 2585428057 Bacteria 6737412
425 2587733490 2585428058 Bacteria 6853932
426 2587735057 2585428058 Bacteria 6853932
427 2587756785 2585428062 Bacteria 6842168
428 2588294466 2588253510 Bacteria 6901809
429 2597031444 2596583598 Bacteria 5251611
430 2599445210 2599185178 Bacteria 5365746
431 2599501661 2599185188 Bacteria 6164180
432 2599931417 2599185300 Bacteria 6062622
433 2599944340 2599185302 Bacteria 5954930
434 2599954812 2599185304 Bacteria 5951361
435 2599984260 2599185309 Bacteria 5969593
436 2599991468 2599185310 Bacteria 6014457
437 2600001152 2599185312 Bacteria 5912071
438 2600048941 2599185320 Bacteria 5963263
439 2603867194 2602042109 Bacteria 5152801
440 2643936425 2643221585 Bacteria 5812563
441 2643968866 2643221592 Bacteria 6608788
442 2644139829 2643221625 Bacteria 6512927
443 2644222708 2643221639 Bacteria 6649903
444 2644249063 2643221644 Bacteria 6865017
445 2644260635 2643221646 Bacteria 6433402
446 2644273781 2643221648 Bacteria 6521465
447 2644317070 2643221656 Bacteria 5809961
448 2644337466 2643221660 Bacteria 4208257
449 2644337556 2643221660 Bacteria 4208257
450 2739056476 2738541337 Bacteria 6183410
451 2739250935 2738543013 Bacteria 5618633
452 2819545289 2818991436 Bacteria 5376622
453 2842815893 2842815866 Bacteria 5947510
454 2857568681 2857564685 Bacteria 6290584
455 2857580463 2857576091 Bacteria 5465855
456 2885270341 2885266251 Bacteria 4796748
457 2888368611 2888366609 Bacteria 5155009
458 2900580488 2900577576 Bacteria 5438534
459 2919130908 2919130084 Bacteria 5301837
460 2928063781 2928058823 Bacteria 5520022
461 2928117772 2928115317 Bacteria 6477646
462 2929196139 2929195423 Bacteria 5325372
463 8015395446 8015394850 Bacteria 5064660
464 JGI24741J21665_1000448
465 JGI24740J21852_10000149
466 JGI24740J21852_10000159
467 JGI25162J39368_1000025
468 JGI25162J39368_1000263
469 JGI25152J39213_1004332
470 JGI25165J46597_1000054
471 JGI25153J46596_10000006
472 JGI25153J46596_10004907
473 rootH1_10015820
474 rootL2_10045667
475 rootL2_10166950
476 rootL2_10212651
477 Ga0055538_1000026
478 Ga0055538_1002449
479 Ga0055538_1004594
480 Ga0055539_1000033
481 Ga0055539_1000086
482 Ga0055533_1000044
483 Ga0055533_1000694
484 Ga0055533_1004738
485 Ga0055532_1000041
486 Ga0055525_1000052
487 Ga0055525_1000537
488 Ga0055535_1000030
489 Ga0055542_1000628
490 Ga0055529_1000058
491 Ga0055526_1000475
492 Ga0055534_1000581
493 Ga0055531_10000007
494 Ga0055541_1000069
495 Ga0055541_1001179
496 Ga0055541_1009313
497 Ga0065165_1000863
498 Ga0070676_10079234
499 Ga0070683_100040450
500 Ga0070683_100042386
501 Ga0070683_100049742
502 Ga0070670_100010447
503 Ga0070677_10002086
504 Ga0068869_100000109
505 Ga0070666_10043113
506 Ga0070666_10079575
507 Ga0070682_100010460
508 Ga0070682_100075994
509 Ga0068868_100000895
510 Ga0068868_100035945
511 Ga0070660_100005137
512 Ga0070660_100108469
513 Ga0070661_100000072
514 Ga0070661_100011993
515 Ga0070661_100065151
516 Ga0070661_100103835
517 Ga0070668_100029724
518 Ga0070668_100088128
519 Ga0070669_100017130
520 Ga0070669_100022290
521 Ga0070675_100000621
522 Ga0070675_100010564
523 Ga0070671_100044570
524 Ga0070671_100062233
525 Ga0070674_100113799
526 Ga0070673_100023166
527 Ga0070688_100039243
528 Ga0070659_100017393
529 Ga0070659_100295927
530 Ga0070667_100004338
531 Ga0070663_100000015
532 Ga0070663_100003719
533 Ga0070662_100001965
534 Ga0068867_100001189
535 Ga0070685_10020898
536 Ga0070679_100009359
537 Ga0070684_100055993
538 Ga0070684_100070918
539 Ga0068853_100006482
540 Ga0070672_100000163
541 Ga0070672_100008125
542 Ga0070672_100105021
543 Ga0070693_100070363
544 Ga0070693_100079681
545 Ga0070665_100034040
546 Ga0070664_100000058
547 Ga0070664_100012851
548 Ga0070664_100014025
549 Ga0068857_100029891
550 Ga0068857_100103925
551 Ga0068854_100000025
552 Ga0068854_100020625
553 Ga0068856_100000084
554 Ga0068856_100029175
555 Ga0068856_100166708
556 Ga0068856_100206696
557 Ga0068852_100003094
558 Ga0068852_100016740
559 Ga0068852_100053997
560 Ga0068852_100063852
561 Ga0068852_100160114
562 Ga0068859_100010952
563 Ga0068859_100049787
564 Ga0068864_100004021
565 Ga0068864_100020937
566 Ga0068861_100000126
567 Ga0068863_100012220
568 Ga0068863_100023051
569 Ga0068858_100010727
570 Ga0068858_100150840
571 Ga0068860_100076801
572 Ga0075366_10004679
573 Ga0097621_100004823
574 Ga0075370_10006053
575 Ga0075370_10091239
576 Ga0068871_100017048
577 Ga0068871_100029265
578 Ga0068871_100112782
579 Ga0075430_100204068
580 Ga0068865_100206653
581 Ga0097620_100010952
582 Ga0097620_100049787
583 Ga0105240_10218069
584 Ga0105240_10309461
585 Ga0105245_10004379
586 Ga0105245_10023026
587 Ga0105248_10446105
588 Ga0105237_10191789
589 Ga0105238_10013310
590 Ga0105239_10110940
591 Ga0157373_10061038
592 Ga0157373_10163496
593 Ga0157371_10000100
594 Ga0157370_10000004
595 Ga0157369_10000809
596 Ga0157369_10173407
597 Ga0157372_10000279
598 Ga0157372_10009183
599 Ga0157372_10025361
600 Ga0157375_10005134
601 Ga0157375_10013596
602 Ga0157375_10017755
603 Ga0157375_10022735
604 Ga0157375_10373457
605 Ga0182008_10000421
606 Ga0182008_10063458
607 Ga0157377_10001137
608 Ga0157379_10005980
609 Ga0157379_10010227
610 Ga0157379_10018220
611 Ga0157376_10006475
612 Ga0157376_10006935
613 Ga0182006_1005758
614 Ga0182006_1017978
615 Ga0182006_1021250
616 Ga0182007_10001289
617 Ga0182007_10009797
618 Ga0182007_10016887
619 Ga0182007_10025805
620 Ga0182005_1000995
621 Ga0183362_10001
622 Ga0163161_10032865
623 Ga0209760_101443
624 Ga0209784_100020
625 Ga0209784_100029
626 Ga0209784_100508
627 Ga0209566_100020
628 Ga0209566_100030
629 Ga0209566_100277
630 Ga0209674_100035
631 Ga0209674_100081
632 Ga0209674_100089
633 Ga0209674_100123
634 Ga0209674_100289
635 Ga0209672_100247
636 Ga0209147_100008
637 Ga0209563_100038
638 Ga0209563_100091
639 Ga0209563_100092
640 Ga0209563_101162
641 Ga0209437_100066
642 Ga0209258_100013
643 Ga0207425_1012551
644 Ga0209646_1000065
645 Ga0209677_100030
646 Ga0209677_100031
647 Ga0209677_102538
648 Ga0209148_1000113
649 Ga0209148_1004805
650 Ga0209759_1000492
651 Ga0209129_1000038
652 Ga0209233_1000060
653 Ga0209455_1000106
654 Ga0209673_1001320
655 Ga0209673_1020829
656 Ga0209675_1006002
657 Ga0209676_1006611
658 Ga0209564_1000129
659 Ga0209758_1000001
660 Ga0209758_1000089
661 Ga0209758_1000600
662 Ga0209050_1002913
663 Ga0209050_1014738
664 Ga0209051_1003740
665 Ga0209257_1000021
666 Ga0209257_1006298
667 Ga0209257_1021236
668 Ga0207697_10008487
669 Ga0207682_10003347
670 Ga0207688_10042533
671 Ga0207680_10118030
672 Ga0207643_10024010
673 Ga0207695_10000535
674 Ga0207671_10194597
675 Ga0207662_10099781
676 Ga0207657_10008286
677 Ga0207657_10023461
678 Ga0207649_10000222
679 Ga0207649_10007761
680 Ga0207649_10010503
681 Ga0207652_10110087
682 Ga0207681_10011548
683 Ga0207681_10075133
684 Ga0207694_10015923
685 Ga0207650_10000887
686 Ga0207659_10003612
687 Ga0207687_10011547
688 Ga0207644_10003968
689 Ga0207644_10036294
690 Ga0207644_10043077
691 Ga0207690_10003347
692 Ga0207690_10006695
693 Ga0207706_10000736
694 Ga0207709_10035457
695 Ga0207669_10018827
696 Ga0207691_10005598
697 Ga0207711_10002545
698 Ga0207689_10000259
699 Ga0207661_10042324
700 Ga0207679_10000038
701 Ga0207679_10027441
702 Ga0207651_10004962
703 Ga0207668_10030926
704 Ga0207640_10000096
705 Ga0207640_10016404
706 Ga0207658_10031397
707 Ga0207677_10004015
708 Ga0207677_10026152
709 Ga0207703_10009860
710 Ga0207703_10016236
711 Ga0207703_10109441
712 Ga0207639_10024668
713 Ga0207678_10000021
714 Ga0207678_10007496
715 Ga0207702_10000203
716 Ga0207702_10023380
717 Ga0207702_10069259
718 Ga0207641_10021159
719 Ga0207641_10030693
720 Ga0207641_10062488
721 Ga0207648_10196449
722 Ga0207676_10008910
723 Ga0207676_10011244
724 Ga0207674_10030619
725 Ga0207674_10057191
726 Ga0207675_100000307
727 Ga0207698_10010835
728 Ga0207698_10015293
729 Ga0268264_10030553
730 Ga0268264_10123725
731 Ga0307515_10016569
732 Ga0307515_10073001
733 Ga0307515_10244857
734 Ga0265327_10031965
735 Ga0265316_10007164
736 Ga0307513_10200053
737 Ga0307408_100000040
738 Ga0316579_10000226
739 Ga0316576_10016405
740 Ga0307413_10000647
741 Ga0307414_10033857
742 Ga0307414_10133648
743 Ga0316583_10035536
744 Ga0316585_10039642
745 Ga0316580_10000277
746 Ga0316588_1000768
747 Ga0316587_1002934
748 Ga0316596_1004783
749 Ga0373956_0022375
750 Ga0316574_0000171
751 Ga0373931_0049829
752 Ga0373933_0106271
753 Ga0373937_0001785
754 Ga0316584_0166153
755 Ga0395900_0032985
756 Ga0395900_0103357
757 Ga0395905_0021202
758 Ga0439439_0018848
759 Ga0439466_0018269
760 Ga0439465_0001136
761 Ga0439465_0001491
762 Ga0439442_005508
763 Ga0439432_000543
764 Ga0439449_0000317
765 Ga0439452_020629
766 Ga0439457_004029
767 Ga0450911_001703
768 Ga0450923_008456
769 Ga0450891_002786
770 Ga0450898_012884
771 Ga0439446_0000499
772 Ga0439434_0003962
773 Ga0439464_0007301
774 Ga0451577_0072726
775 Ga0451577_0211148
776 Ga0466986_0024952
777 Ga0466969_0077342
778 Ga0466969_0114025
779 Ga0466978_0028381
780 Ga0453683_0246639
781 Ga0466965_0020032
782 Ga0466966_0050390
783 Ga0466961_0000404
784 Ga0466964_0018176
785 Ga0453684_0000826
786 Ga0453684_0007549
787 Ga0453684_0067601
788 Ga0466968_0013647
789 Ga0466970_0002930
790 Ga0466959_0045822
791 Ga0451576_0021302
792 Ga0451576_0097165
793 Ga0451576_0134877
794 Ga0451576_0159505
795 Ga0451576_0218268
796 Ga0451576_0531546
797 Ga0466967_0216722
798 Ga0495617_001271
799 Ga0495603_0083705
800 Ga0495638_0036279
801 Ga0495651_0010259
802 Ga0495651_0027368
803 Ga0495653_0020739
804 Ga0495607_0000007
805 Ga0495607_0000023
806 Ga0495628_0010495
807 Ga0495628_0015237
808 Ga0495628_0088328
809 Ga0495632_0001338
810 Ga0495632_0007969
811 Ga0495643_0000007
812 Ga0495652_0019178
813 Ga0495654_0003758
814 Ga0495645_0067075
815 Ga0495634_0195265
816 Ga0495599_0018022
817 Ga0495623_0015624
818 Ga0495646_0024693
819 Ga0495600_0008801
820 Ga0495604_0031506
821 Ga0495676_0256266
822 Ga0495687_000242
823 Ga0495687_019385
824 Ga0495602_0024377
825 Ga0495615_0023418
826 Ga0495626_0029796
827 Ga0496101_0008217
828 Ga0496102_0000706
829 Ga0496106_0011434
830 Ga0496106_0203166
831 Ga0496108_0031370
832 Ga0496109_0024773
833 Ga0496109_0035237
834 Ga0496110_0005584
835 Ga0496110_0018404
836 Ga0496111_0031950
837 Ga0496112_0003117
838 Ga0496113_0056357
839 Ga0496113_0288157
840 Ga0496114_0001178
841 Ga0496114_0009654
842 Ga0496118_0072342
843 Ga0496121_0019293
844 Ga0496124_0014401
845 Ga0496125_0005647
846 Ga0496125_0008735
847 Ga0501294_001662
848 Ga0501300_001892
849 Ga0501032_0072071
850 Ga0501033_0000035
851 Ga0501034_0270585
852 Ga0501211_002300
853 Ga0501235_001717
854 Ga0501221_000078
855 Ga0501267_000061
856 Ga0501035_0000388
857 Ga0501035_0265227
858 Ga0501044_0157826
859 nmdc:mga0k408_111685_c1
860 nmdc:mga0k408_2643_c1
861 nmdc:mga07m45_56611_c1
862 nmdc:mga07m45_587_c2
863 nmdc:mga07m45_6580_c1
864 nmdc:mga0a205_329004_c1
865 Ga0495601_0031288
866 Ga0495601_0054607
867 Ga0500578_0000622
868 Ga0500644_0028828
869 Ga0500646_0007026
870 Ga0500595_003252
871 Ga0500607_019200
872 Ga0500617_007001
873 Ga0500642_0018256
874 Ga0500652_000085
875 Ga0500568_0055179
876 Ga0500574_000787
877 Ga0500577_0023599
878 Ga0500604_0014150
879 Ga0500619_005672
880 Ga0500622_0000019
881 Ga0500622_0000534
882 Ga0500622_0003635
883 Ga0500645_003311
884 Ga0466962_0001461
885 2857577537
886 2523108136
887 2587729896
888 2587733490
889 2587735057
890 2587756785
891 2588294466
892 2597031444
893 2599445210
894 2599501661
895 2599931417
896 2599944340
897 2599954812
898 2599984260
899 2599991468
900 2600001152
901 2600048941
902 2603867194
903 2643936425
904 2643968866
905 2644139829
906 2644222708
907 2644249063
908 2644260635
909 2644273781
910 2644317070
911 2644337466
912 2644337556
913 2739056476
914 2739250935
915 2819545289
916 2842815893
917 2857568681
918 2857580463
919 2885270341
920 2888368611
921 2900580488
922 2919130908
923 2928063781
924 2928117772
925 2929196139
926 8015395446

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13437

HlyD_3

HlyD family secretion protein

188

290

0.92

PF13533

Biotin_lipoyl_2

Biotin-lipoyl like

78

126

0.9

PF16576

HlyD_D23

Barrel-sandwich domain of CusB or HlyD membrane-fusion

61

293

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qsh-assembly1.cif.gz_B crystal structure of l. monocytogenes pyruvate carboxylase in complex with cyclic-di-amp 0.8934 62 180
4qsh-assembly1.cif.gz_D crystal structure of l. monocytogenes pyruvate carboxylase in complex with cyclic-di-amp 0.8932 62 180
4qsh-assembly1.cif.gz_C crystal structure of l. monocytogenes pyruvate carboxylase in complex with cyclic-di-amp 0.893 62 180
4qsh-assembly1.cif.gz_A crystal structure of l. monocytogenes pyruvate carboxylase in complex with cyclic-di-amp 0.8928 62 180
3hb9-assembly1.cif.gz_B crystal structure of s. aureus pyruvate carboxylase a610t mutant 0.8865 62 178
ID Description Score Start End Superfamily
4l8jA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9636 59 180 2.40.50.100
4tkoB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9432 59 180 2.40.50.100
4tkoB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9295 59 180 2.40.50.100
3lnnA01 Mainly Beta;Beta Barrel;conserved putative lor/sdh protein from methanococcus maripaludis s2 fold; 0.9237 261 318 2.40.420.20
3ne5C01 Mainly Beta;Beta Barrel;conserved putative lor/sdh protein from methanococcus maripaludis s2 fold; 0.9175 265 324 2.40.420.20
ID Description Score Start End GO Terms
AF-A0A519WVK6-F1-model_v4 Efflux RND transporter periplasmic adaptor subunit 0.9217 264 337 GO:0005886
GO:0046677
AF-A0A3B0WKP4-F1-model_v4 RND efflux system, membrane fusion protein 0.9044 264 337 GO:0005886
GO:0046677
AF-A0A1M5VF26-F1-model_v4 RND family efflux transporter, MFP subunit 0.8874 264 337 GO:0005886
GO:0015562
GO:1990281
AF-A0A4R0WYL8-F1-model_v4 Efflux transporter periplasmic adaptor subunit 0.8431 266 339 GO:0015562
GO:1990281
AF-A0A352AFL2-F1-model_v4 Efflux transporter periplasmic adaptor subunit 0.772 9 336 GO:0005886
GO:0015562
GO:1990281

Map