F449231

General Info

Members Datasets Scaffolds Average Seq Length
464 208 928 213

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10350846|rootH1_103508462
Length 252
Sequence MMWLILQQQWKRLRRHLINITHTQPAADRCLRLFLYFYFMQLTLSNLLPVYFEKSRTQTSEVWGKEIVWSKGELIKIVAPSGSGKSSLINFLYGMRKDFDGAIRYDQQDIRSMNPEELAPLRKDHVSIVFQDLRLFPHQTVAQNLEIKRQLNPFHPPEKIREMAERLGIGKKLDSLAKTCSYGEQQRVAIIRALLQPFDFLLLDEPFSHLDDKNSQKAMQLLLEEAKARKASIVLADLERIEFFPFTRLFHL

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
143 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
144 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
145 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
146 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
149 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
152 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
153 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
174 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
175 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
176 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
177 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
187 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
188 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
189 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
190 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
191 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
192 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
193 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
194 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
195 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
196 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
197 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
198 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
199 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
200 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
201 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
202 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
203 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
204 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
205 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
206 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
207 2738541278 Niastella sp. CF465 Isolate Unclassified
208 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.25
Nodule 0
Rhizoplane 0.65
Rhizosphere 89.44
Stem 0
Stem Tuber 0
Unclassified 10.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10350846 3300003323 Unclassified 2183
2 MBSR1b_contig_6007198 2162886012 Bacteria 1984
3 JGI24751J29686_10012806 3300002459 Bacteria 1730
4 rootH1_10012412 3300003316 Bacteria 3354
5 rootL2_10039238 3300003322 Bacteria 3834
6 rootL2_10146807 3300003322 Bacteria 3768
7 rootL2_10239549 3300003322 Bacteria 2236
8 rootL2_10296123 3300003322 Bacteria 2787
9 Ga0065704_10325490 3300005289 Bacteria 846
10 Ga0065712_10002035 3300005290 Bacteria 7674
11 Ga0065712_10091984 3300005290 Unclassified 2349
12 Ga0065715_10120593 3300005293 Bacteria 2253
13 Ga0065707_10105744 3300005295 Bacteria 2630
14 Ga0070658_10047764 3300005327 Bacteria 3464
15 Ga0070658_10117057 3300005327 Bacteria 2212
16 Ga0070658_10283817 3300005327 Bacteria 1410
17 Ga0070658_10321181 3300005327 Bacteria 1322
18 Ga0070658_10404711 3300005327 Bacteria 1172
19 Ga0070676_10009100 3300005328 Bacteria 5372
20 Ga0070676_10116321 3300005328 Bacteria 1672
21 Ga0070676_10243136 3300005328 Bacteria 1198
22 Ga0070683_100038547 3300005329 Bacteria 4382
23 Ga0070683_100371302 3300005329 Bacteria 1363
24 Ga0070670_100033169 3300005331 Bacteria 4447
25 Ga0070670_100081364 3300005331 Bacteria 2783
26 Ga0070670_100107336 3300005331 Bacteria 2406
27 Ga0068869_100178374 3300005334 Unclassified 1664
28 Ga0068869_100232589 3300005334 Unclassified 1465
29 Ga0068869_100548794 3300005334 Unclassified 971
30 Ga0070666_10317291 3300005335 Unclassified 1111
31 Ga0070680_100015274 3300005336 Bacteria 6017
32 Ga0070680_100015545 3300005336 Bacteria 5971
33 Ga0070680_100190593 3300005336 Bacteria 1727
34 Ga0070682_100000129 3300005337 Bacteria 64098
35 Ga0070682_100032757 3300005337 Bacteria 3154
36 Ga0068868_100039366 3300005338 Bacteria 3674
37 Ga0070660_100163885 3300005339 Bacteria 1792
38 Ga0070660_100206575 3300005339 Bacteria 1594
39 Ga0070660_100310132 3300005339 Bacteria 1295
40 Ga0070660_100653898 3300005339 Bacteria 880
41 Ga0070689_100005567 3300005340 Bacteria 8617
42 Ga0070687_100063531 3300005343 Bacteria 1958
43 Ga0070661_100074935 3300005344 Bacteria 2493
44 Ga0070661_100170747 3300005344 Bacteria 1651
45 Ga0070661_100453804 3300005344 Bacteria 1020
46 Ga0070668_100066397 3300005347 Bacteria 2800
47 Ga0070669_100016849 3300005353 Bacteria 5216
48 Ga0070669_100274071 3300005353 Unclassified 1350
49 Ga0070675_100024186 3300005354 Bacteria 4864
50 Ga0070671_100015509 3300005355 Bacteria 6157
51 Ga0070671_100237110 3300005355 Unclassified 1548
52 Ga0070674_100137258 3300005356 Bacteria 1831
53 Ga0070673_100021075 3300005364 Bacteria 4715
54 Ga0070673_100047904 3300005364 Bacteria 3329
55 Ga0070673_100095942 3300005364 Bacteria 2433
56 Ga0070659_100006512 3300005366 Bacteria 8431
57 Ga0070659_100035879 3300005366 Bacteria 3863
58 Ga0070659_100062722 3300005366 Bacteria 2939
59 Ga0070667_100376112 3300005367 Bacteria 1290
60 Ga0070700_100146323 3300005441 Bacteria 1611
61 Ga0070663_100082531 3300005455 Bacteria 2365
62 Ga0070662_100019373 3300005457 Bacteria 4618
63 Ga0070662_100755129 3300005457 Bacteria 825
64 Ga0070681_10008908 3300005458 Bacteria 9864
65 Ga0070681_10031787 3300005458 Bacteria 5298
66 Ga0070681_10045938 3300005458 Bacteria 4367
67 Ga0070681_10049877 3300005458 Bacteria 4178
68 Ga0070681_10429654 3300005458 Bacteria 1233
69 Ga0070681_10874090 3300005458 Unclassified 817
70 Ga0068867_100002592 3300005459 Bacteria 12743
71 Ga0068867_100082089 3300005459 Bacteria 2431
72 Ga0070698_100041774 3300005471 Bacteria 4708
73 Ga0070679_100007785 3300005530 Bacteria 10038
74 Ga0070679_100045358 3300005530 Bacteria 4380
75 Ga0070679_100070601 3300005530 Bacteria 3484
76 Ga0070679_100078498 3300005530 Bacteria 3290
77 Ga0070679_100210234 3300005530 Bacteria 1910
78 Ga0070679_100447513 3300005530 Bacteria 1236
79 Ga0070679_100489848 3300005530 Bacteria 1173
80 Ga0070684_100026284 3300005535 Bacteria 4903
81 Ga0070684_100102828 3300005535 Bacteria 2555
82 Ga0068853_100067352 3300005539 Bacteria 3111
83 Ga0068853_100089550 3300005539 Bacteria 2703
84 Ga0068853_100137607 3300005539 Unclassified 2190
85 Ga0068853_100184660 3300005539 Bacteria 1892
86 Ga0068853_100368271 3300005539 Bacteria 1340
87 Ga0070672_100061423 3300005543 Bacteria 2962
88 Ga0070672_100196500 3300005543 Bacteria 1685
89 Ga0070672_100367610 3300005543 Unclassified 1228
90 Ga0070686_100019076 3300005544 Bacteria 4036
91 Ga0070665_100400560 3300005548 Bacteria 1380
92 Ga0070665_100678655 3300005548 Bacteria 1043
93 Ga0068855_100000736 3300005563 Bacteria 40224
94 Ga0068855_100034533 3300005563 Bacteria 6029
95 Ga0068855_100044043 3300005563 Bacteria 5283
96 Ga0068855_100097458 3300005563 Bacteria 3387
97 Ga0068855_100530254 3300005563 Bacteria 1277
98 Ga0070664_100003960 3300005564 Bacteria 11923
99 Ga0070664_100058701 3300005564 Bacteria 3273
100 Ga0068857_100009057 3300005577 Bacteria 8635
101 Ga0068857_100010071 3300005577 Bacteria 8214
102 Ga0068857_100114141 3300005577 Unclassified 2429
103 Ga0068854_100053084 3300005578 Bacteria 2909
104 Ga0068854_100109041 3300005578 Bacteria 2086
105 Ga0068854_100137264 3300005578 Bacteria 1873
106 Ga0068854_100376261 3300005578 Bacteria 1169
107 Ga0068854_100680334 3300005578 Bacteria 886
108 Ga0068856_100085471 3300005614 Unclassified 3134
109 Ga0068856_100323678 3300005614 Bacteria 1559
110 Ga0068856_100459072 3300005614 Unclassified 1295
111 Ga0070702_100026377 3300005615 Bacteria 3122
112 Ga0070702_100137105 3300005615 Bacteria 1554
113 Ga0068852_100005485 3300005616 Bacteria 9080
114 Ga0068852_100101578 3300005616 Bacteria 2597
115 Ga0068852_100168158 3300005616 Bacteria 2053
116 Ga0068852_100204528 3300005616 Bacteria 1870
117 Ga0068852_101210918 3300005616 Bacteria 776
118 Ga0068859_100068756 3300005617 Bacteria 3576
119 Ga0068859_100192861 3300005617 Bacteria 2122
120 Ga0068859_100746071 3300005617 Bacteria 1068
121 Ga0068859_100926066 3300005617 Bacteria 955
122 Ga0068864_100010104 3300005618 Bacteria 7793
123 Ga0068864_100167932 3300005618 Unclassified 1999
124 Ga0068864_100411482 3300005618 Bacteria 1287
125 Ga0068866_10290918 3300005718 Bacteria 1016
126 Ga0068861_100001269 3300005719 Bacteria 15760
127 Ga0068861_100726836 3300005719 Bacteria 925
128 Ga0068860_100047439 3300005843 Bacteria 4094
129 Ga0068860_100079057 3300005843 Bacteria 3127
130 Ga0068860_100202843 3300005843 Bacteria 1922
131 Ga0068862_100020230 3300005844 Bacteria 5559
132 Ga0070712_100658254 3300006175 Bacteria 890
133 Ga0097621_100022761 3300006237 Bacteria 4868
134 Ga0097621_100167329 3300006237 Bacteria 1893
135 Ga0068871_100004156 3300006358 Bacteria 10021
136 Ga0075428_100634405 3300006844 Bacteria 1140
137 Ga0068865_100191591 3300006881 Bacteria 1582
138 Ga0097620_100068756 3300006931 Bacteria 3576
139 Ga0097620_100192854 3300006931 Bacteria 2122
140 Ga0097620_100746033 3300006931 Bacteria 1068
141 Ga0097620_100926013 3300006931 Bacteria 955
142 Ga0105240_10158505 3300009093 Bacteria 2690
143 Ga0105240_10298056 3300009093 Bacteria 1845
144 Ga0105240_10300429 3300009093 Unclassified 1837
145 Ga0114129_10000608 3300009147 Bacteria 44314
146 Ga0105241_10286548 3300009174 Bacteria 1409
147 Ga0105241_10715737 3300009174 Bacteria 915
148 Ga0105242_10403594 3300009176 Bacteria 1276
149 Ga0105237_10080822 3300009545 Bacteria 3241
150 Ga0105249_10031030 3300009553 Bacteria 4832
151 Ga0105249_10126626 3300009553 Bacteria 2433
152 Ga0105249_10849917 3300009553 Unclassified 978
153 Ga0105239_10009401 3300010375 Bacteria 11024
154 Ga0105239_10142986 3300010375 Bacteria 2667
155 Ga0105246_10557808 3300011119 Bacteria 983
156 Ga0157373_10000489 3300013100 Bacteria 31312
157 Ga0157373_10041004 3300013100 Bacteria 3312
158 Ga0157373_10088185 3300013100 Bacteria 2186
159 Ga0157373_10090576 3300013100 Bacteria 2154
160 Ga0157373_10148260 3300013100 Bacteria 1650
161 Ga0157373_10262767 3300013100 Unclassified 1221
162 Ga0157371_10000168 3300013102 Bacteria 95185
163 Ga0157371_10000265 3300013102 Bacteria 71188
164 Ga0157371_10001473 3300013102 Bacteria 24412
165 Ga0157371_10003791 3300013102 Bacteria 13534
166 Ga0157371_10007021 3300013102 Bacteria 9163
167 Ga0157371_10008108 3300013102 Bacteria 8393
168 Ga0157371_10008695 3300013102 Bacteria 8063
169 Ga0157371_10031549 3300013102 Bacteria 3817
170 Ga0157371_10037038 3300013102 Bacteria 3493
171 Ga0157371_10071079 3300013102 Bacteria 2464
172 Ga0157371_10101707 3300013102 Bacteria 2039
173 Ga0157371_10329828 3300013102 Bacteria 1108
174 Ga0157370_10000631 3300013104 Bacteria 43919
175 Ga0157370_10000817 3300013104 Bacteria 39404
176 Ga0157370_10009410 3300013104 Bacteria 10443
177 Ga0157370_10313085 3300013104 Unclassified 1448
178 Ga0157370_10436857 3300013104 Bacteria 1204
179 Ga0157370_10530411 3300013104 Bacteria 1080
180 Ga0157370_10694349 3300013104 Bacteria 929
181 Ga0157369_10022127 3300013105 Bacteria 7102
182 Ga0157369_10036698 3300013105 Bacteria 5369
183 Ga0157369_10090995 3300013105 Bacteria 3257
184 Ga0157369_10129375 3300013105 Bacteria 2676
185 Ga0157369_10602777 3300013105 Bacteria 1134
186 Ga0157369_10894212 3300013105 Unclassified 911
187 Ga0157374_10140535 3300013296 Bacteria 2344
188 Ga0157374_10168643 3300013296 Bacteria 2135
189 Ga0157374_10357934 3300013296 Bacteria 1451
190 Ga0157374_11434608 3300013296 Bacteria 713
191 Ga0157374_11458281 3300013296 Unclassified 707
192 Ga0157378_10011915 3300013297 Bacteria 7615
193 Ga0157378_10118711 3300013297 Bacteria 2435
194 Ga0157378_10268355 3300013297 Bacteria 1640
195 Ga0157378_10404861 3300013297 Bacteria 1345
196 Ga0163162_10007197 3300013306 Bacteria 10808
197 Ga0163162_10099785 3300013306 Bacteria 2994
198 Ga0163162_10228200 3300013306 Bacteria 1992
199 Ga0163162_10483156 3300013306 Bacteria 1370
200 Ga0163162_10771405 3300013306 Bacteria 1080
201 Ga0157372_10005686 3300013307 Bacteria 13267
202 Ga0157372_10010761 3300013307 Bacteria 9738
203 Ga0157372_10063686 3300013307 Bacteria 4135
204 Ga0157372_10065661 3300013307 Bacteria 4075
205 Ga0157372_10071946 3300013307 Bacteria 3896
206 Ga0157372_10099300 3300013307 Bacteria 3321
207 Ga0157372_10109742 3300013307 Bacteria 3160
208 Ga0157372_10136040 3300013307 Bacteria 2830
209 Ga0157372_10151597 3300013307 Bacteria 2676
210 Ga0157372_10215720 3300013307 Bacteria 2224
211 Ga0157372_10336621 3300013307 Bacteria 1758
212 Ga0157372_10530507 3300013307 Bacteria 1372
213 Ga0157372_10798637 3300013307 Bacteria 1096
214 Ga0157372_10844357 3300013307 Bacteria 1063
215 Ga0157372_11601132 3300013307 Bacteria 750
216 Ga0157375_10031962 3300013308 Bacteria 4986
217 Ga0157375_10052741 3300013308 Bacteria 3999
218 Ga0163163_10008242 3300014325 Bacteria 9249
219 Ga0163163_10083642 3300014325 Unclassified 3197
220 Ga0163163_10717955 3300014325 Unclassified 1063
221 Ga0157380_10002159 3300014326 Bacteria 13202
222 Ga0157380_10008243 3300014326 Bacteria 7425
223 Ga0157380_10131112 3300014326 Bacteria 2139
224 Ga0157380_11504641 3300014326 Bacteria 726
225 Ga0157377_10002829 3300014745 Bacteria 7747
226 Ga0157376_10051780 3300014969 Bacteria 3411
227 Ga0157376_10876980 3300014969 Unclassified 914
228 Ga0163161_10145004 3300017792 Bacteria 1800
229 Ga0163161_10590611 3300017792 Bacteria 914
230 Ga0213876_10035792 3300021384 Bacteria 2618
231 Ga0209646_1001048 3300025246 Bacteria 8338
232 Ga0207642_10339714 3300025899 Bacteria 882
233 Ga0207688_10011452 3300025901 Unclassified 4829
234 Ga0207647_10000061 3300025904 Bacteria 83985
235 Ga0207643_10010426 3300025908 Bacteria 5006
236 Ga0207705_10004097 3300025909 Bacteria 11055
237 Ga0207705_10014789 3300025909 Bacteria 5611
238 Ga0207705_10021830 3300025909 Bacteria 4567
239 Ga0207705_10123108 3300025909 Bacteria 1926
240 Ga0207707_10050951 3300025912 Bacteria 3605
241 Ga0207707_10142291 3300025912 Bacteria 2097
242 Ga0207707_10220099 3300025912 Bacteria 1653
243 Ga0207707_10295538 3300025912 Bacteria 1401
244 Ga0207707_10583224 3300025912 Bacteria 948
245 Ga0207695_10069366 3300025913 Bacteria 3607
246 Ga0207695_10115323 3300025913 Bacteria 2661
247 Ga0207671_10298951 3300025914 Bacteria 1271
248 Ga0207660_10002770 3300025917 Bacteria 11495
249 Ga0207660_10066138 3300025917 Bacteria 2614
250 Ga0207660_10068978 3300025917 Bacteria 2566
251 Ga0207660_10271293 3300025917 Bacteria 1344
252 Ga0207660_10318160 3300025917 Bacteria 1242
253 Ga0207662_10176646 3300025918 Bacteria 1372
254 Ga0207657_10032457 3300025919 Unclassified 4717
255 Ga0207657_10091687 3300025919 Bacteria 2533
256 Ga0207657_10203000 3300025919 Bacteria 1594
257 Ga0207649_10040243 3300025920 Bacteria 2840
258 Ga0207649_10098632 3300025920 Bacteria 1929
259 Ga0207652_10000181 3300025921 Bacteria 66711
260 Ga0207652_10004555 3300025921 Bacteria 11245
261 Ga0207652_10016313 3300025921 Bacteria 6062
262 Ga0207652_10031819 3300025921 Bacteria 4431
263 Ga0207681_10022253 3300025923 Bacteria 4041
264 Ga0207681_10700345 3300025923 Unclassified 842
265 Ga0207650_10001776 3300025925 Bacteria 15251
266 Ga0207650_10093364 3300025925 Bacteria 2303
267 Ga0207650_10124126 3300025925 Bacteria 2014
268 Ga0207650_10494851 3300025925 Unclassified 1021
269 Ga0207659_10163262 3300025926 Bacteria 1751
270 Ga0207659_10219339 3300025926 Bacteria 1528
271 Ga0207644_10006583 3300025931 Bacteria 7569
272 Ga0207644_10100592 3300025931 Bacteria 2171
273 Ga0207690_10009440 3300025932 Bacteria 5793
274 Ga0207690_10038908 3300025932 Bacteria 3099
275 Ga0207690_10062431 3300025932 Bacteria 2536
276 Ga0207690_10469651 3300025932 Bacteria 1014
277 Ga0207670_10588980 3300025936 Bacteria 912
278 Ga0207669_10389329 3300025937 Unclassified 1088
279 Ga0207704_10060372 3300025938 Viruses 2346
280 Ga0207691_10002742 3300025940 Bacteria 17179
281 Ga0207691_10158423 3300025940 Bacteria 1987
282 Ga0207691_10181652 3300025940 Unclassified 1838
283 Ga0207689_10145683 3300025942 Unclassified 1951
284 Ga0207689_10240584 3300025942 Unclassified 1496
285 Ga0207689_10254085 3300025942 Unclassified 1454
286 Ga0207661_10016920 3300025944 Bacteria 5385
287 Ga0207661_10078740 3300025944 Bacteria 2715
288 Ga0207661_10240549 3300025944 Bacteria 1606
289 Ga0207661_10769921 3300025944 Bacteria 886
290 Ga0207679_10006298 3300025945 Bacteria 7491
291 Ga0207679_10147574 3300025945 Bacteria 1910
292 Ga0207679_10998404 3300025945 Bacteria 767
293 Ga0207667_10000150 3300025949 Bacteria 104244
294 Ga0207667_10007978 3300025949 Bacteria 12628
295 Ga0207667_10249085 3300025949 Bacteria 1817
296 Ga0207651_10022178 3300025960 Bacteria 3876
297 Ga0207712_10002097 3300025961 Bacteria 13065
298 Ga0207712_10058323 3300025961 Bacteria 2727
299 Ga0207712_10721722 3300025961 Bacteria 871
300 Ga0207668_10012698 3300025972 Bacteria 5165
301 Ga0207640_10078279 3300025981 Bacteria 2250
302 Ga0207640_10107331 3300025981 Bacteria 1971
303 Ga0207658_10319756 3300025986 Bacteria 1343
304 Ga0207703_10191522 3300026035 Bacteria 1811
305 Ga0207639_10018352 3300026041 Bacteria 4971
306 Ga0207639_10046600 3300026041 Bacteria 3272
307 Ga0207639_10098355 3300026041 Unclassified 2358
308 Ga0207639_10119469 3300026041 Bacteria 2163
309 Ga0207639_10206915 3300026041 Bacteria 1687
310 Ga0207678_10026745 3300026067 Bacteria 5033
311 Ga0207702_10060777 3300026078 Unclassified 3221
312 Ga0207648_10004167 3300026089 Bacteria 14951
313 Ga0207648_10031283 3300026089 Bacteria 4705
314 Ga0207648_10098965 3300026089 Bacteria 2554
315 Ga0207676_10067242 3300026095 Bacteria 2862
316 Ga0207674_10006765 3300026116 Bacteria 13455
317 Ga0207674_10015094 3300026116 Bacteria 8501
318 Ga0207674_10038017 3300026116 Bacteria 5001
319 Ga0207674_10055493 3300026116 Bacteria 4027
320 Ga0207674_10543453 3300026116 Unclassified 1122
321 Ga0207675_100007946 3300026118 Bacteria 10005
322 Ga0207675_100081190 3300026118 Bacteria 3040
323 Ga0207683_10436915 3300026121 Bacteria 1206
324 Ga0207698_10004632 3300026142 Bacteria 8400
325 Ga0207698_10027864 3300026142 Bacteria 4018
326 Ga0207698_10399572 3300026142 Bacteria 1313
327 Ga0209969_1017827 3300027360 Bacteria 1047
328 Ga0209971_1089491 3300027682 Bacteria 751
329 Ga0268265_10087233 3300028380 Bacteria 2482
330 Ga0268265_10153107 3300028380 Bacteria 1947
331 Ga0268264_10039334 3300028381 Bacteria 3907
332 Ga0268264_10064595 3300028381 Bacteria 3081
333 Ga0268264_10297361 3300028381 Bacteria 1518
334 Ga0268264_10896454 3300028381 Bacteria 890
335 Ga0265334_10086833 3300028573 Bacteria 1146
336 Ga0307515_10000001 3300028794 Bacteria 4259510
337 Ga0265327_10000421 3300031251 Bacteria 77515
338 Ga0265327_10118388 3300031251 Unclassified 1258
339 Ga0307513_10232620 3300031456 Bacteria 1655
340 Ga0307513_10379765 3300031456 Bacteria 1153
341 Ga0307410_10222795 3300031852 Bacteria 1452
342 Ga0395899_0040600 3300037312 Bacteria 3480
343 Ga0395899_0043770 3300037312 Bacteria 3337
344 Ga0395899_0122063 3300037312 Bacteria 1865
345 Ga0395899_0134766 3300037312 Bacteria 1761
346 Ga0395899_0235972 3300037312 Bacteria 1261
347 Ga0395899_0273450 3300037312 Bacteria 1151
348 Ga0395900_0009605 3300037418 Bacteria 9919
349 Ga0395900_0010029 3300037418 Bacteria 9692
350 Ga0395900_0030065 3300037418 Bacteria 5575
351 Ga0395900_0040936 3300037418 Bacteria 4776
352 Ga0395900_0046864 3300037418 Bacteria 4451
353 Ga0395900_0053276 3300037418 Bacteria 4163
354 Ga0395900_0113470 3300037418 Bacteria 2781
355 Ga0395900_0360171 3300037418 Bacteria 1426
356 Ga0395900_0491809 3300037418 Bacteria 1178
357 Ga0395898_0010171 3300037466 Bacteria 9847
358 Ga0395898_0019600 3300037466 Bacteria 6881
359 Ga0395898_0083321 3300037466 Bacteria 3082
360 Ga0395898_0135761 3300037466 Bacteria 2355
361 Ga0395898_0492531 3300037466 Bacteria 1166
362 Ga0395905_0063940 3300037471 Bacteria 3443
363 Ga0395905_0088545 3300037471 Unclassified 2902
364 Ga0395905_0225474 3300037471 Bacteria 1753
365 Ga0395905_0401449 3300037471 Bacteria 1266
366 Ga0395901_0012588 3300038443 Bacteria 8585
367 Ga0395901_0019153 3300038443 Bacteria 6997
368 Ga0395901_0028717 3300038443 Bacteria 5723
369 Ga0395901_0051900 3300038443 Bacteria 4263
370 Ga0395901_0184914 3300038443 Bacteria 2185
371 Ga0395901_0224637 3300038443 Bacteria 1962
372 Ga0436365_0956608 3300039437 Archaea 1142
373 Ga0436365_1917912 3300039437 Bacteria 29135
374 Ga0439439_0050301 3300041406 Bacteria 1092
375 Ga0451793_0742970 3300041452 Unclassified 1017
376 Ga0451798_0639731 3300041458 Bacteria 1165
377 Ga0451802_1069707 3300041460 Bacteria 1449
378 Ga0451851_0614910 3300041507 Bacteria 1023
379 Ga0451853_2488349 3300041512 Bacteria 1399
380 Ga0439449_0070504 3300042007 Bacteria 1288
381 Ga0439457_000110 3300042014 Bacteria 19601
382 Ga0451577_0156309 3300042876 Bacteria 2053
383 Ga0466969_0000382 3300044656 Bacteria 24366
384 Ga0466972_0000143 3300044658 Bacteria 58694
385 Ga0466972_0028363 3300044658 Bacteria 2762
386 Ga0466965_0272732 3300044683 Bacteria 912
387 Ga0466966_0000176 3300044684 Bacteria 42093
388 Ga0466961_0248987 3300044693 Unclassified 1091
389 Ga0466964_0004429 3300044706 Bacteria 5187
390 Ga0466957_0006988 3300044842 Bacteria 6380
391 Ga0466957_0007527 3300044842 Bacteria 6152
392 Ga0466959_0000016 3300045049 Bacteria 144600
393 Ga0451576_0395027 3300045051 Bacteria 1450
394 Ga0495632_0173095 3300046519 Bacteria 991
395 Ga0495668_0000106 3300046616 Bacteria 133476
396 Ga0495668_0002925 3300046616 Bacteria 13474
397 Ga0495611_0173693 3300046648 Bacteria 1007
398 Ga0495686_0036411 3300047472 Unclassified 3158
399 Ga0495686_0145588 3300047472 Bacteria 1395
400 Ga0495686_0225461 3300047472 Unclassified 1064
401 Ga0501032_0000901 3300049569 Bacteria 24084
402 Ga0501034_0028017 3300049571 Bacteria 5729
403 Ga0501034_0032243 3300049571 Bacteria 5322
404 Ga0501034_0080799 3300049571 Bacteria 3254
405 Ga0501034_0130014 3300049571 Bacteria 2502
406 Ga0501034_0520137 3300049571 Bacteria 1102
407 Ga0501039_0739551 3300049575 Unclassified 768
408 Ga0501043_0060865 3300049579 Bacteria 2964
409 Ga0501046_0039478 3300049580 Bacteria 3779
410 Ga0501046_0134780 3300049580 Bacteria 1871
411 Ga0501047_0057928 3300049581 Bacteria 3744
412 Ga0501047_0153566 3300049581 Bacteria 2176
413 Ga0501070_0120212 3300049586 Bacteria 2171
414 Ga0501073_0019454 3300049589 Bacteria 4902
415 Ga0501074_0016531 3300049590 Bacteria 5356
416 Ga0501074_0052391 3300049590 Bacteria 2946
417 Ga0501074_0583713 3300049590 Bacteria 791
418 Ga0501250_003270 3300049680 Bacteria 1539
419 Ga0501251_004502 3300049681 Bacteria 1441
420 Ga0501257_001414 3300049686 Bacteria 4959
421 Ga0501259_005860 3300049688 Bacteria 1948
422 Ga0501225_0014887 3300049705 Bacteria 2170
423 Ga0501080_0025243 3300049742 Bacteria 5515
424 Ga0501080_0098637 3300049742 Bacteria 2711
425 Ga0501083_0037877 3300049744 Bacteria 3281
426 Ga0501267_009352 3300049764 Bacteria 977
427 Ga0501035_0004426 3300049822 Bacteria 13337
428 Ga0501035_0042493 3300049822 Bacteria 4100
429 Ga0501044_0123252 3300049823 Bacteria 2591
430 Ga0501044_0126113 3300049823 Bacteria 2557
431 Ga0501044_0157678 3300049823 Bacteria 2248
432 nmdc:mga0k408_13902_c1 3300050493 Bacteria 4122
433 nmdc:mga0k408_299103_c1 3300050493 Bacteria 960
434 nmdc:mga0k408_33301_c1 3300050493 Bacteria 2947
435 nmdc:mga0k408_44600_c1 3300050493 Bacteria 2557
436 nmdc:mga05p37_3495_c2 3300050507 Bacteria 11743
437 nmdc:mga08y16_357658_c1 3300050511 Unclassified 1499
438 Ga0500578_0000296 3300053086 Bacteria 61614
439 Ga0500578_0013800 3300053086 Bacteria 5202
440 Ga0500646_0008723 3300053090 Bacteria 2598
441 Ga0500583_0000037 3300053092 Bacteria 92466
442 Ga0500583_0002476 3300053092 Bacteria 5556
443 Ga0500651_0196817 3300053093 Unclassified 1191
444 Ga0500641_0143765 3300053096 Bacteria 1030
445 Ga0500650_0041886 3300053098 Bacteria 2115
446 Ga0500553_077115 3300053101 Bacteria 1513
447 Ga0500562_000038 3300053108 Bacteria 72186
448 Ga0500572_025408 3300053111 Bacteria 1606
449 Ga0500594_0061184 3300053118 Bacteria 1086
450 Ga0500628_029819 3300053129 Bacteria 1175
451 Ga0500652_031882 3300053131 Unclassified 2071
452 Ga0500559_0030594 3300053136 Bacteria 2309
453 Ga0500568_0000863 3300053139 Bacteria 21288
454 Ga0500603_022915 3300053150 Bacteria 1551
455 Ga0500604_0005598 3300053151 Bacteria 3314
456 Ga0500622_0005258 3300053156 Bacteria 7811
457 Ga0500622_0181303 3300053156 Bacteria 973
458 Ga0500636_0039362 3300053177 Bacteria 2796
459 Ga0500611_000010 3300053727 Bacteria 165151
460 Ga0500611_067952 3300053727 Bacteria 861
461 Ga0500645_020114 3300053730 Bacteria 2071
462 Ga0500661_008535 3300055283 Unclassified 1885
463 2738726094 2738541278 Bacteria 9755573
464 2929159852 2929154850 Bacteria 6753285
465 rootH1_10350846
466 MBSR1b_contig_6007198
467 JGI24751J29686_10012806
468 rootH1_10012412
469 rootL2_10039238
470 rootL2_10146807
471 rootL2_10239549
472 rootL2_10296123
473 Ga0065704_10325490
474 Ga0065712_10002035
475 Ga0065712_10091984
476 Ga0065715_10120593
477 Ga0065707_10105744
478 Ga0070658_10047764
479 Ga0070658_10117057
480 Ga0070658_10283817
481 Ga0070658_10321181
482 Ga0070658_10404711
483 Ga0070676_10009100
484 Ga0070676_10116321
485 Ga0070676_10243136
486 Ga0070683_100038547
487 Ga0070683_100371302
488 Ga0070670_100033169
489 Ga0070670_100081364
490 Ga0070670_100107336
491 Ga0068869_100178374
492 Ga0068869_100232589
493 Ga0068869_100548794
494 Ga0070666_10317291
495 Ga0070680_100015274
496 Ga0070680_100015545
497 Ga0070680_100190593
498 Ga0070682_100000129
499 Ga0070682_100032757
500 Ga0068868_100039366
501 Ga0070660_100163885
502 Ga0070660_100206575
503 Ga0070660_100310132
504 Ga0070660_100653898
505 Ga0070689_100005567
506 Ga0070687_100063531
507 Ga0070661_100074935
508 Ga0070661_100170747
509 Ga0070661_100453804
510 Ga0070668_100066397
511 Ga0070669_100016849
512 Ga0070669_100274071
513 Ga0070675_100024186
514 Ga0070671_100015509
515 Ga0070671_100237110
516 Ga0070674_100137258
517 Ga0070673_100021075
518 Ga0070673_100047904
519 Ga0070673_100095942
520 Ga0070659_100006512
521 Ga0070659_100035879
522 Ga0070659_100062722
523 Ga0070667_100376112
524 Ga0070700_100146323
525 Ga0070663_100082531
526 Ga0070662_100019373
527 Ga0070662_100755129
528 Ga0070681_10008908
529 Ga0070681_10031787
530 Ga0070681_10045938
531 Ga0070681_10049877
532 Ga0070681_10429654
533 Ga0070681_10874090
534 Ga0068867_100002592
535 Ga0068867_100082089
536 Ga0070698_100041774
537 Ga0070679_100007785
538 Ga0070679_100045358
539 Ga0070679_100070601
540 Ga0070679_100078498
541 Ga0070679_100210234
542 Ga0070679_100447513
543 Ga0070679_100489848
544 Ga0070684_100026284
545 Ga0070684_100102828
546 Ga0068853_100067352
547 Ga0068853_100089550
548 Ga0068853_100137607
549 Ga0068853_100184660
550 Ga0068853_100368271
551 Ga0070672_100061423
552 Ga0070672_100196500
553 Ga0070672_100367610
554 Ga0070686_100019076
555 Ga0070665_100400560
556 Ga0070665_100678655
557 Ga0068855_100000736
558 Ga0068855_100034533
559 Ga0068855_100044043
560 Ga0068855_100097458
561 Ga0068855_100530254
562 Ga0070664_100003960
563 Ga0070664_100058701
564 Ga0068857_100009057
565 Ga0068857_100010071
566 Ga0068857_100114141
567 Ga0068854_100053084
568 Ga0068854_100109041
569 Ga0068854_100137264
570 Ga0068854_100376261
571 Ga0068854_100680334
572 Ga0068856_100085471
573 Ga0068856_100323678
574 Ga0068856_100459072
575 Ga0070702_100026377
576 Ga0070702_100137105
577 Ga0068852_100005485
578 Ga0068852_100101578
579 Ga0068852_100168158
580 Ga0068852_100204528
581 Ga0068852_101210918
582 Ga0068859_100068756
583 Ga0068859_100192861
584 Ga0068859_100746071
585 Ga0068859_100926066
586 Ga0068864_100010104
587 Ga0068864_100167932
588 Ga0068864_100411482
589 Ga0068866_10290918
590 Ga0068861_100001269
591 Ga0068861_100726836
592 Ga0068860_100047439
593 Ga0068860_100079057
594 Ga0068860_100202843
595 Ga0068862_100020230
596 Ga0070712_100658254
597 Ga0097621_100022761
598 Ga0097621_100167329
599 Ga0068871_100004156
600 Ga0075428_100634405
601 Ga0068865_100191591
602 Ga0097620_100068756
603 Ga0097620_100192854
604 Ga0097620_100746033
605 Ga0097620_100926013
606 Ga0105240_10158505
607 Ga0105240_10298056
608 Ga0105240_10300429
609 Ga0114129_10000608
610 Ga0105241_10286548
611 Ga0105241_10715737
612 Ga0105242_10403594
613 Ga0105237_10080822
614 Ga0105249_10031030
615 Ga0105249_10126626
616 Ga0105249_10849917
617 Ga0105239_10009401
618 Ga0105239_10142986
619 Ga0105246_10557808
620 Ga0157373_10000489
621 Ga0157373_10041004
622 Ga0157373_10088185
623 Ga0157373_10090576
624 Ga0157373_10148260
625 Ga0157373_10262767
626 Ga0157371_10000168
627 Ga0157371_10000265
628 Ga0157371_10001473
629 Ga0157371_10003791
630 Ga0157371_10007021
631 Ga0157371_10008108
632 Ga0157371_10008695
633 Ga0157371_10031549
634 Ga0157371_10037038
635 Ga0157371_10071079
636 Ga0157371_10101707
637 Ga0157371_10329828
638 Ga0157370_10000631
639 Ga0157370_10000817
640 Ga0157370_10009410
641 Ga0157370_10313085
642 Ga0157370_10436857
643 Ga0157370_10530411
644 Ga0157370_10694349
645 Ga0157369_10022127
646 Ga0157369_10036698
647 Ga0157369_10090995
648 Ga0157369_10129375
649 Ga0157369_10602777
650 Ga0157369_10894212
651 Ga0157374_10140535
652 Ga0157374_10168643
653 Ga0157374_10357934
654 Ga0157374_11434608
655 Ga0157374_11458281
656 Ga0157378_10011915
657 Ga0157378_10118711
658 Ga0157378_10268355
659 Ga0157378_10404861
660 Ga0163162_10007197
661 Ga0163162_10099785
662 Ga0163162_10228200
663 Ga0163162_10483156
664 Ga0163162_10771405
665 Ga0157372_10005686
666 Ga0157372_10010761
667 Ga0157372_10063686
668 Ga0157372_10065661
669 Ga0157372_10071946
670 Ga0157372_10099300
671 Ga0157372_10109742
672 Ga0157372_10136040
673 Ga0157372_10151597
674 Ga0157372_10215720
675 Ga0157372_10336621
676 Ga0157372_10530507
677 Ga0157372_10798637
678 Ga0157372_10844357
679 Ga0157372_11601132
680 Ga0157375_10031962
681 Ga0157375_10052741
682 Ga0163163_10008242
683 Ga0163163_10083642
684 Ga0163163_10717955
685 Ga0157380_10002159
686 Ga0157380_10008243
687 Ga0157380_10131112
688 Ga0157380_11504641
689 Ga0157377_10002829
690 Ga0157376_10051780
691 Ga0157376_10876980
692 Ga0163161_10145004
693 Ga0163161_10590611
694 Ga0213876_10035792
695 Ga0209646_1001048
696 Ga0207642_10339714
697 Ga0207688_10011452
698 Ga0207647_10000061
699 Ga0207643_10010426
700 Ga0207705_10004097
701 Ga0207705_10014789
702 Ga0207705_10021830
703 Ga0207705_10123108
704 Ga0207707_10050951
705 Ga0207707_10142291
706 Ga0207707_10220099
707 Ga0207707_10295538
708 Ga0207707_10583224
709 Ga0207695_10069366
710 Ga0207695_10115323
711 Ga0207671_10298951
712 Ga0207660_10002770
713 Ga0207660_10066138
714 Ga0207660_10068978
715 Ga0207660_10271293
716 Ga0207660_10318160
717 Ga0207662_10176646
718 Ga0207657_10032457
719 Ga0207657_10091687
720 Ga0207657_10203000
721 Ga0207649_10040243
722 Ga0207649_10098632
723 Ga0207652_10000181
724 Ga0207652_10004555
725 Ga0207652_10016313
726 Ga0207652_10031819
727 Ga0207681_10022253
728 Ga0207681_10700345
729 Ga0207650_10001776
730 Ga0207650_10093364
731 Ga0207650_10124126
732 Ga0207650_10494851
733 Ga0207659_10163262
734 Ga0207659_10219339
735 Ga0207644_10006583
736 Ga0207644_10100592
737 Ga0207690_10009440
738 Ga0207690_10038908
739 Ga0207690_10062431
740 Ga0207690_10469651
741 Ga0207670_10588980
742 Ga0207669_10389329
743 Ga0207704_10060372
744 Ga0207691_10002742
745 Ga0207691_10158423
746 Ga0207691_10181652
747 Ga0207689_10145683
748 Ga0207689_10240584
749 Ga0207689_10254085
750 Ga0207661_10016920
751 Ga0207661_10078740
752 Ga0207661_10240549
753 Ga0207661_10769921
754 Ga0207679_10006298
755 Ga0207679_10147574
756 Ga0207679_10998404
757 Ga0207667_10000150
758 Ga0207667_10007978
759 Ga0207667_10249085
760 Ga0207651_10022178
761 Ga0207712_10002097
762 Ga0207712_10058323
763 Ga0207712_10721722
764 Ga0207668_10012698
765 Ga0207640_10078279
766 Ga0207640_10107331
767 Ga0207658_10319756
768 Ga0207703_10191522
769 Ga0207639_10018352
770 Ga0207639_10046600
771 Ga0207639_10098355
772 Ga0207639_10119469
773 Ga0207639_10206915
774 Ga0207678_10026745
775 Ga0207702_10060777
776 Ga0207648_10004167
777 Ga0207648_10031283
778 Ga0207648_10098965
779 Ga0207676_10067242
780 Ga0207674_10006765
781 Ga0207674_10015094
782 Ga0207674_10038017
783 Ga0207674_10055493
784 Ga0207674_10543453
785 Ga0207675_100007946
786 Ga0207675_100081190
787 Ga0207683_10436915
788 Ga0207698_10004632
789 Ga0207698_10027864
790 Ga0207698_10399572
791 Ga0209969_1017827
792 Ga0209971_1089491
793 Ga0268265_10087233
794 Ga0268265_10153107
795 Ga0268264_10039334
796 Ga0268264_10064595
797 Ga0268264_10297361
798 Ga0268264_10896454
799 Ga0265334_10086833
800 Ga0307515_10000001
801 Ga0265327_10000421
802 Ga0265327_10118388
803 Ga0307513_10232620
804 Ga0307513_10379765
805 Ga0307410_10222795
806 Ga0395899_0040600
807 Ga0395899_0043770
808 Ga0395899_0122063
809 Ga0395899_0134766
810 Ga0395899_0235972
811 Ga0395899_0273450
812 Ga0395900_0009605
813 Ga0395900_0010029
814 Ga0395900_0030065
815 Ga0395900_0040936
816 Ga0395900_0046864
817 Ga0395900_0053276
818 Ga0395900_0113470
819 Ga0395900_0360171
820 Ga0395900_0491809
821 Ga0395898_0010171
822 Ga0395898_0019600
823 Ga0395898_0083321
824 Ga0395898_0135761
825 Ga0395898_0492531
826 Ga0395905_0063940
827 Ga0395905_0088545
828 Ga0395905_0225474
829 Ga0395905_0401449
830 Ga0395901_0012588
831 Ga0395901_0019153
832 Ga0395901_0028717
833 Ga0395901_0051900
834 Ga0395901_0184914
835 Ga0395901_0224637
836 Ga0436365_0956608
837 Ga0436365_1917912
838 Ga0439439_0050301
839 Ga0451793_0742970
840 Ga0451798_0639731
841 Ga0451802_1069707
842 Ga0451851_0614910
843 Ga0451853_2488349
844 Ga0439449_0070504
845 Ga0439457_000110
846 Ga0451577_0156309
847 Ga0466969_0000382
848 Ga0466972_0000143
849 Ga0466972_0028363
850 Ga0466965_0272732
851 Ga0466966_0000176
852 Ga0466961_0248987
853 Ga0466964_0004429
854 Ga0466957_0006988
855 Ga0466957_0007527
856 Ga0466959_0000016
857 Ga0451576_0395027
858 Ga0495632_0173095
859 Ga0495668_0000106
860 Ga0495668_0002925
861 Ga0495611_0173693
862 Ga0495686_0036411
863 Ga0495686_0145588
864 Ga0495686_0225461
865 Ga0501032_0000901
866 Ga0501034_0028017
867 Ga0501034_0032243
868 Ga0501034_0080799
869 Ga0501034_0130014
870 Ga0501034_0520137
871 Ga0501039_0739551
872 Ga0501043_0060865
873 Ga0501046_0039478
874 Ga0501046_0134780
875 Ga0501047_0057928
876 Ga0501047_0153566
877 Ga0501070_0120212
878 Ga0501073_0019454
879 Ga0501074_0016531
880 Ga0501074_0052391
881 Ga0501074_0583713
882 Ga0501250_003270
883 Ga0501251_004502
884 Ga0501257_001414
885 Ga0501259_005860
886 Ga0501225_0014887
887 Ga0501080_0025243
888 Ga0501080_0098637
889 Ga0501083_0037877
890 Ga0501267_009352
891 Ga0501035_0004426
892 Ga0501035_0042493
893 Ga0501044_0123252
894 Ga0501044_0126113
895 Ga0501044_0157678
896 nmdc:mga0k408_13902_c1
897 nmdc:mga0k408_299103_c1
898 nmdc:mga0k408_33301_c1
899 nmdc:mga0k408_44600_c1
900 nmdc:mga05p37_3495_c2
901 nmdc:mga08y16_357658_c1
902 Ga0500578_0000296
903 Ga0500578_0013800
904 Ga0500646_0008723
905 Ga0500583_0000037
906 Ga0500583_0002476
907 Ga0500651_0196817
908 Ga0500641_0143765
909 Ga0500650_0041886
910 Ga0500553_077115
911 Ga0500562_000038
912 Ga0500572_025408
913 Ga0500594_0061184
914 Ga0500628_029819
915 Ga0500652_031882
916 Ga0500559_0030594
917 Ga0500568_0000863
918 Ga0500603_022915
919 Ga0500604_0005598
920 Ga0500622_0005258
921 Ga0500622_0181303
922 Ga0500636_0039362
923 Ga0500611_000010
924 Ga0500611_067952
925 Ga0500645_020114
926 Ga0500661_008535
927 2738726094
928 2929159852

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

66

208

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xgz-assembly3.cif.gz_E crystal structure of e. coli mlafb abc transport subunits in the monomeric state 0.8755 3 198
6xgz-assembly2.cif.gz_C crystal structure of e. coli mlafb abc transport subunits in the monomeric state 0.8729 3 198
7cag-assembly1.cif.gz_D mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state 0.8681 1 198
7ch0-assembly1.cif.gz_E the overall structure of the mlafedb complex in atp-bound eqclose conformation (mutation of e170q on mlaf) 0.8636 3 198
1sgw-assembly1.cif.gz_A putative abc transporter (atp-binding protein) from pyrococcus furiosus pfu-867808-001 0.8625 1 213
ID Description Score Start End Superfamily
af_A0A1D6JKA3_4_149_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8724 140 200 3.40.50.300
af_Q4CKA0_1_130_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8721 128 198 3.40.50.300
af_X2JG15_1642_1882_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8698 3 200 3.40.50.300
af_P77279_1_223_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8684 3 213 3.40.50.300
af_A1ZBS3_470_698_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8663 3 200 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1M3GSF1-F1-model_v4 deleted 0.992 1 213
AF-A0A1M3GD69-F1-model_v4 ABC transporter 0.9912 1 213 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A3D6CGL4-F1-model_v4 ABC transporter 0.9808 1 200 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A3B9C3S1-F1-model_v4 ABC transporter 0.9782 1 213 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-J0PAP7-F1-model_v4 ABC-type antimicrobial peptide transport system, ATPase component 0.9776 3 213 GO:0005524
GO:0005886
GO:0016887
GO:0022857

Map