F449236

General Info

Members Datasets Scaffolds Average Seq Length
464 261 464 131

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10007458|Ga0065715_100074582
Length 145
Sequence VAAHWILKTEPSTYSFDRLVEERKTVWDGVSNPVALRHLREMAVGDQVMIYHTGDVKAVVGLARITRAAYPDPKDPKLVVVELEAGNRLPRSVTLASIKADPAFADLALVRMGRLSVVPVKPEQWNRLMGMGQAETTGKGGAGKR

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
175 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
176 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
177 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
178 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
179 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
180 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
188 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
189 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
190 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
191 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
192 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
193 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
194 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
206 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
223 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
224 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
245 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
246 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.54
Rhizosphere 90.3
Stem 0
Stem Tuber 0
Unclassified 2.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_3548509 2162886012 Bacteria 853
2 Ga0065704_10475819 3300005289 Unclassified 685
3 Ga0065712_10518478 3300005290 Bacteria 637
4 Ga0065715_10007458 3300005293 Bacteria 3350
5 Ga0070683_100005070 3300005329 Bacteria 10940
6 Ga0070690_100007958 3300005330 Bacteria 6084
7 Ga0070690_100049831 3300005330 Bacteria 2671
8 Ga0068869_100040634 3300005334 Bacteria 3327
9 Ga0068869_100137455 3300005334 Unclassified 1884
10 Ga0068869_100822919 3300005334 Bacteria 799
11 Ga0070666_10130282 3300005335 Bacteria 1747
12 Ga0070666_10993763 3300005335 Bacteria 622
13 Ga0070680_100159592 3300005336 Bacteria 1894
14 Ga0070682_100087484 3300005337 Bacteria 2031
15 Ga0068868_100017386 3300005338 Bacteria 5358
16 Ga0068868_100536126 3300005338 Unclassified 1030
17 Ga0070660_100009078 3300005339 Bacteria 6980
18 Ga0070689_100156651 3300005340 Bacteria 1839
19 Ga0070689_100264814 3300005340 Bacteria 1421
20 Ga0070691_10553937 3300005341 Bacteria 672
21 Ga0070687_101318523 3300005343 Unclassified 537
22 Ga0070692_11274110 3300005345 Unclassified 526
23 Ga0070668_100003748 3300005347 Bacteria 11216
24 Ga0070675_100082833 3300005354 Bacteria 2677
25 Ga0070674_100106620 3300005356 Bacteria 2051
26 Ga0070673_100043255 3300005364 Bacteria 3479
27 Ga0070673_101388626 3300005364 Unclassified 661
28 Ga0070688_100083397 3300005365 Bacteria 2074
29 Ga0070659_100040955 3300005366 Bacteria 3620
30 Ga0070667_100018064 3300005367 Bacteria 5846
31 Ga0070667_100709094 3300005367 Unclassified 931
32 Ga0070709_10080740 3300005434 Bacteria 2121
33 Ga0070709_10508523 3300005434 Bacteria 916
34 Ga0070709_10715599 3300005434 Bacteria 780
35 Ga0070709_10726879 3300005434 Unclassified 774
36 Ga0070714_100906292 3300005435 Unclassified 856
37 Ga0070714_102422373 3300005435 Unclassified 510
38 Ga0070713_100027601 3300005436 Unclassified 4471
39 Ga0070713_100083755 3300005436 Bacteria 2727
40 Ga0070713_100132809 3300005436 Unclassified 2197
41 Ga0070713_100274139 3300005436 Unclassified 1546
42 Ga0070713_100897608 3300005436 Bacteria 852
43 Ga0070710_10008077 3300005437 Bacteria 5117
44 Ga0070710_10839347 3300005437 Bacteria 659
45 Ga0070701_10078229 3300005438 Bacteria 1784
46 Ga0070701_10240182 3300005438 Bacteria 1089
47 Ga0070711_100004286 3300005439 Bacteria 8396
48 Ga0070711_100023680 3300005439 Bacteria 3997
49 Ga0070705_100592989 3300005440 Bacteria 856
50 Ga0070700_100075818 3300005441 Bacteria 2158
51 Ga0070700_100108783 3300005441 Bacteria 1839
52 Ga0070708_100007809 3300005445 Bacteria 8573
53 Ga0070708_100009233 3300005445 Bacteria 7951
54 Ga0070708_100017595 3300005445 Bacteria 5967
55 Ga0070708_100044771 3300005445 Bacteria 3894
56 Ga0070708_100124402 3300005445 Bacteria 2382
57 Ga0070708_100269958 3300005445 Unclassified 1600
58 Ga0070708_100319889 3300005445 Unclassified 1461
59 Ga0070708_101092692 3300005445 Bacteria 747
60 Ga0070663_100020616 3300005455 Bacteria 4366
61 Ga0070663_100478969 3300005455 Unclassified 1030
62 Ga0070663_101069064 3300005455 Bacteria 704
63 Ga0070678_100928571 3300005456 Bacteria 797
64 Ga0070662_100001509 3300005457 Bacteria 14305
65 Ga0070681_10302371 3300005458 Unclassified 1509
66 Ga0070681_10354405 3300005458 Unclassified 1378
67 Ga0070681_10698045 3300005458 Bacteria 930
68 Ga0068867_100105707 3300005459 Bacteria 2155
69 Ga0068867_100404291 3300005459 Bacteria 1152
70 Ga0068867_102231991 3300005459 Bacteria 520
71 Ga0070706_100000454 3300005467 Bacteria 48917
72 Ga0070706_100006873 3300005467 Bacteria 10739
73 Ga0070707_100059118 3300005468 Bacteria 3677
74 Ga0070707_100105897 3300005468 Bacteria 2727
75 Ga0070707_100115369 3300005468 Bacteria 2606
76 Ga0070707_100140876 3300005468 Bacteria 2347
77 Ga0070707_100709016 3300005468 Bacteria 969
78 Ga0070707_100795052 3300005468 Unclassified 910
79 Ga0070698_100259533 3300005471 Bacteria 1670
80 Ga0070698_101616214 3300005471 Bacteria 600
81 Ga0070699_100006134 3300005518 Bacteria 10511
82 Ga0070699_100007475 3300005518 Bacteria 9508
83 Ga0070699_100083968 3300005518 Bacteria 2778
84 Ga0070699_100200958 3300005518 Bacteria 1772
85 Ga0070699_100367844 3300005518 Bacteria 1297
86 Ga0070699_100751607 3300005518 Bacteria 892
87 Ga0070699_100777234 3300005518 Bacteria 876
88 Ga0070679_100595804 3300005530 Bacteria 1048
89 Ga0070679_100821745 3300005530 Bacteria 872
90 Ga0070684_100009203 3300005535 Bacteria 7771
91 Ga0070697_100000411 3300005536 Bacteria 32999
92 Ga0070697_100005073 3300005536 Bacteria 10114
93 Ga0070697_100057250 3300005536 Bacteria 3172
94 Ga0070697_100309750 3300005536 Bacteria 1358
95 Ga0070697_100757696 3300005536 Unclassified 858
96 Ga0070697_101185299 3300005536 Unclassified 680
97 Ga0070697_101523692 3300005536 Bacteria 598
98 Ga0068853_100277159 3300005539 Bacteria 1545
99 Ga0070672_100243332 3300005543 Bacteria 1514
100 Ga0070672_100459146 3300005543 Bacteria 1098
101 Ga0070695_100072218 3300005545 Bacteria 2262
102 Ga0070696_100004251 3300005546 Bacteria 9551
103 Ga0070696_100181557 3300005546 Bacteria 1561
104 Ga0070696_100876306 3300005546 Bacteria 743
105 Ga0070696_101140570 3300005546 Bacteria 657
106 Ga0070693_100134586 3300005547 Bacteria 1549
107 Ga0070693_100178797 3300005547 Bacteria 1364
108 Ga0070665_100017004 3300005548 Bacteria 7292
109 Ga0070665_101495319 3300005548 Unclassified 684
110 Ga0070704_100033984 3300005549 Bacteria 3453
111 Ga0070704_100073589 3300005549 Bacteria 2490
112 Ga0070704_100106352 3300005549 Bacteria 2126
113 Ga0068855_100041603 3300005563 Bacteria 5446
114 Ga0070664_100056939 3300005564 Bacteria 3322
115 Ga0068857_100102462 3300005577 Bacteria 2569
116 Ga0068857_101963855 3300005577 Bacteria 573
117 Ga0068854_100014267 3300005578 Bacteria 5234
118 Ga0068856_100026690 3300005614 Bacteria 5632
119 Ga0068856_100604404 3300005614 Bacteria 1118
120 Ga0070702_100272995 3300005615 Bacteria 1157
121 Ga0068852_100129769 3300005616 Bacteria 2320
122 Ga0068859_100011364 3300005617 Bacteria 8956
123 Ga0068859_100084557 3300005617 Bacteria 3218
124 Ga0068864_100422891 3300005618 Bacteria 1270
125 Ga0068864_100994205 3300005618 Unclassified 832
126 Ga0068866_10603014 3300005718 Bacteria 742
127 Ga0068861_100054890 3300005719 Bacteria 3037
128 Ga0068861_100059717 3300005719 Bacteria 2921
129 Ga0068863_100054521 3300005841 Bacteria 3788
130 Ga0068863_100281249 3300005841 Bacteria 1612
131 Ga0068863_100647697 3300005841 Bacteria 1048
132 Ga0068858_100373633 3300005842 Bacteria 1367
133 Ga0068858_101117953 3300005842 Unclassified 774
134 Ga0068858_101459258 3300005842 Bacteria 674
135 Ga0068860_100063221 3300005843 Bacteria 3516
136 Ga0068860_102081067 3300005843 Bacteria 589
137 Ga0068862_100232424 3300005844 Bacteria 1673
138 Ga0068862_100399578 3300005844 Unclassified 1285
139 Ga0070717_10239912 3300006028 Bacteria 1598
140 Ga0070717_10555080 3300006028 Bacteria 1040
141 Ga0070717_10724845 3300006028 Unclassified 904
142 Ga0070716_100044660 3300006173 Bacteria 2483
143 Ga0070716_100167228 3300006173 Bacteria 1431
144 Ga0070716_100181324 3300006173 Bacteria 1383
145 Ga0070712_100001686 3300006175 Bacteria 13529
146 Ga0070712_100220227 3300006175 Bacteria 1502
147 Ga0097621_100082090 3300006237 Bacteria 2683
148 Ga0097621_100869534 3300006237 Unclassified 838
149 Ga0097621_101019060 3300006237 Unclassified 775
150 Ga0097621_101226238 3300006237 Bacteria 707
151 Ga0068871_100179388 3300006358 Bacteria 1819
152 Ga0075428_100026434 3300006844 Bacteria 6425
153 Ga0075428_100951607 3300006844 Bacteria 910
154 Ga0075431_100380418 3300006847 Bacteria 1416
155 Ga0075434_100055819 3300006871 Bacteria 3925
156 Ga0075434_100154569 3300006871 Bacteria 2314
157 Ga0075429_100189356 3300006880 Bacteria 1803
158 Ga0068865_100046769 3300006881 Bacteria 2970
159 Ga0068865_100094578 3300006881 Unclassified 2175
160 Ga0075436_100466943 3300006914 Bacteria 920
161 Ga0097620_100011364 3300006931 Bacteria 8956
162 Ga0097620_100084559 3300006931 Bacteria 3218
163 Ga0075435_100122551 3300007076 Unclassified 2170
164 Ga0075435_100772403 3300007076 Unclassified 836
165 Ga0099794_10008233 3300007265 Bacteria 4322
166 Ga0099794_10040515 3300007265 Unclassified 2215
167 Ga0099794_10220933 3300007265 Bacteria 973
168 Ga0099795_10577642 3300007788 Unclassified 533
169 Ga0105250_10128447 3300009092 Unclassified 1045
170 Ga0105250_10254663 3300009092 Bacteria 751
171 Ga0105240_10140971 3300009093 Bacteria 2882
172 Ga0105240_10833669 3300009093 Unclassified 997
173 Ga0105245_10012140 3300009098 Bacteria 7491
174 Ga0105245_10063191 3300009098 Bacteria 3342
175 Ga0105245_10283813 3300009098 Bacteria 1619
176 Ga0105245_10374714 3300009098 Unclassified 1416
177 Ga0105245_10945390 3300009098 Bacteria 905
178 Ga0105247_10380979 3300009101 Bacteria 1000
179 Ga0114129_10000442 3300009147 Bacteria 49250
180 Ga0114129_10377255 3300009147 Bacteria 1874
181 Ga0105243_10086729 3300009148 Bacteria 2568
182 Ga0105241_10058399 3300009174 Unclassified 2963
183 Ga0105241_10240394 3300009174 Bacteria 1530
184 Ga0105241_10384601 3300009174 Bacteria 1227
185 Ga0105242_10201194 3300009176 Bacteria 1769
186 Ga0105242_10336936 3300009176 Bacteria 1389
187 Ga0105242_10628194 3300009176 Bacteria 1041
188 Ga0105248_10028183 3300009177 Bacteria 6255
189 Ga0105248_10665801 3300009177 Bacteria 1174
190 Ga0105237_10206672 3300009545 Bacteria 1964
191 Ga0105237_10338639 3300009545 Unclassified 1509
192 Ga0105237_11094461 3300009545 Bacteria 804
193 Ga0105238_10223771 3300009551 Bacteria 1858
194 Ga0105249_10040299 3300009553 Bacteria 4242
195 Ga0105249_10229354 3300009553 Unclassified 1831
196 Ga0105249_10291377 3300009553 Bacteria 1634
197 Ga0105249_13300263 3300009553 Unclassified 519
198 Ga0099796_10067135 3300010159 Bacteria 1286
199 Ga0105239_10949900 3300010375 Bacteria 987
200 Ga0105239_11448205 3300010375 Bacteria 793
201 Ga0105246_10008469 3300011119 Bacteria 6321
202 Ga0157373_10101729 3300013100 Bacteria 2022
203 Ga0157373_10353229 3300013100 Bacteria 1049
204 Ga0157373_10994202 3300013100 Bacteria 626
205 Ga0157371_10039968 3300013102 Bacteria 3353
206 Ga0157370_10133796 3300013104 Bacteria 2312
207 Ga0157369_10215009 3300013105 Bacteria 2014
208 Ga0157374_10075302 3300013296 Bacteria 3190
209 Ga0157374_10114825 3300013296 Bacteria 2593
210 Ga0157374_10177626 3300013296 Bacteria 2078
211 Ga0157374_11140860 3300013296 Unclassified 800
212 Ga0157378_10079978 3300013297 Bacteria 2952
213 Ga0157378_10274533 3300013297 Bacteria 1623
214 Ga0157378_10889636 3300013297 Unclassified 921
215 Ga0157378_11084955 3300013297 Bacteria 837
216 Ga0163162_10008845 3300013306 Bacteria 9790
217 Ga0163162_10018082 3300013306 Bacteria 6899
218 Ga0163162_10093456 3300013306 Bacteria 3092
219 Ga0157372_10111008 3300013307 Unclassified 3141
220 Ga0157375_10153466 3300013308 Bacteria 2440
221 Ga0163163_10064627 3300014325 Bacteria 3630
222 Ga0163163_10122897 3300014325 Unclassified 2631
223 Ga0157380_10145448 3300014326 Bacteria 2042
224 Ga0157379_10070074 3300014968 Bacteria 3137
225 Ga0157379_10082683 3300014968 Unclassified 2877
226 Ga0157379_10557995 3300014968 Unclassified 1066
227 Ga0157379_12545188 3300014968 Unclassified 512
228 Ga0157376_10356146 3300014969 Unclassified 1402
229 Ga0206350_10288710 3300020080 Unclassified 573
230 Ga0213873_10100201 3300021358 Unclassified 832
231 Ga0213876_10152363 3300021384 Bacteria 1229
232 Ga0213875_10419104 3300021388 Bacteria 639
233 Ga0228598_1015242 3300024227 Unclassified 1518
234 Ga0207642_10012657 3300025899 Bacteria 3053
235 Ga0207680_10090245 3300025903 Bacteria 1947
236 Ga0207699_10363584 3300025906 Bacteria 1024
237 Ga0207684_10011901 3300025910 Bacteria 7584
238 Ga0207684_10023636 3300025910 Bacteria 5247
239 Ga0207684_10041049 3300025910 Bacteria 3925
240 Ga0207684_10177013 3300025910 Bacteria 1839
241 Ga0207654_10018592 3300025911 Bacteria 3650
242 Ga0207707_10132533 3300025912 Bacteria 2179
243 Ga0207695_10006799 3300025913 Bacteria 14742
244 Ga0207695_11692532 3300025913 Unclassified 513
245 Ga0207671_10983986 3300025914 Unclassified 665
246 Ga0207693_10000214 3300025915 Bacteria 53256
247 Ga0207693_10152351 3300025915 Bacteria 1819
248 Ga0207663_10003886 3300025916 Bacteria 7381
249 Ga0207663_11087073 3300025916 Bacteria 643
250 Ga0207663_11088136 3300025916 Unclassified 642
251 Ga0207663_11457340 3300025916 Unclassified 551
252 Ga0207660_10030728 3300025917 Bacteria 3693
253 Ga0207657_10045264 3300025919 Bacteria 3864
254 Ga0207649_10295847 3300025920 Bacteria 1182
255 Ga0207652_10200819 3300025921 Bacteria 1794
256 Ga0207652_10654686 3300025921 Bacteria 939
257 Ga0207646_10067330 3300025922 Bacteria 3197
258 Ga0207646_10095416 3300025922 Bacteria 2664
259 Ga0207646_10394606 3300025922 Bacteria 1250
260 Ga0207646_10922036 3300025922 Bacteria 774
261 Ga0207681_10463961 3300025923 Unclassified 1032
262 Ga0207694_10085099 3300025924 Bacteria 2488
263 Ga0207659_10044079 3300025926 Bacteria 3137
264 Ga0207687_10017487 3300025927 Bacteria 4722
265 Ga0207687_11093077 3300025927 Unclassified 685
266 Ga0207687_11428828 3300025927 Unclassified 594
267 Ga0207700_10215221 3300025928 Unclassified 1626
268 Ga0207700_10577465 3300025928 Bacteria 999
269 Ga0207664_10240436 3300025929 Unclassified 1577
270 Ga0207690_10105772 3300025932 Bacteria 2018
271 Ga0207706_10000868 3300025933 Bacteria 31136
272 Ga0207706_11023690 3300025933 Unclassified 693
273 Ga0207686_10197205 3300025934 Bacteria 1439
274 Ga0207709_10225282 3300025935 Bacteria 1355
275 Ga0207670_10042752 3300025936 Bacteria 2988
276 Ga0207670_10216397 3300025936 Unclassified 1464
277 Ga0207669_10285403 3300025937 Bacteria 1247
278 Ga0207704_10188724 3300025938 Bacteria 1497
279 Ga0207665_10062810 3300025939 Bacteria 2521
280 Ga0207665_10322899 3300025939 Bacteria 1159
281 Ga0207691_10017285 3300025940 Bacteria 6840
282 Ga0207691_10097660 3300025940 Bacteria 2625
283 Ga0207711_10022747 3300025941 Bacteria 5243
284 Ga0207711_10178725 3300025941 Unclassified 1929
285 Ga0207711_10943772 3300025941 Bacteria 801
286 Ga0207689_10087416 3300025942 Bacteria 2561
287 Ga0207689_10153481 3300025942 Unclassified 1898
288 Ga0207661_10034518 3300025944 Bacteria 3935
289 Ga0207679_10090319 3300025945 Bacteria 2367
290 Ga0207667_10168645 3300025949 Bacteria 2250
291 Ga0207651_11386734 3300025960 Unclassified 632
292 Ga0207712_10004079 3300025961 Bacteria 9214
293 Ga0207712_10552805 3300025961 Bacteria 990
294 Ga0207668_10131406 3300025972 Unclassified 1912
295 Ga0207658_10108859 3300025986 Bacteria 2186
296 Ga0207658_10337081 3300025986 Unclassified 1310
297 Ga0207677_10159329 3300026023 Bacteria 1751
298 Ga0207703_10439193 3300026035 Unclassified 1217
299 Ga0207703_10636425 3300026035 Bacteria 1011
300 Ga0207678_10002447 3300026067 Bacteria 16873
301 Ga0207678_10528856 3300026067 Unclassified 1030
302 Ga0207678_10961075 3300026067 Bacteria 756
303 Ga0207708_10070293 3300026075 Unclassified 2680
304 Ga0207702_10232634 3300026078 Bacteria 1723
305 Ga0207702_12002826 3300026078 Unclassified 570
306 Ga0207641_10016855 3300026088 Bacteria 5983
307 Ga0207648_10031250 3300026089 Bacteria 4708
308 Ga0207648_11222856 3300026089 Bacteria 706
309 Ga0207676_10084308 3300026095 Unclassified 2590
310 Ga0207676_10402935 3300026095 Bacteria 1279
311 Ga0207676_10903807 3300026095 Unclassified 866
312 Ga0207674_10065637 3300026116 Bacteria 3657
313 Ga0207675_100253732 3300026118 Bacteria 1703
314 Ga0207683_10266968 3300026121 Bacteria 1563
315 Ga0207698_10050520 3300026142 Bacteria 3172
316 Ga0207698_11317065 3300026142 Bacteria 737
317 Ga0209179_1036940 3300027512 Unclassified 1019
318 Ga0265356_1019011 3300028017 Unclassified 743
319 Ga0268266_10177638 3300028379 Bacteria 1936
320 Ga0268266_11290691 3300028379 Unclassified 705
321 Ga0268265_10712888 3300028380 Bacteria 970
322 Ga0268264_11593795 3300028381 Bacteria 663
323 Ga0268264_11679514 3300028381 Unclassified 646
324 Ga0265338_10017171 3300028800 Bacteria 7819
325 Ga0265338_10017868 3300028800 Bacteria 7620
326 Ga0265762_1000032 3300030760 Bacteria 15937
327 Ga0265760_10005055 3300031090 Unclassified 3775
328 Ga0265330_10238673 3300031235 Unclassified 766
329 Ga0265330_10517738 3300031235 Unclassified 508
330 Ga0265328_10036154 3300031239 Bacteria 1825
331 Ga0265328_10404892 3300031239 Unclassified 536
332 Ga0265325_10004545 3300031241 Bacteria 8744
333 Ga0265325_10011506 3300031241 Bacteria 5082
334 Ga0265325_10014940 3300031241 Bacteria 4377
335 Ga0265340_10002683 3300031247 Bacteria 10120
336 Ga0265340_10005877 3300031247 Bacteria 6787
337 Ga0265339_10266254 3300031249 Bacteria 825
338 Ga0265331_10025254 3300031250 Bacteria 3001
339 Ga0265327_10365412 3300031251 Unclassified 629
340 Ga0265327_10503299 3300031251 Unclassified 522
341 Ga0265316_10278779 3300031344 Bacteria 1222
342 Ga0265316_10910164 3300031344 Unclassified 614
343 Ga0265313_10009551 3300031595 Bacteria 6279
344 Ga0265313_10100719 3300031595 Bacteria 1283
345 Ga0307406_10121206 3300031901 Unclassified 1819
346 Ga0307412_10353856 3300031911 Bacteria 1180
347 Ga0307416_100873286 3300032002 Bacteria 998
348 Ga0307411_10370362 3300032005 Bacteria 1175
349 Ga0373928_0036074 3300035084 Unclassified 1117
350 Ga0373934_0032123 3300035086 Bacteria 2058
351 Ga0373940_0054436 3300035088 Bacteria 1131
352 Ga0373940_0141081 3300035088 Bacteria 762
353 Ga0373949_0019961 3300035090 Bacteria 1531
354 Ga0373932_0096868 3300035112 Unclassified 955
355 Ga0373939_0051562 3300035114 Unclassified 1280
356 Ga0373954_0043606 3300035118 Bacteria 2092
357 Ga0373956_0019159 3300035119 Bacteria 2901
358 Ga0373960_0109191 3300035121 Bacteria 906
359 Ga0373955_0471894 3300035172 Unclassified 765
360 Ga0373962_0072135 3300035242 Bacteria 1034
361 Ga0373931_0022478 3300035691 Bacteria 3175
362 Ga0373931_0039613 3300035691 Bacteria 2469
363 Ga0373931_0261801 3300035691 Bacteria 1055
364 Ga0373931_0288740 3300035691 Bacteria 1009
365 Ga0373931_0818649 3300035691 Bacteria 622
366 Ga0373933_0000134 3300035724 Bacteria 47187
367 Ga0373937_0000076 3300036401 Bacteria 89708
368 Ga0373937_1144744 3300036401 Unclassified 727
369 Ga0436364_1139901 3300037853 Unclassified 706
370 Ga0436364_1385332 3300037853 Bacteria 28665
371 Ga0436364_1563724 3300037853 Bacteria 663
372 Ga0395901_0588647 3300038443 Unclassified 1123
373 Ga0242420_004276 3300038996 Bacteria 2152
374 Ga0436365_1481982 3300039437 Bacteria 2101
375 Ga0436365_1683735 3300039437 Unclassified 916
376 Ga0436363_0079187 3300039450 Unclassified 515
377 Ga0436363_0353593 3300039450 Bacteria 1320
378 Ga0436363_1293518 3300039450 Unclassified 711
379 Ga0436362_0898951 3300039453 Bacteria 3990
380 Ga0451577_0456050 3300042876 Bacteria 1161
381 Ga0453683_0015498 3300044673 Bacteria 4936
382 Ga0453683_0047520 3300044673 Bacteria 2691
383 Ga0453683_0113974 3300044673 Bacteria 1701
384 Ga0453683_0139994 3300044673 Bacteria 1526
385 Ga0466963_0378098 3300044694 Bacteria 998
386 Ga0453684_0919986 3300044712 Unclassified 935
387 Ga0453684_1103703 3300044712 Bacteria 838
388 Ga0453684_2419214 3300044712 Unclassified 520
389 Ga0451576_0000637 3300045051 Bacteria 72776
390 Ga0451576_0781715 3300045051 Bacteria 1003
391 Ga0466958_0320653 3300045836 Unclassified 996
392 Ga0466967_1464199 3300045976 Unclassified 680
393 Ga0495592_0945483 3300046454 Bacteria 504
394 Ga0495651_0019548 3300046462 Bacteria 5253
395 Ga0495653_0161154 3300046463 Bacteria 1557
396 Ga0495580_0469118 3300046472 Bacteria 843
397 Ga0495608_0074737 3300046511 Bacteria 2209
398 Ga0495652_0005394 3300046529 Bacteria 12047
399 Ga0495587_0000066 3300046536 Bacteria 87398
400 Ga0495635_0843431 3300046663 Unclassified 589
401 Ga0495623_0015560 3300046679 Bacteria 4920
402 Ga0495604_0144944 3300047317 Unclassified 1693
403 Ga0495675_0000270 3300047444 Bacteria 37560
404 Ga0495684_0391878 3300047471 Unclassified 977
405 Ga0495602_0000576 3300048088 Bacteria 34173
406 Ga0496100_0172694 3300048903 Bacteria 1558
407 Ga0496100_0285814 3300048903 Bacteria 1231
408 Ga0496101_0018325 3300048904 Bacteria 4759
409 Ga0496101_0569952 3300048904 Bacteria 895
410 Ga0496101_1539300 3300048904 Unclassified 517
411 Ga0496102_0000650 3300048905 Bacteria 35051
412 Ga0496102_0000898 3300048905 Bacteria 28227
413 Ga0496102_0232614 3300048905 Bacteria 1737
414 Ga0496102_0367354 3300048905 Bacteria 1354
415 Ga0496102_0520562 3300048905 Unclassified 1112
416 Ga0496103_0006317 3300048906 Bacteria 7084
417 Ga0496103_0050175 3300048906 Bacteria 2581
418 Ga0496103_0437010 3300048906 Unclassified 840
419 Ga0496104_0063742 3300048907 Bacteria 3496
420 Ga0496104_0089236 3300048907 Bacteria 2945
421 Ga0496104_0296881 3300048907 Bacteria 1528
422 Ga0496104_1598087 3300048907 Unclassified 555
423 Ga0496105_0574785 3300048908 Bacteria 877
424 Ga0496106_0209767 3300048909 Bacteria 1551
425 Ga0496106_0245732 3300048909 Bacteria 1430
426 Ga0496107_0071404 3300048910 Bacteria 2523
427 Ga0496107_0712781 3300048910 Bacteria 738
428 Ga0496108_0002462 3300048911 Bacteria 14820
429 Ga0496108_0293257 3300048911 Bacteria 1416
430 Ga0496108_1551416 3300048911 Unclassified 549
431 Ga0496109_0000241 3300048912 Bacteria 53091
432 Ga0496109_0199721 3300048912 Bacteria 1880
433 Ga0496109_0348447 3300048912 Bacteria 1399
434 Ga0496110_0010851 3300048913 Bacteria 7430
435 Ga0496111_0008046 3300048914 Bacteria 6957
436 Ga0496112_0086708 3300048915 Bacteria 3097
437 Ga0496112_0326861 3300048915 Bacteria 1477
438 Ga0496113_0005424 3300048916 Bacteria 7950
439 Ga0496113_0742297 3300048916 Bacteria 782
440 Ga0496115_0181684 3300048918 Bacteria 1739
441 Ga0501299_087439 3300049522 Bacteria 703
442 Ga0501034_0015274 3300049571 Bacteria 7891
443 Ga0501067_0001322 3300049583 Bacteria 13425
444 Ga0501068_0001210 3300049584 Bacteria 13718
445 Ga0501069_0001423 3300049585 Bacteria 11736
446 Ga0501070_0004431 3300049586 Bacteria 12061
447 Ga0501071_0000205 3300049587 Bacteria 26898
448 Ga0501072_0002860 3300049588 Bacteria 12970
449 Ga0501073_0175169 3300049589 Bacteria 1484
450 Ga0501074_0000077 3300049590 Bacteria 47623
451 Ga0501076_0119904 3300049592 Bacteria 2130
452 Ga0501080_0004095 3300049742 Bacteria 12921
453 Ga0501083_0000477 3300049744 Bacteria 25720
454 Ga0501083_0367764 3300049744 Bacteria 935
455 Ga0501083_0485606 3300049744 Bacteria 804
456 nmdc:mga05p37_114128_c1 3300050507 Bacteria 3321
457 nmdc:mga06r32_532596_c1 3300050510 Unclassified 1150
458 nmdc:mga0n895_155801_c1 3300050512 Bacteria 2315
459 nmdc:mga0n895_89168_c1 3300050512 Bacteria 3085
460 nmdc:mga08x19_50122_c1 3300050514 Bacteria 2678
461 nmdc:mga0a205_400279_c1 3300050515 Bacteria 1237
462 Ga0501084_0006240 3300054114 Bacteria 9802
463 Ga0501084_1125925 3300054114 Unclassified 659
464 Ga0501082_0003975 3300060353 Bacteria 12909

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_1683735 Ga0436365_1683735_102_473 123
2 3300037853 Ga0436364_1563724 Ga0436364_1563724_211_588 124
3 3300039437 Ga0436365_1481982 Ga0436365_1481982_1514_1891 124
4 3300005434 Ga0070709_10080740 Ga0070709_100807403 125
5 3300005435 Ga0070714_102422373 Ga0070714_1024223731 125
6 3300005436 Ga0070713_100083755 Ga0070713_1000837553 125
7 3300005437 Ga0070710_10008077 Ga0070710_100080774 125
8 3300005439 Ga0070711_100004286 Ga0070711_1000042866 125
9 3300006028 Ga0070717_10555080 Ga0070717_105550801 125
10 3300006173 Ga0070716_100181324 Ga0070716_1001813242 125
11 3300006175 Ga0070712_100001686 Ga0070712_1000016866 125
12 3300013297 Ga0157378_10889636 Ga0157378_108896362 125
13 3300021358 Ga0213873_10100201 Ga0213873_101002011 125
14 3300025915 Ga0207693_10000214 Ga0207693_1000021436 125
15 3300025916 Ga0207663_10003886 Ga0207663_100038866 125
16 3300028017 Ga0265356_1019011 Ga0265356_10190112 125
17 3300030760 Ga0265762_1000032 Ga0265762_100003214 125
18 3300035084 Ga0373928_0036074 Ga0373928_0036074_332_709 125
19 3300039453 Ga0436362_0898951 Ga0436362_0898951_3256_3633 125
20 3300005289 Ga0065704_10475819 Ga0065704_104758192 126
21 3300005290 Ga0065712_10518478 Ga0065712_105184781 126
22 3300005329 Ga0070683_100005070 Ga0070683_1000050704 126
23 3300005330 Ga0070690_100007958 Ga0070690_1000079586 126
24 3300005334 Ga0068869_100040634 Ga0068869_1000406345 126
25 3300005334 Ga0068869_100137455 Ga0068869_1001374551 126
26 3300005335 Ga0070666_10130282 Ga0070666_101302823 126
27 3300005335 Ga0070666_10993763 Ga0070666_109937631 126
28 3300005336 Ga0070680_100159592 Ga0070680_1001595921 126
29 3300005337 Ga0070682_100087484 Ga0070682_1000874842 126
30 3300005338 Ga0068868_100017386 Ga0068868_1000173862 126
31 3300005338 Ga0068868_100536126 Ga0068868_1005361262 126
32 3300005339 Ga0070660_100009078 Ga0070660_1000090787 126
33 3300005340 Ga0070689_100264814 Ga0070689_1002648143 126
34 3300005343 Ga0070687_101318523 Ga0070687_1013185231 126
35 3300005345 Ga0070692_11274110 Ga0070692_112741101 126
36 3300005366 Ga0070659_100040955 Ga0070659_1000409554 126
37 3300005367 Ga0070667_100018064 Ga0070667_1000180645 126
38 3300005367 Ga0070667_100709094 Ga0070667_1007090942 126
39 3300005434 Ga0070709_10508523 Ga0070709_105085231 126
40 3300005436 Ga0070713_100027601 Ga0070713_1000276012 126
41 3300005441 Ga0070700_100075818 Ga0070700_1000758182 126
42 3300005445 Ga0070708_100007809 Ga0070708_1000078095 126
43 3300005445 Ga0070708_100009233 Ga0070708_1000092335 126
44 3300005445 Ga0070708_100124402 Ga0070708_1001244023 126
45 3300005445 Ga0070708_101092692 Ga0070708_1010926922 126
46 3300005455 Ga0070663_100020616 Ga0070663_1000206164 126
47 3300005455 Ga0070663_100478969 Ga0070663_1004789691 126
48 3300005456 Ga0070678_100928571 Ga0070678_1009285712 126
49 3300005457 Ga0070662_100001509 Ga0070662_1000015092 126
50 3300005458 Ga0070681_10302371 Ga0070681_103023713 126
51 3300005458 Ga0070681_10354405 Ga0070681_103544052 126
52 3300005458 Ga0070681_10698045 Ga0070681_106980452 126
53 3300005459 Ga0068867_100105707 Ga0068867_1001057073 126
54 3300005459 Ga0068867_102231991 Ga0068867_1022319911 126
55 3300005467 Ga0070706_100000454 Ga0070706_10000045417 126
56 3300005468 Ga0070707_100105897 Ga0070707_1001058973 126
57 3300005468 Ga0070707_100115369 Ga0070707_1001153694 126
58 3300005468 Ga0070707_100140876 Ga0070707_1001408763 126
59 3300005518 Ga0070699_100006134 Ga0070699_1000061345 126
60 3300005518 Ga0070699_100083968 Ga0070699_1000839684 126
61 3300005518 Ga0070699_100200958 Ga0070699_1002009582 126
62 3300005518 Ga0070699_100367844 Ga0070699_1003678443 126
63 3300005530 Ga0070679_100595804 Ga0070679_1005958041 126
64 3300005530 Ga0070679_100821745 Ga0070679_1008217452 126
65 3300005535 Ga0070684_100009203 Ga0070684_1000092035 126
66 3300005536 Ga0070697_100000411 Ga0070697_10000041127 126
67 3300005536 Ga0070697_100005073 Ga0070697_1000050734 126
68 3300005536 Ga0070697_100309750 Ga0070697_1003097502 126
69 3300005536 Ga0070697_101185299 Ga0070697_1011852992 126
70 3300005536 Ga0070697_101523692 Ga0070697_1015236921 126
71 3300005539 Ga0068853_100277159 Ga0068853_1002771592 126
72 3300005546 Ga0070696_100181557 Ga0070696_1001815573 126
73 3300005546 Ga0070696_101140570 Ga0070696_1011405701 126
74 3300005547 Ga0070693_100178797 Ga0070693_1001787972 126
75 3300005548 Ga0070665_100017004 Ga0070665_1000170042 126
76 3300005548 Ga0070665_101495319 Ga0070665_1014953191 126
77 3300005549 Ga0070704_100106352 Ga0070704_1001063521 126
78 3300005563 Ga0068855_100041603 Ga0068855_1000416036 126
79 3300005564 Ga0070664_100056939 Ga0070664_1000569394 126
80 3300005577 Ga0068857_100102462 Ga0068857_1001024623 126
81 3300005577 Ga0068857_101963855 Ga0068857_1019638551 126
82 3300005578 Ga0068854_100014267 Ga0068854_1000142674 126
83 3300005614 Ga0068856_100026690 Ga0068856_1000266906 126
84 3300005614 Ga0068856_100604404 Ga0068856_1006044042 126
85 3300005616 Ga0068852_100129769 Ga0068852_1001297692 126
86 3300005617 Ga0068859_100011364 Ga0068859_1000113646 126
87 3300005618 Ga0068864_100422891 Ga0068864_1004228914 126
88 3300005618 Ga0068864_100994205 Ga0068864_1009942052 126
89 3300005718 Ga0068866_10603014 Ga0068866_106030142 126
90 3300005719 Ga0068861_100054890 Ga0068861_1000548904 126
91 3300005841 Ga0068863_100054521 Ga0068863_1000545213 126
92 3300005841 Ga0068863_100647697 Ga0068863_1006476973 126
93 3300005842 Ga0068858_100373633 Ga0068858_1003736334 126
94 3300005843 Ga0068860_100063221 Ga0068860_1000632215 126
95 3300005844 Ga0068862_100232424 Ga0068862_1002324243 126
96 3300005844 Ga0068862_100399578 Ga0068862_1003995781 126
97 3300006028 Ga0070717_10724845 Ga0070717_107248452 126
98 3300006173 Ga0070716_100044660 Ga0070716_1000446604 126
99 3300006173 Ga0070716_100167228 Ga0070716_1001672282 126
100 3300006237 Ga0097621_100082090 Ga0097621_1000820903 126
101 3300006237 Ga0097621_101019060 Ga0097621_1010190602 126
102 3300006237 Ga0097621_101226238 Ga0097621_1012262381 126
103 3300006358 Ga0068871_100179388 Ga0068871_1001793882 126
104 3300006881 Ga0068865_100046769 Ga0068865_1000467693 126
105 3300006881 Ga0068865_100094578 Ga0068865_1000945782 126
106 3300006931 Ga0097620_100011364 Ga0097620_1000113645 126
107 3300009092 Ga0105250_10254663 Ga0105250_102546631 126
108 3300009093 Ga0105240_10140971 Ga0105240_101409711 126
109 3300009093 Ga0105240_10833669 Ga0105240_108336692 126
110 3300009098 Ga0105245_10012140 Ga0105245_100121402 126
111 3300009098 Ga0105245_10063191 Ga0105245_100631914 126
112 3300009098 Ga0105245_10374714 Ga0105245_103747142 126
113 3300009101 Ga0105247_10380979 Ga0105247_103809792 126
114 3300009148 Ga0105243_10086729 Ga0105243_100867293 126
115 3300009174 Ga0105241_10058399 Ga0105241_100583992 126
116 3300009174 Ga0105241_10240394 Ga0105241_102403942 126
117 3300009176 Ga0105242_10201194 Ga0105242_102011941 126
118 3300009176 Ga0105242_10336936 Ga0105242_103369363 126
119 3300009177 Ga0105248_10028183 Ga0105248_100281834 126
120 3300009545 Ga0105237_10338639 Ga0105237_103386392 126
121 3300009545 Ga0105237_11094461 Ga0105237_110944611 126
122 3300009551 Ga0105238_10223771 Ga0105238_102237713 126
123 3300009553 Ga0105249_10040299 Ga0105249_100402993 126
124 3300009553 Ga0105249_10229354 Ga0105249_102293543 126
125 3300009553 Ga0105249_13300263 Ga0105249_133002631 126
126 3300010375 Ga0105239_11448205 Ga0105239_114482052 126
127 3300011119 Ga0105246_10008469 Ga0105246_100084696 126
128 3300013100 Ga0157373_10101729 Ga0157373_101017294 126
129 3300013100 Ga0157373_10353229 Ga0157373_103532293 126
130 3300013100 Ga0157373_10994202 Ga0157373_109942021 126
131 3300013102 Ga0157371_10039968 Ga0157371_100399683 126
132 3300013104 Ga0157370_10133796 Ga0157370_101337965 126
133 3300013105 Ga0157369_10215009 Ga0157369_102150093 126
134 3300013296 Ga0157374_10114825 Ga0157374_101148252 126
135 3300013296 Ga0157374_10177626 Ga0157374_101776262 126
136 3300013297 Ga0157378_10079978 Ga0157378_100799783 126
137 3300013297 Ga0157378_10274533 Ga0157378_102745332 126
138 3300013297 Ga0157378_11084955 Ga0157378_110849552 126
139 3300013306 Ga0163162_10008845 Ga0163162_100088456 126
140 3300013306 Ga0163162_10018082 Ga0163162_100180829 126
141 3300013306 Ga0163162_10093456 Ga0163162_100934563 126
142 3300013307 Ga0157372_10111008 Ga0157372_101110081 126
143 3300014325 Ga0163163_10122897 Ga0163163_101228973 126
144 3300014968 Ga0157379_10070074 Ga0157379_100700744 126
145 3300014968 Ga0157379_10082683 Ga0157379_100826832 126
146 3300014968 Ga0157379_12545188 Ga0157379_125451881 126
147 3300014969 Ga0157376_10356146 Ga0157376_103561462 126
148 3300024227 Ga0228598_1015242 Ga0228598_10152423 126
149 3300025899 Ga0207642_10012657 Ga0207642_100126575 126
150 3300025903 Ga0207680_10090245 Ga0207680_100902453 126
151 3300025910 Ga0207684_10011901 Ga0207684_100119015 126
152 3300025910 Ga0207684_10041049 Ga0207684_100410493 126
153 3300025910 Ga0207684_10177013 Ga0207684_101770132 126
154 3300025911 Ga0207654_10018592 Ga0207654_100185921 126
155 3300025912 Ga0207707_10132533 Ga0207707_101325332 126
156 3300025913 Ga0207695_10006799 Ga0207695_100067999 126
157 3300025913 Ga0207695_11692532 Ga0207695_116925321 126
158 3300025917 Ga0207660_10030728 Ga0207660_100307284 126
159 3300025919 Ga0207657_10045264 Ga0207657_100452645 126
160 3300025920 Ga0207649_10295847 Ga0207649_102958471 126
161 3300025921 Ga0207652_10200819 Ga0207652_102008193 126
162 3300025921 Ga0207652_10654686 Ga0207652_106546862 126
163 3300025922 Ga0207646_10095416 Ga0207646_100954163 126
164 3300025922 Ga0207646_10922036 Ga0207646_109220361 126
165 3300025923 Ga0207681_10463961 Ga0207681_104639613 126
166 3300025924 Ga0207694_10085099 Ga0207694_100850994 126
167 3300025927 Ga0207687_10017487 Ga0207687_100174875 126
168 3300025927 Ga0207687_11093077 Ga0207687_110930772 126
169 3300025932 Ga0207690_10105772 Ga0207690_101057722 126
170 3300025933 Ga0207706_10000868 Ga0207706_100008684 126
171 3300025934 Ga0207686_10197205 Ga0207686_101972051 126
172 3300025935 Ga0207709_10225282 Ga0207709_102252823 126
173 3300025936 Ga0207670_10216397 Ga0207670_102163972 126
174 3300025938 Ga0207704_10188724 Ga0207704_101887242 126
175 3300025939 Ga0207665_10062810 Ga0207665_100628101 126
176 3300025939 Ga0207665_10322899 Ga0207665_103228991 126
177 3300025941 Ga0207711_10022747 Ga0207711_100227473 126
178 3300025942 Ga0207689_10087416 Ga0207689_100874163 126
179 3300025942 Ga0207689_10153481 Ga0207689_101534813 126
180 3300025944 Ga0207661_10034518 Ga0207661_100345184 126
181 3300025945 Ga0207679_10090319 Ga0207679_100903192 126
182 3300025949 Ga0207667_10168645 Ga0207667_101686453 126
183 3300025961 Ga0207712_10004079 Ga0207712_100040795 126
184 3300025972 Ga0207668_10131406 Ga0207668_101314064 126
185 3300025986 Ga0207658_10108859 Ga0207658_101088594 126
186 3300025986 Ga0207658_10337081 Ga0207658_103370812 126
187 3300026023 Ga0207677_10159329 Ga0207677_101593293 126
188 3300026035 Ga0207703_10439193 Ga0207703_104391931 126
189 3300026067 Ga0207678_10002447 Ga0207678_1000244715 126
190 3300026067 Ga0207678_10528856 Ga0207678_105288562 126
191 3300026075 Ga0207708_10070293 Ga0207708_100702932 126
192 3300026078 Ga0207702_10232634 Ga0207702_102326343 126
193 3300026078 Ga0207702_12002826 Ga0207702_120028261 126
194 3300026088 Ga0207641_10016855 Ga0207641_100168556 126
195 3300026089 Ga0207648_10031250 Ga0207648_100312504 126
196 3300026095 Ga0207676_10402935 Ga0207676_104029352 126
197 3300026095 Ga0207676_10903807 Ga0207676_109038072 126
198 3300026116 Ga0207674_10065637 Ga0207674_100656374 126
199 3300026118 Ga0207675_100253732 Ga0207675_1002537322 126
200 3300026121 Ga0207683_10266968 Ga0207683_102669682 126
201 3300026142 Ga0207698_10050520 Ga0207698_100505201 126
202 3300028379 Ga0268266_10177638 Ga0268266_101776382 126
203 3300028379 Ga0268266_11290691 Ga0268266_112906911 126
204 3300028380 Ga0268265_10712888 Ga0268265_107128882 126
205 3300028381 Ga0268264_11679514 Ga0268264_116795142 126
206 3300028800 Ga0265338_10017868 Ga0265338_100178686 126
207 3300031090 Ga0265760_10005055 Ga0265760_100050554 126
208 3300031235 Ga0265330_10238673 Ga0265330_102386731 126
209 3300031235 Ga0265330_10517738 Ga0265330_105177381 126
210 3300031239 Ga0265328_10036154 Ga0265328_100361542 126
211 3300031241 Ga0265325_10011506 Ga0265325_100115065 126
212 3300031241 Ga0265325_10014940 Ga0265325_100149404 126
213 3300031247 Ga0265340_10002683 Ga0265340_100026832 126
214 3300031247 Ga0265340_10005877 Ga0265340_100058775 126
215 3300031249 Ga0265339_10266254 Ga0265339_102662542 126
216 3300031250 Ga0265331_10025254 Ga0265331_100252542 126
217 3300031251 Ga0265327_10365412 Ga0265327_103654121 126
218 3300031251 Ga0265327_10503299 Ga0265327_105032991 126
219 3300031595 Ga0265313_10009551 Ga0265313_100095513 126
220 3300035088 Ga0373940_0141081 Ga0373940_0141081_279_659 126
221 3300035114 Ga0373939_0051562 Ga0373939_0051562_685_1065 126
222 3300035121 Ga0373960_0109191 Ga0373960_0109191_37_417 126
223 3300035242 Ga0373962_0072135 Ga0373962_0072135_467_847 126
224 3300035691 Ga0373931_0261801 Ga0373931_0261801_245_625 126
225 3300035691 Ga0373931_0288740 Ga0373931_0288740_536_916 126
226 3300037853 Ga0436364_1139901 Ga0436364_1139901_209_589 126
227 3300037853 Ga0436364_1385332 Ga0436364_1385332_21075_21455 126
228 3300038996 Ga0242420_004276 Ga0242420_004276_1711_2091 126
229 3300039450 Ga0436363_0079187 Ga0436363_0079187_14_394 126
230 3300039450 Ga0436363_0353593 Ga0436363_0353593_849_1229 126
231 3300039450 Ga0436363_1293518 Ga0436363_1293518_134_514 126
232 3300044694 Ga0466963_0378098 Ga0466963_0378098_518_898 126
233 3300044712 Ga0453684_2419214 Ga0453684_2419214_85_465 126
234 3300045051 Ga0451576_0781715 Ga0451576_0781715_255_635 126
235 3300045836 Ga0466958_0320653 Ga0466958_0320653_349_729 126
236 3300045976 Ga0466967_1464199 Ga0466967_1464199_139_519 126
237 3300046472 Ga0495580_0469118 Ga0495580_0469118_64_444 126
238 3300048905 Ga0496102_0232614 Ga0496102_0232614_806_1186 126
239 3300048905 Ga0496102_0367354 Ga0496102_0367354_108_488 126
240 3300048905 Ga0496102_0520562 Ga0496102_0520562_578_958 126
241 3300048906 Ga0496103_0437010 Ga0496103_0437010_408_788 126
242 3300048910 Ga0496107_0712781 Ga0496107_0712781_142_522 126
243 3300048911 Ga0496108_0293257 Ga0496108_0293257_664_1044 126
244 3300048912 Ga0496109_0199721 Ga0496109_0199721_1097_1477 126
245 3300048915 Ga0496112_0326861 Ga0496112_0326861_114_494 126
246 3300048916 Ga0496113_0742297 Ga0496113_0742297_224_604 126
247 3300049744 Ga0501083_0367764 Ga0501083_0367764_382_762 126
248 3300049744 Ga0501083_0485606 Ga0501083_0485606_323_703 126
249 3300054114 Ga0501084_1125925 Ga0501084_1125925_254_634 126
250 3300005436 Ga0070713_100132809 Ga0070713_1001328093 127
251 3300005437 Ga0070710_10839347 Ga0070710_108393471 127
252 3300005842 Ga0068858_101117953 Ga0068858_1011179532 127
253 3300006237 Ga0097621_100869534 Ga0097621_1008695342 127
254 3300007265 Ga0099794_10008233 Ga0099794_100082334 127
255 3300007788 Ga0099795_10577642 Ga0099795_105776421 127
256 3300021384 Ga0213876_10152363 Ga0213876_101523632 127
257 3300021388 Ga0213875_10419104 Ga0213875_104191041 127
258 3300025929 Ga0207664_10240436 Ga0207664_102404362 127
259 3300027512 Ga0209179_1036940 Ga0209179_10369402 127
260 3300031344 Ga0265316_10278779 Ga0265316_102787792 127
261 3300047471 Ga0495684_0391878 Ga0495684_0391878_275_658 127
262 3300005436 Ga0070713_100274139 Ga0070713_1002741392 128
263 3300005445 Ga0070708_100319889 Ga0070708_1003198892 128
264 3300005468 Ga0070707_100795052 Ga0070707_1007950522 128
265 3300006028 Ga0070717_10239912 Ga0070717_102399122 128
266 3300007265 Ga0099794_10040515 Ga0099794_100405151 128
267 3300007265 Ga0099794_10220933 Ga0099794_102209331 128
268 3300009092 Ga0105250_10128447 Ga0105250_101284472 128
269 3300009098 Ga0105245_10283813 Ga0105245_102838132 128
270 3300009176 Ga0105242_10628194 Ga0105242_106281942 128
271 3300010159 Ga0099796_10067135 Ga0099796_100671352 128
272 3300025916 Ga0207663_11088136 Ga0207663_110881362 128
273 3300025928 Ga0207700_10215221 Ga0207700_102152212 128
274 3300028800 Ga0265338_10017171 Ga0265338_1001717111 128
275 3300031239 Ga0265328_10404892 Ga0265328_104048922 128
276 3300031241 Ga0265325_10004545 Ga0265325_100045452 128
277 3300031344 Ga0265316_10910164 Ga0265316_109101642 128
278 3300031595 Ga0265313_10100719 Ga0265313_101007191 128
279 3300035086 Ga0373934_0032123 Ga0373934_0032123_1028_1414 128
280 3300035118 Ga0373954_0043606 Ga0373954_0043606_1576_1962 128
281 3300035119 Ga0373956_0019159 Ga0373956_0019159_1930_2316 128
282 3300035172 Ga0373955_0471894 Ga0373955_0471894_126_512 128
283 3300035691 Ga0373931_0039613 Ga0373931_0039613_1267_1707 128
284 3300035724 Ga0373933_0000134 Ga0373933_0000134_14300_14686 128
285 3300036401 Ga0373937_0000076 Ga0373937_0000076_76167_76553 128
286 3300036401 Ga0373937_1144744 Ga0373937_1144744_19_405 128
287 3300042876 Ga0451577_0456050 Ga0451577_0456050_504_890 128
288 3300044673 Ga0453683_0015498 Ga0453683_0015498_3113_3499 128
289 3300044712 Ga0453684_0919986 Ga0453684_0919986_266_652 128
290 3300046462 Ga0495651_0019548 Ga0495651_0019548_109_495 128
291 3300046463 Ga0495653_0161154 Ga0495653_0161154_1006_1392 128
292 3300046511 Ga0495608_0074737 Ga0495608_0074737_1265_1651 128
293 3300046529 Ga0495652_0005394 Ga0495652_0005394_10326_10712 128
294 3300046536 Ga0495587_0000066 Ga0495587_0000066_19994_20380 128
295 3300046663 Ga0495635_0843431 Ga0495635_0843431_75_461 128
296 3300046679 Ga0495623_0015560 Ga0495623_0015560_2876_3262 128
297 3300047317 Ga0495604_0144944 Ga0495604_0144944_1196_1582 128
298 3300047444 Ga0495675_0000270 Ga0495675_0000270_26958_27344 128
299 3300048088 Ga0495602_0000576 Ga0495602_0000576_33646_34032 128
300 3300048904 Ga0496101_1539300 Ga0496101_1539300_54_500 128
301 3300048905 Ga0496102_0000898 Ga0496102_0000898_25289_25735 128
302 3300048906 Ga0496103_0006317 Ga0496103_0006317_1790_2236 128
303 3300048907 Ga0496104_0063742 Ga0496104_0063742_197_637 128
304 3300048907 Ga0496104_0089236 Ga0496104_0089236_2271_2717 128
305 3300048909 Ga0496106_0245732 Ga0496106_0245732_415_861 128
306 3300048911 Ga0496108_1551416 Ga0496108_1551416_19_465 128
307 3300005347 Ga0070668_100003748 Ga0070668_1000037484 131
308 3300005354 Ga0070675_100082833 Ga0070675_1000828332 131
309 3300005356 Ga0070674_100106620 Ga0070674_1001066202 131
310 3300005364 Ga0070673_100043255 Ga0070673_1000432553 131
311 3300005364 Ga0070673_101388626 Ga0070673_1013886261 131
312 3300005438 Ga0070701_10240182 Ga0070701_102401822 131
313 3300005440 Ga0070705_100592989 Ga0070705_1005929891 131
314 3300005445 Ga0070708_100044771 Ga0070708_1000447714 131
315 3300005455 Ga0070663_101069064 Ga0070663_1010690642 131
316 3300005459 Ga0068867_100404291 Ga0068867_1004042911 131
317 3300005467 Ga0070706_100006873 Ga0070706_1000068732 131
318 3300005468 Ga0070707_100059118 Ga0070707_1000591182 131
319 3300005518 Ga0070699_100007475 Ga0070699_10000747510 131
320 3300005536 Ga0070697_100057250 Ga0070697_1000572503 131
321 3300005543 Ga0070672_100243332 Ga0070672_1002433321 131
322 3300005543 Ga0070672_100459146 Ga0070672_1004591462 131
323 3300005719 Ga0068861_100059717 Ga0068861_1000597172 131
324 3300009177 Ga0105248_10665801 Ga0105248_106658012 131
325 3300013308 Ga0157375_10153466 Ga0157375_101534662 131
326 3300014325 Ga0163163_10064627 Ga0163163_100646273 131
327 3300014326 Ga0157380_10145448 Ga0157380_101454482 131
328 3300025910 Ga0207684_10023636 Ga0207684_100236364 131
329 3300025922 Ga0207646_10067330 Ga0207646_100673302 131
330 3300025926 Ga0207659_10044079 Ga0207659_100440792 131
331 3300025937 Ga0207669_10285403 Ga0207669_102854032 131
332 3300025940 Ga0207691_10017285 Ga0207691_100172855 131
333 3300025940 Ga0207691_10097660 Ga0207691_100976602 131
334 3300025941 Ga0207711_10943772 Ga0207711_109437721 131
335 3300025960 Ga0207651_11386734 Ga0207651_113867342 131
336 3300026067 Ga0207678_10961075 Ga0207678_109610751 131
337 3300026089 Ga0207648_11222856 Ga0207648_112228562 131
338 3300005468 Ga0070707_100709016 Ga0070707_1007090162 132
339 3300005518 Ga0070699_100777234 Ga0070699_1007772342 132
340 3300013296 Ga0157374_10075302 Ga0157374_100753022 132
341 3300025922 Ga0207646_10394606 Ga0207646_103946062 132
342 3300049571 Ga0501034_0015274 Ga0501034_0015274_3104_3511 132
343 3300049583 Ga0501067_0001322 Ga0501067_0001322_9470_9877 132
344 3300049584 Ga0501068_0001210 Ga0501068_0001210_8748_9155 132
345 3300049585 Ga0501069_0001423 Ga0501069_0001423_11247_11654 132
346 3300049586 Ga0501070_0004431 Ga0501070_0004431_3549_3956 132
347 3300049587 Ga0501071_0000205 Ga0501071_0000205_3549_3956 132
348 3300049588 Ga0501072_0002860 Ga0501072_0002860_5053_5460 132
349 3300049589 Ga0501073_0175169 Ga0501073_0175169_1006_1413 132
350 3300049590 Ga0501074_0000077 Ga0501074_0000077_43686_44093 132
351 3300049592 Ga0501076_0119904 Ga0501076_0119904_1479_1886 132
352 3300049742 Ga0501080_0004095 Ga0501080_0004095_1396_1803 132
353 3300049744 Ga0501083_0000477 Ga0501083_0000477_24807_25214 132
354 3300054114 Ga0501084_0006240 Ga0501084_0006240_1396_1803 132
355 3300060353 Ga0501082_0003975 Ga0501082_0003975_1384_1791 132
356 3300005341 Ga0070691_10553937 Ga0070691_105539372 133
357 3300005438 Ga0070701_10078229 Ga0070701_100782292 133
358 3300005441 Ga0070700_100108783 Ga0070700_1001087833 133
359 3300005445 Ga0070708_100269958 Ga0070708_1002699582 133
360 3300005471 Ga0070698_100259533 Ga0070698_1002595332 133
361 3300005536 Ga0070697_100757696 Ga0070697_1007576961 133
362 3300005549 Ga0070704_100073589 Ga0070704_1000735892 133
363 3300005843 Ga0068860_102081067 Ga0068860_1020810671 133
364 3300006844 Ga0075428_100951607 Ga0075428_1009516072 133
365 3300007076 Ga0075435_100772403 Ga0075435_1007724032 133
366 3300026095 Ga0207676_10084308 Ga0207676_100843082 133
367 3300028381 Ga0268264_11593795 Ga0268264_115937951 133
368 3300038443 Ga0395901_0588647 Ga0395901_0588647_258_668 133
369 3300044673 Ga0453683_0047520 Ga0453683_0047520_545_955 133
370 3300044673 Ga0453683_0113974 Ga0453683_0113974_1083_1493 133
371 3300005434 Ga0070709_10726879 Ga0070709_107268791 134
372 3300005436 Ga0070713_100897608 Ga0070713_1008976082 134
373 3300005439 Ga0070711_100023680 Ga0070711_1000236805 134
374 3300005445 Ga0070708_100017595 Ga0070708_1000175952 134
375 3300006175 Ga0070712_100220227 Ga0070712_1002202272 134
376 3300025915 Ga0207693_10152351 Ga0207693_101523512 134
377 3300025916 Ga0207663_11087073 Ga0207663_110870732 134
378 3300025928 Ga0207700_10577465 Ga0207700_105774651 134
379 3300035112 Ga0373932_0096868 Ga0373932_0096868_205_618 134
380 3300044673 Ga0453683_0139994 Ga0453683_0139994_264_677 134
381 3300048903 Ga0496100_0285814 Ga0496100_0285814_351_764 134
382 3300048904 Ga0496101_0018325 Ga0496101_0018325_3711_4124 134
383 3300048912 Ga0496109_0348447 Ga0496109_0348447_53_466 134
384 3300005434 Ga0070709_10715599 Ga0070709_107155992 135
385 3300005471 Ga0070698_101616214 Ga0070698_1016162141 135
386 3300006844 Ga0075428_100026434 Ga0075428_1000264342 135
387 3300006847 Ga0075431_100380418 Ga0075431_1003804183 135
388 3300006871 Ga0075434_100154569 Ga0075434_1001545692 135
389 3300006880 Ga0075429_100189356 Ga0075429_1001893562 135
390 3300006914 Ga0075436_100466943 Ga0075436_1004669432 135
391 3300009147 Ga0114129_10000442 Ga0114129_100004421 135
392 3300013296 Ga0157374_11140860 Ga0157374_111408602 135
393 3300014968 Ga0157379_10557995 Ga0157379_105579951 135
394 3300025906 Ga0207699_10363584 Ga0207699_103635842 135
395 3300025916 Ga0207663_11457340 Ga0207663_114573401 135
396 3300025941 Ga0207711_10178725 Ga0207711_101787252 135
397 3300031901 Ga0307406_10121206 Ga0307406_101212062 135
398 3300031911 Ga0307412_10353856 Ga0307412_103538562 135
399 3300032002 Ga0307416_100873286 Ga0307416_1008732861 135
400 3300032005 Ga0307411_10370362 Ga0307411_103703622 135
401 3300035088 Ga0373940_0054436 Ga0373940_0054436_219_635 135
402 3300035090 Ga0373949_0019961 Ga0373949_0019961_932_1348 135
403 3300035691 Ga0373931_0818649 Ga0373931_0818649_88_504 135
404 3300045051 Ga0451576_0000637 Ga0451576_0000637_853_1263 135
405 3300046454 Ga0495592_0945483 Ga0495592_0945483_56_466 135
406 3300048907 Ga0496104_0296881 Ga0496104_0296881_800_1210 135
407 3300048907 Ga0496104_1598087 Ga0496104_1598087_80_490 135
408 3300049522 Ga0501299_087439 Ga0501299_087439_67_483 135
409 3300050507 nmdc:mga05p37_114128_c1 nmdc:mga05p37_114128_c1_607_1077 135
410 3300050510 nmdc:mga06r32_532596_c1 nmdc:mga06r32_532596_c1_74_544 135
411 3300050512 nmdc:mga0n895_155801_c1 nmdc:mga0n895_155801_c1_317_787 135
412 3300050514 nmdc:mga08x19_50122_c1 nmdc:mga08x19_50122_c1_251_661 135
413 3300050515 nmdc:mga0a205_400279_c1 nmdc:mga0a205_400279_c1_222_692 135
414 3300005518 Ga0070699_100751607 Ga0070699_1007516072 136
415 3300005546 Ga0070696_100876306 Ga0070696_1008763061 136
416 3300020080 Ga0206350_10288710 Ga0206350_102887101 137
417 3300005435 Ga0070714_100906292 Ga0070714_1009062922 139
418 3300026142 Ga0207698_11317065 Ga0207698_113170651 144
419 2162886012 MBSR1b_contig_3548509 MBSR1b_0095.00003310 145
420 3300005293 Ga0065715_10007458 Ga0065715_100074582 145
421 3300005330 Ga0070690_100049831 Ga0070690_1000498312 145
422 3300005334 Ga0068869_100822919 Ga0068869_1008229191 145
423 3300005340 Ga0070689_100156651 Ga0070689_1001566511 145
424 3300005365 Ga0070688_100083397 Ga0070688_1000833973 145
425 3300005545 Ga0070695_100072218 Ga0070695_1000722182 145
426 3300005546 Ga0070696_100004251 Ga0070696_1000042512 145
427 3300005547 Ga0070693_100134586 Ga0070693_1001345862 145
428 3300005549 Ga0070704_100033984 Ga0070704_1000339842 145
429 3300005615 Ga0070702_100272995 Ga0070702_1002729952 145
430 3300005617 Ga0068859_100084557 Ga0068859_1000845573 145
431 3300005841 Ga0068863_100281249 Ga0068863_1002812493 145
432 3300005842 Ga0068858_101459258 Ga0068858_1014592582 145
433 3300006871 Ga0075434_100055819 Ga0075434_1000558192 145
434 3300006931 Ga0097620_100084559 Ga0097620_1000845593 145
435 3300007076 Ga0075435_100122551 Ga0075435_1001225513 145
436 3300009098 Ga0105245_10945390 Ga0105245_109453902 145
437 3300009147 Ga0114129_10377255 Ga0114129_103772552 145
438 3300009174 Ga0105241_10384601 Ga0105241_103846012 145
439 3300009545 Ga0105237_10206672 Ga0105237_102066722 145
440 3300009553 Ga0105249_10291377 Ga0105249_102913773 145
441 3300010375 Ga0105239_10949900 Ga0105239_109499002 145
442 3300025914 Ga0207671_10983986 Ga0207671_109839861 145
443 3300025927 Ga0207687_11428828 Ga0207687_114288281 145
444 3300025933 Ga0207706_11023690 Ga0207706_110236901 145
445 3300025936 Ga0207670_10042752 Ga0207670_100427523 145
446 3300025961 Ga0207712_10552805 Ga0207712_105528051 145
447 3300026035 Ga0207703_10636425 Ga0207703_106364252 145
448 3300035691 Ga0373931_0022478 Ga0373931_0022478_2449_2886 145
449 3300044712 Ga0453684_1103703 Ga0453684_1103703_171_653 145
450 3300048903 Ga0496100_0172694 Ga0496100_0172694_210_647 145
451 3300048904 Ga0496101_0569952 Ga0496101_0569952_225_662 145
452 3300048905 Ga0496102_0000650 Ga0496102_0000650_32489_32926 145
453 3300048906 Ga0496103_0050175 Ga0496103_0050175_697_1134 145
454 3300048908 Ga0496105_0574785 Ga0496105_0574785_279_716 145
455 3300048909 Ga0496106_0209767 Ga0496106_0209767_141_578 145
456 3300048910 Ga0496107_0071404 Ga0496107_0071404_1052_1489 145
457 3300048911 Ga0496108_0002462 Ga0496108_0002462_8797_9234 145
458 3300048912 Ga0496109_0000241 Ga0496109_0000241_23037_23474 145
459 3300048913 Ga0496110_0010851 Ga0496110_0010851_6752_7189 145
460 3300048914 Ga0496111_0008046 Ga0496111_0008046_5772_6209 145
461 3300048915 Ga0496112_0086708 Ga0496112_0086708_2650_3087 145
462 3300048916 Ga0496113_0005424 Ga0496113_0005424_6215_6652 145
463 3300048918 Ga0496115_0181684 Ga0496115_0181684_1136_1573 145
464 3300050512 nmdc:mga0n895_89168_c1 nmdc:mga0n895_89168_c1_410_847 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01878

EVE

EVE domain

3

131

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zce-assembly1.cif.gz_A x-ray crystal structure of protein atu2648 from agrobacterium tumefaciens. northeast structural genomics consortium target atr33. 0.9655 2 132
2gbs-assembly1.cif.gz_A nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3 0.9643 2 132
2g2x-assembly3.cif.gz_C x-ray crystal structure protein q88ch6 from pseudomonas putida. northeast structural genomics consortium target ppr72. 0.9511 3 132
2eve-assembly1.cif.gz_A x-ray crystal structure of protein pspto5229 from pseudomonas syringae. northeast structural genomics consortium target psr62 0.9474 3 132
2ar1-assembly1.cif.gz_A structure of hypothetical protein from leishmania major 0.9403 1 132
ID Description Score Start End Superfamily
af_I1JAX2_1_77_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.972 1 72 3.10.590.10
af_A4ICC8_1_164_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.952 2 132 3.10.590.10
af_O94645_8_177_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9335 3 134 3.10.590.10
2eveA00 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.925 3 132 3.10.590.10
3eopB00 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9206 4 135 3.10.590.10
ID Description Score Start End GO Terms
AF-A0A517XRJ8-F1-model_v4 EVE domain protein 0.9959 3 132
AF-A0A2S6TIU4-F1-model_v4 EVE domain-containing protein 0.9957 3 67
AF-A0A1Q7FG16-F1-model_v4 Ubiquinol-cytochrome C reductase 0.9956 3 133
AF-A0A3D4TA91-F1-model_v4 EVE domain-containing protein 0.9954 4 64
AF-A0A2V6EM40-F1-model_v4 EVE domain-containing protein 0.9947 1 69

Feature Viewer

pLDDT pTM Quality
92.42 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map