F449253

General Info

Members Datasets Scaffolds Average Seq Length
464 221 415 468

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100042148|Ga0070698_1000421482
Length 498
Sequence VIVKGLGIRDWGWVGAIAALIVSATPRAQPLQSFGSSLVLSQSKDERLAQDRPDWKALEGEIMQQFQAVLRLDTRNPPGNEHLVAEYLKGVFDQAGIPAQIFALDPKRSNVVARLKGNGKKRPILIMGHSDVVTVDESKWKFPPFSATRDGGWVYARGTVDDKDNLTGALMTMLLLKRYRVPLDRDVIFLSEAGEEGSSNIGMQFMVNQHYPEIEAEYCLAEGGGAIRIGGVAKYTTVETLEKIPRGIELVAHGISGHGSIPLKSNAIVHLAGAVSRVGQWRPEIRFNETTGTYFRGLANLAAPETAKHYRDVLSTDPKLRAAADQWLFENEPLHSSMLRTSVSPNIFSGGYRSNVIPSEAKATLDVRALPDEDPAKFLDQVKTVVNDPAVDVHFTAQNVRPAAFDARLDSEAYKVLEAAATRIYNTITLPTMQTGGTDMAPLRARGVQCFGIGAAVDMEDGPKGFGMHSDQERLLESELYRFVRYNYEVVVDLARAK

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
133 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
134 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
135 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
136 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
137 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
138 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
139 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
140 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
141 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
142 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
146 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
147 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
148 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
151 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
152 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
158 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
159 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
167 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
200 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
201 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
214 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
215 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
216 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
219 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
220 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
221 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.37
Nodule 0
Rhizoplane 3.23
Rhizosphere 94.18
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10091972 3300005293 Bacteria 5421
2 Ga0065715_10115557 3300005293 Bacteria 2411
3 Ga0065707_10082352 3300005295 Bacteria 16346
4 Ga0070658_10008305 3300005327 Bacteria 8352
5 Ga0070676_10048393 3300005328 Bacteria 2485
6 Ga0070690_100006917 3300005330 Bacteria 6456
7 Ga0070670_100091053 3300005331 Unclassified 2621
8 Ga0070666_10046442 3300005335 Bacteria 2913
9 Ga0070666_10066507 3300005335 Bacteria 2446
10 Ga0070666_10110850 3300005335 Unclassified 1898
11 Ga0070682_100122433 3300005337 Bacteria 1749
12 Ga0068868_100014078 3300005338 Bacteria 5888
13 Ga0068868_100034116 3300005338 Bacteria 3927
14 Ga0070660_100013634 3300005339 Bacteria 5840
15 Ga0070689_100037384 3300005340 Bacteria 3712
16 Ga0070687_100050345 3300005343 Bacteria 2151
17 Ga0070669_100009133 3300005353 Bacteria 7067
18 Ga0070675_100007938 3300005354 Bacteria 8225
19 Ga0070671_100010629 3300005355 Bacteria 7387
20 Ga0070671_100143954 3300005355 Bacteria 2012
21 Ga0070674_100007478 3300005356 Bacteria 6444
22 Ga0070674_100122162 3300005356 Bacteria 1929
23 Ga0070667_100016256 3300005367 Bacteria 6155
24 Ga0070667_100101732 3300005367 Unclassified 2483
25 Ga0070705_100000329 3300005440 Bacteria 28073
26 Ga0070700_100015237 3300005441 Bacteria 4357
27 Ga0070694_100001716 3300005444 Bacteria 12917
28 Ga0070694_100010648 3300005444 Bacteria 5680
29 Ga0070694_100013666 3300005444 Bacteria 5074
30 Ga0070708_100072369 3300005445 Unclassified 3106
31 Ga0070708_100308637 3300005445 Bacteria 1490
32 Ga0070678_100154005 3300005456 Bacteria 1855
33 Ga0070678_100196193 3300005456 Bacteria 1663
34 Ga0070681_10046606 3300005458 Bacteria 4334
35 Ga0068867_100007917 3300005459 Bacteria 7505
36 Ga0068867_100077138 3300005459 Unclassified 2503
37 Ga0070706_100069396 3300005467 Bacteria 3260
38 Ga0070707_100020367 3300005468 Bacteria 6255
39 Ga0070707_100126292 3300005468 Bacteria 2485
40 Ga0070707_100164376 3300005468 Bacteria 2163
41 Ga0070698_100012074 3300005471 Bacteria 9159
42 Ga0070698_100042148 3300005471 Bacteria 4682
43 Ga0070699_100007611 3300005518 Bacteria 9416
44 Ga0070699_100021397 3300005518 Bacteria 5578
45 Ga0070699_100028472 3300005518 Bacteria 4818
46 Ga0070699_100075079 3300005518 Unclassified 2942
47 Ga0070699_100106478 3300005518 Bacteria 2460
48 Ga0070679_100077773 3300005530 Bacteria 3307
49 Ga0070672_100021691 3300005543 Bacteria 4703
50 Ga0070672_100160772 3300005543 Bacteria 1863
51 Ga0070686_100001727 3300005544 Bacteria 12210
52 Ga0070695_100000033 3300005545 Bacteria 52528
53 Ga0070695_100003168 3300005545 Bacteria 9596
54 Ga0070696_100033220 3300005546 Bacteria 3543
55 Ga0070696_100072567 3300005546 Bacteria 2424
56 Ga0070696_100089856 3300005546 Bacteria 2184
57 Ga0070665_100001095 3300005548 Bacteria 33482
58 Ga0070665_100071073 3300005548 Bacteria 3487
59 Ga0070665_100175919 3300005548 Bacteria 2141
60 Ga0070704_100009051 3300005549 Bacteria 6005
61 Ga0070704_100011727 3300005549 Bacteria 5386
62 Ga0070704_100079924 3300005549 Bacteria 2404
63 Ga0068855_100005232 3300005563 Bacteria 15826
64 Ga0068855_100182968 3300005563 Bacteria 2368
65 Ga0070664_100160365 3300005564 Bacteria 1990
66 Ga0068856_100037359 3300005614 Bacteria 4766
67 Ga0070702_100016960 3300005615 Bacteria 3748
68 Ga0070702_100037488 3300005615 Bacteria 2693
69 Ga0070702_100074888 3300005615 Bacteria 2010
70 Ga0068852_100009563 3300005616 Bacteria 7201
71 Ga0068859_100021903 3300005617 Bacteria 6407
72 Ga0068864_100064805 3300005618 Bacteria 3169
73 Ga0068866_10009186 3300005718 Bacteria 4189
74 Ga0068866_10026567 3300005718 Bacteria 2736
75 Ga0068861_100012800 3300005719 Bacteria 5858
76 Ga0068861_100076040 3300005719 Bacteria 2615
77 Ga0068861_100082741 3300005719 Bacteria 2516
78 Ga0068863_100008040 3300005841 Bacteria 10300
79 Ga0068863_100154265 3300005841 Bacteria 2199
80 Ga0068858_100001924 3300005842 Bacteria 21167
81 Ga0068858_100028072 3300005842 Bacteria 5229
82 Ga0068858_100030803 3300005842 Bacteria 4982
83 Ga0068860_100042189 3300005843 Bacteria 4358
84 Ga0068862_100001200 3300005844 Bacteria 24448
85 Ga0068862_100057396 3300005844 Bacteria 3338
86 Ga0068862_100058329 3300005844 Bacteria 3311
87 Ga0081455_10020786 3300005937 Bacteria 6170
88 Ga0081455_10023391 3300005937 Bacteria 5750
89 Ga0081538_10068298 3300005981 Bacteria 1977
90 Ga0081539_10016502 3300005985 Bacteria 5266
91 Ga0075364_10007817 3300006051 Bacteria 6366
92 Ga0075362_10003580 3300006177 Bacteria 5457
93 Ga0075367_10002473 3300006178 Bacteria 8458
94 Ga0075366_10003024 3300006195 Bacteria 8774
95 Ga0097621_100071245 3300006237 Bacteria 2872
96 Ga0097621_100173973 3300006237 Bacteria 1857
97 Ga0068871_100003670 3300006358 Bacteria 10554
98 Ga0068871_100036037 3300006358 Bacteria 3936
99 Ga0068871_100089043 3300006358 Bacteria 2569
100 Ga0075428_100000019 3300006844 Bacteria 137803
101 Ga0075428_100002764 3300006844 Bacteria 19110
102 Ga0075428_100034183 3300006844 Bacteria 5608
103 Ga0075428_100057678 3300006844 Bacteria 4250
104 Ga0075430_100003635 3300006846 Bacteria 12938
105 Ga0075430_100071235 3300006846 Bacteria 2916
106 Ga0075430_100121042 3300006846 Bacteria 2182
107 Ga0075431_100002890 3300006847 Bacteria 16623
108 Ga0075431_100012771 3300006847 Bacteria 8479
109 Ga0075431_100029103 3300006847 Bacteria 5683
110 Ga0075431_100083175 3300006847 Unclassified 3304
111 Ga0075431_100091906 3300006847 Bacteria 3132
112 Ga0075433_10008665 3300006852 Bacteria 8113
113 Ga0075433_10108131 3300006852 Bacteria 2466
114 Ga0075433_10122667 3300006852 Bacteria 2308
115 Ga0075433_10254740 3300006852 Unclassified 1557
116 Ga0075434_100000263 3300006871 Bacteria 37265
117 Ga0075434_100003861 3300006871 Bacteria 13401
118 Ga0075434_100179460 3300006871 Bacteria 2137
119 Ga0075429_100111197 3300006880 Bacteria 2394
120 Ga0068865_100001376 3300006881 Bacteria 14151
121 Ga0075436_100003783 3300006914 Bacteria 10374
122 Ga0075436_100009542 3300006914 Bacteria 6643
123 Ga0097620_100021903 3300006931 Bacteria 6407
124 Ga0075435_100000006 3300007076 Bacteria 119843
125 Ga0075435_100004562 3300007076 Bacteria 9527
126 Ga0075435_100028994 3300007076 Bacteria 4343
127 Ga0075435_100042263 3300007076 Bacteria 3646
128 Ga0075435_100043864 3300007076 Bacteria 3581
129 Ga0105240_10000682 3300009093 Bacteria 62492
130 Ga0105240_10011382 3300009093 Bacteria 12392
131 Ga0105240_10170724 3300009093 Bacteria 2576
132 Ga0111539_10000002 3300009094 Bacteria 983359
133 Ga0111539_10020537 3300009094 Bacteria 8134
134 Ga0111539_10044411 3300009094 Bacteria 5324
135 Ga0111539_10078188 3300009094 Bacteria 3893
136 Ga0105245_10001473 3300009098 Bacteria 21251
137 Ga0105245_10025270 3300009098 Bacteria 5222
138 Ga0105245_10089932 3300009098 Bacteria 2823
139 Ga0105245_10106856 3300009098 Bacteria 2598
140 Ga0105247_10005697 3300009101 Bacteria 7802
141 Ga0105247_10022129 3300009101 Bacteria 3827
142 Ga0114129_10002572 3300009147 Bacteria 25214
143 Ga0114129_10006237 3300009147 Bacteria 16900
144 Ga0114129_10007177 3300009147 Bacteria 15859
145 Ga0114129_10008163 3300009147 Bacteria 14918
146 Ga0114129_10008560 3300009147 Bacteria 14583
147 Ga0114129_10010213 3300009147 Bacteria 13386
148 Ga0114129_10013015 3300009147 Bacteria 11850
149 Ga0114129_10039244 3300009147 Bacteria 6675
150 Ga0114129_10052812 3300009147 Bacteria 5703
151 Ga0114129_10087445 3300009147 Bacteria 4321
152 Ga0114129_10090778 3300009147 Bacteria 4234
153 Ga0114129_10093237 3300009147 Bacteria 4171
154 Ga0114129_10120476 3300009147 Bacteria 3612
155 Ga0114129_10154661 3300009147 Bacteria 3137
156 Ga0114129_10225996 3300009147 Bacteria 2523
157 Ga0114129_10328726 3300009147 Bacteria 2030
158 Ga0105243_10029586 3300009148 Bacteria 4213
159 Ga0105243_10056077 3300009148 Bacteria 3132
160 Ga0105241_10013219 3300009174 Bacteria 6051
161 Ga0105241_10041644 3300009174 Bacteria 3472
162 Ga0105242_10010353 3300009176 Bacteria 7152
163 Ga0105242_10036409 3300009176 Bacteria 3948
164 Ga0105242_10146453 3300009176 Bacteria 2055
165 Ga0105248_10003165 3300009177 Bacteria 18226
166 Ga0105248_10006231 3300009177 Bacteria 13077
167 Ga0105248_10015101 3300009177 Bacteria 8506
168 Ga0105248_10082831 3300009177 Bacteria 3609
169 Ga0105248_10150429 3300009177 Unclassified 2626
170 Ga0105237_10045227 3300009545 Bacteria 4432
171 Ga0105237_10123964 3300009545 Bacteria 2578
172 Ga0105238_10011900 3300009551 Bacteria 8766
173 Ga0105238_10154448 3300009551 Bacteria 2270
174 Ga0105249_10175770 3300009553 Unclassified 2080
175 Ga0105249_10238820 3300009553 Unclassified 1796
176 Ga0105239_10041783 3300010375 Bacteria 5025
177 Ga0105239_10066681 3300010375 Bacteria 3954
178 Ga0105239_10177059 3300010375 Bacteria 2386
179 Ga0105246_10015120 3300011119 Bacteria 4866
180 Ga0157370_10006104 3300013104 Bacteria 13370
181 Ga0157374_10023770 3300013296 Bacteria 5487
182 Ga0157378_10005959 3300013297 Bacteria 10683
183 Ga0157378_10022159 3300013297 Bacteria 5590
184 Ga0163162_10001082 3300013306 Bacteria 25244
185 Ga0163162_10042323 3300013306 Bacteria 4559
186 Ga0163162_10170923 3300013306 Bacteria 2298
187 Ga0157372_10164379 3300013307 Bacteria 2566
188 Ga0157375_10006173 3300013308 Bacteria 10442
189 Ga0157375_10112476 3300013308 Bacteria 2823
190 Ga0157375_10195871 3300013308 Bacteria 2176
191 Ga0163163_10002582 3300014325 Bacteria 15349
192 Ga0163163_10011323 3300014325 Bacteria 8086
193 Ga0163163_10088335 3300014325 Bacteria 3111
194 Ga0157380_10095627 3300014326 Bacteria 2461
195 Ga0157380_10192491 3300014326 Bacteria 1802
196 Ga0157379_10009189 3300014968 Bacteria 8609
197 Ga0157379_10051109 3300014968 Unclassified 3692
198 Ga0157379_10160627 3300014968 Unclassified 2028
199 Ga0157376_10073067 3300014969 Bacteria 2920
200 Ga0157376_10104329 3300014969 Bacteria 2484
201 Ga0207710_10008987 3300025900 Bacteria 4205
202 Ga0207645_10003840 3300025907 Bacteria 11249
203 Ga0207707_10079151 3300025912 Bacteria 2870
204 Ga0207707_10131760 3300025912 Bacteria 2186
205 Ga0207695_10004343 3300025913 Bacteria 19414
206 Ga0207695_10006298 3300025913 Bacteria 15447
207 Ga0207695_10032557 3300025913 Bacteria 5703
208 Ga0207662_10061149 3300025918 Unclassified 2261
209 Ga0207646_10165232 3300025922 Bacteria 1998
210 Ga0207681_10007100 3300025923 Bacteria 6867
211 Ga0207681_10028375 3300025923 Bacteria 3625
212 Ga0207681_10061031 3300025923 Bacteria 2590
213 Ga0207681_10102961 3300025923 Bacteria 2062
214 Ga0207694_10026969 3300025924 Bacteria 4374
215 Ga0207694_10027323 3300025924 Unclassified 4345
216 Ga0207694_10031474 3300025924 Bacteria 4053
217 Ga0207687_10001474 3300025927 Bacteria 16144
218 Ga0207687_10104451 3300025927 Bacteria 2091
219 Ga0207644_10013110 3300025931 Bacteria 5518
220 Ga0207644_10040509 3300025931 Bacteria 3292
221 Ga0207686_10026934 3300025934 Unclassified 3360
222 Ga0207686_10055490 3300025934 Bacteria 2486
223 Ga0207686_10058431 3300025934 Bacteria 2431
224 Ga0207709_10145412 3300025935 Bacteria 1635
225 Ga0207670_10024450 3300025936 Bacteria 3775
226 Ga0207669_10017958 3300025937 Unclassified 3643
227 Ga0207669_10107368 3300025937 Bacteria 1862
228 Ga0207704_10028146 3300025938 Bacteria 3113
229 Ga0207691_10007906 3300025940 Bacteria 10240
230 Ga0207691_10010269 3300025940 Bacteria 8981
231 Ga0207711_10006875 3300025941 Bacteria 9553
232 Ga0207711_10034721 3300025941 Bacteria 4271
233 Ga0207711_10074376 3300025941 Bacteria 2954
234 Ga0207711_10083338 3300025941 Unclassified 2797
235 Ga0207711_10093849 3300025941 Bacteria 2644
236 Ga0207711_10095824 3300025941 Unclassified 2618
237 Ga0207667_10004233 3300025949 Bacteria 17618
238 Ga0207712_10081419 3300025961 Unclassified 2358
239 Ga0207712_10177497 3300025961 Bacteria 1670
240 Ga0207668_10063951 3300025972 Bacteria 2598
241 Ga0207668_10107761 3300025972 Bacteria 2084
242 Ga0207668_10119665 3300025972 Bacteria 1992
243 Ga0207640_10017309 3300025981 Bacteria 4216
244 Ga0207640_10055516 3300025981 Bacteria 2595
245 Ga0207658_10012919 3300025986 Bacteria 5703
246 Ga0207658_10100710 3300025986 Unclassified 2262
247 Ga0207677_10126394 3300026023 Bacteria 1933
248 Ga0207677_10240790 3300026023 Unclassified 1463
249 Ga0207703_10001690 3300026035 Bacteria 19847
250 Ga0207703_10017681 3300026035 Bacteria 5566
251 Ga0207703_10093454 3300026035 Bacteria 2533
252 Ga0207708_10052075 3300026075 Bacteria 3118
253 Ga0207708_10209208 3300026075 Unclassified 1559
254 Ga0207702_10092113 3300026078 Bacteria 2656
255 Ga0207641_10017923 3300026088 Bacteria 5800
256 Ga0207648_10008701 3300026089 Bacteria 9791
257 Ga0207648_10088849 3300026089 Bacteria 2698
258 Ga0207648_10118051 3300026089 Bacteria 2331
259 Ga0207676_10006605 3300026095 Bacteria 8204
260 Ga0207676_10075371 3300026095 Bacteria 2721
261 Ga0207676_10094987 3300026095 Bacteria 2458
262 Ga0207675_100004263 3300026118 Bacteria 13834
263 Ga0207675_100011699 3300026118 Bacteria 8206
264 Ga0207675_100138737 3300026118 Bacteria 2309
265 Ga0207683_10044666 3300026121 Unclassified 3874
266 Ga0207683_10057256 3300026121 Bacteria 3421
267 Ga0207698_10089845 3300026142 Bacteria 2510
268 Ga0207428_10000004 3300027907 Bacteria 727800
269 Ga0207428_10023973 3300027907 Bacteria 5125
270 Ga0268266_10010020 3300028379 Bacteria 8316
271 Ga0268266_10020532 3300028379 Bacteria 5630
272 Ga0268266_10194039 3300028379 Bacteria 1855
273 Ga0268266_10194947 3300028379 Bacteria 1851
274 Ga0268265_10004951 3300028380 Bacteria 9155
275 Ga0268265_10011257 3300028380 Bacteria 6048
276 Ga0268265_10021175 3300028380 Bacteria 4550
277 Ga0307408_100023634 3300031548 Bacteria 4190
278 Ga0307408_100028957 3300031548 Bacteria 3832
279 Ga0265314_10002638 3300031711 Bacteria 18054
280 Ga0307413_10045461 3300031824 Bacteria 2603
281 Ga0307413_10077520 3300031824 Bacteria 2117
282 Ga0307416_100092952 3300032002 Unclassified 2597
283 Ga0307414_10096430 3300032004 Unclassified 2213
284 Ga0373930_0000287 3300034816 Bacteria 6450
285 Ga0373948_0002828 3300034817 Bacteria 2606
286 Ga0373950_0000334 3300034818 Bacteria 5939
287 Ga0373958_0008318 3300034819 Unclassified 1678
288 Ga0373938_0000205 3300034957 Bacteria 8934
289 Ga0373928_0000652 3300035084 Bacteria 6823
290 Ga0373929_0001227 3300035085 Bacteria 4958
291 Ga0373940_0001976 3300035088 Bacteria 3874
292 Ga0373949_0000454 3300035090 Bacteria 14136
293 Ga0373951_0001177 3300035091 Bacteria 6915
294 Ga0373951_0019588 3300035091 Bacteria 1543
295 Ga0373952_0002265 3300035092 Bacteria 3466
296 Ga0373932_0001500 3300035112 Bacteria 6493
297 Ga0373932_0010995 3300035112 Bacteria 2203
298 Ga0373936_0015317 3300035113 Bacteria 2938
299 Ga0373939_0004947 3300035114 Bacteria 3164
300 Ga0373941_0000148 3300035115 Bacteria 12522
301 Ga0373956_0037806 3300035119 Bacteria 2134
302 Ga0373960_0000908 3300035121 Bacteria 6290
303 Ga0373960_0020799 3300035121 Bacteria 1738
304 Ga0373946_0009574 3300035171 Bacteria 3572
305 Ga0373942_0000134 3300035207 Bacteria 17539
306 Ga0373961_0000639 3300035241 Bacteria 12664
307 Ga0373962_0001584 3300035242 Bacteria 5395
308 Ga0373931_0015092 3300035691 Bacteria 3785
309 Ga0373933_0058821 3300035724 Bacteria 2313
310 Ga0373947_0012629 3300035725 Bacteria 4843
311 Ga0373937_0287254 3300036401 Bacteria 1554
312 Ga0439453_0002413 3300041408 Bacteria 2578
313 Ga0439464_0005008 3300042439 Bacteria 3406
314 Ga0439460_0006862 3300042461 Bacteria 2836
315 Ga0451576_0013724 3300045051 Bacteria 9049
316 Ga0451576_0138669 3300045051 Bacteria 2537
317 Ga0495592_0057758 3300046454 Bacteria 2864
318 Ga0495603_0058638 3300046455 Bacteria 2276
319 Ga0495629_0076746 3300046459 Bacteria 2333
320 Ga0495638_0013604 3300046460 Bacteria 5530
321 Ga0495582_0089553 3300046473 Bacteria 1715
322 Ga0495662_0082837 3300046476 Bacteria 1561
323 Ga0495664_0078023 3300046477 Bacteria 1984
324 Ga0495608_0007747 3300046511 Bacteria 7562
325 Ga0495628_0076259 3300046516 Bacteria 2609
326 Ga0495630_0005516 3300046517 Bacteria 8925
327 Ga0495642_0038993 3300046528 Bacteria 1926
328 Ga0495640_0166920 3300046533 Bacteria 1408
329 Ga0495586_0016945 3300046535 Bacteria 3875
330 Ga0495587_0015382 3300046536 Bacteria 4781
331 Ga0495645_0004139 3300046543 Bacteria 9909
332 Ga0495645_0020873 3300046543 Bacteria 4733
333 Ga0495645_0021928 3300046543 Bacteria 4619
334 Ga0495667_0014888 3300046559 Bacteria 5255
335 Ga0495625_0015060 3300046660 Bacteria 6141
336 Ga0495635_0076057 3300046663 Bacteria 2301
337 Ga0495647_0015207 3300046681 Bacteria 2693
338 Ga0495658_0070407 3300046683 Bacteria 2029
339 Ga0495658_0151935 3300046683 Bacteria 1423
340 Ga0495613_0001419 3300046689 Bacteria 18267
341 Ga0495613_0060876 3300046689 Bacteria 2765
342 Ga0495613_0133265 3300046689 Unclassified 1779
343 Ga0495600_0022432 3300046809 Bacteria 4053
344 Ga0495604_0025341 3300047317 Bacteria 4726
345 Ga0495636_0017022 3300047318 Bacteria 2907
346 Ga0495674_0026054 3300047319 Bacteria 5352
347 Ga0495674_0141333 3300047319 Bacteria 2023
348 Ga0495684_0000535 3300047471 Bacteria 30870
349 Ga0496104_0009794 3300048907 Bacteria 8544
350 Ga0496104_0061383 3300048907 Bacteria 3564
351 Ga0496104_0134450 3300048907 Bacteria 2376
352 Ga0496106_0075800 3300048909 Bacteria 2577
353 Ga0496108_0009554 3300048911 Bacteria 7863
354 Ga0496108_0071750 3300048911 Bacteria 2923
355 Ga0496110_0062907 3300048913 Bacteria 3279
356 Ga0496112_0006268 3300048915 Bacteria 10428
357 Ga0496112_0330706 3300048915 Unclassified 1468
358 Ga0496113_0054153 3300048916 Bacteria 3002
359 Ga0496114_0058787 3300048917 Bacteria 3211
360 Ga0496114_0095886 3300048917 Bacteria 2525
361 Ga0496115_0066056 3300048918 Bacteria 2923
362 Ga0496118_0082357 3300048921 Bacteria 2255
363 Ga0501039_0027337 3300049575 Bacteria 4387
364 Ga0501071_0069116 3300049587 Bacteria 2571
365 Ga0501076_0018289 3300049592 Bacteria 5340
366 nmdc:mga00v17_13810_c1 3300050491 Bacteria 4491
367 nmdc:mga0k408_14691_c1 3300050493 Bacteria 4319
368 nmdc:mga06z11_15651_c1 3300050494 Bacteria 3391
369 nmdc:mga05p37_142569_c1 3300050507 Bacteria 2935
370 nmdc:mga05p37_14868_c1 3300050507 Bacteria 9348
371 nmdc:mga05p37_159228_c1 3300050507 Bacteria 2758
372 nmdc:mga05p37_198142_c1 3300050507 Bacteria 2434
373 nmdc:mga05p37_252439_c1 3300050507 Unclassified 2115
374 nmdc:mga05p37_30157_c1 3300050507 Bacteria 6617
375 nmdc:mga05p37_313201_c1 3300050507 Unclassified 1860
376 nmdc:mga05p37_4190_c1 3300050507 Bacteria 16851
377 nmdc:mga05p37_4748_c1 3300050507 Bacteria 15879
378 nmdc:mga05p37_7044_c1 3300050507 Bacteria 13253
379 nmdc:mga05p37_73403_c1 3300050507 Bacteria 4211
380 nmdc:mga05p37_77033_c1 3300050507 Unclassified 4105
381 nmdc:mga05p37_84859_c1 3300050507 Bacteria 3902
382 nmdc:mga09592_106332_c1 3300050508 Bacteria 2406
383 nmdc:mga09592_63077_c1 3300050508 Bacteria 3135
384 nmdc:mga0qj67_1336_c1 3300050509 Bacteria 17299
385 nmdc:mga06r32_57733_c1 3300050510 Bacteria 3728
386 nmdc:mga06r32_58747_c1 3300050510 Bacteria 3697
387 nmdc:mga06r32_87217_c1 3300050510 Bacteria 3045
388 nmdc:mga08y16_169526_c1 3300050511 Unclassified 2267
389 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
390 nmdc:mga08y16_4936_c1 3300050511 Bacteria 13938
391 nmdc:mga08y16_93932_c1 3300050511 Bacteria 3125
392 nmdc:mga0n895_15_c1 3300050512 Bacteria 102361
393 nmdc:mga0rr50_15_c1 3300050513 Bacteria 189079
394 nmdc:mga0rr50_17685_c1 3300050513 Bacteria 4767
395 nmdc:mga0rr50_34769_c1 3300050513 Bacteria 3612
396 nmdc:mga0rr50_6174_c1 3300050513 Bacteria 7258
397 nmdc:mga08x19_16873_c1 3300050514 Bacteria 4460
398 nmdc:mga0a205_145295_c1 3300050515 Bacteria 2272
399 nmdc:mga0a205_80422_c1 3300050515 Bacteria 3149
400 nmdc:mga0a205_90561_c1 3300050515 Bacteria 2956
401 Ga0495601_0010916 3300053077 Bacteria 5421
402 Ga0495601_0011933 3300053077 Bacteria 5208
403 Ga0495601_0074628 3300053077 Bacteria 2170
404 Ga0495619_0040016 3300053085 Bacteria 3063
405 Ga0495619_0112338 3300053085 Bacteria 1863
406 Ga0500641_0030445 3300053096 Bacteria 2121
407 Ga0500555_000614 3300053103 Bacteria 13798
408 Ga0500588_0024456 3300053146 Unclassified 1667
409 Ga0500616_0005583 3300053153 Bacteria 8499
410 Ga0501084_0153123 3300054114 Unclassified 1944
411 Ga0590071_000017 3300059421 Bacteria 43985
412 Ga0590074_001505 3300059423 Bacteria 3769
413 Ga0590075_000326 3300059424 Bacteria 13233
414 Ga0590075_011606 3300059424 Bacteria 2132
415 Ga0590077_000494 3300059426 Bacteria 11023

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005981 Ga0081538_10068298 Ga0081538_100682982 386
2 3300046683 Ga0495658_0151935 Ga0495658_0151935_11_1306 430
3 3300053096 Ga0500641_0030445 Ga0500641_0030445_798_2108 430
4 3300036401 Ga0373937_0287254 Ga0373937_0287254_11_1375 432
5 3300005444 Ga0070694_100010648 Ga0070694_1000106485 433
6 3300005444 Ga0070694_100013666 Ga0070694_1000136662 433
7 3300005471 Ga0070698_100012074 Ga0070698_1000120747 433
8 3300005518 Ga0070699_100021397 Ga0070699_1000213975 433
9 3300005545 Ga0070695_100003168 Ga0070695_1000031683 433
10 3300005546 Ga0070696_100033220 Ga0070696_1000332203 433
11 3300005549 Ga0070704_100009051 Ga0070704_1000090514 433
12 3300005355 Ga0070671_100010629 Ga0070671_1000106294 435
13 3300005367 Ga0070667_100016256 Ga0070667_1000162564 435
14 3300005543 Ga0070672_100021691 Ga0070672_1000216914 435
15 3300005843 Ga0068860_100042189 Ga0068860_1000421893 435
16 3300009177 Ga0105248_10003165 Ga0105248_100031652 435
17 3300013306 Ga0163162_10042323 Ga0163162_100423234 435
18 3300014968 Ga0157379_10051109 Ga0157379_100511093 435
19 3300025931 Ga0207644_10013110 Ga0207644_100131104 435
20 3300025940 Ga0207691_10007906 Ga0207691_100079066 435
21 3300025941 Ga0207711_10083338 Ga0207711_100833383 435
22 3300025986 Ga0207658_10100710 Ga0207658_101007101 435
23 3300005293 Ga0065715_10115557 Ga0065715_101155572 436
24 3300005353 Ga0070669_100009133 Ga0070669_1000091333 436
25 3300005844 Ga0068862_100001200 Ga0068862_10000120010 436
26 3300025923 Ga0207681_10007100 Ga0207681_100071004 436
27 3300028380 Ga0268265_10004951 Ga0268265_100049513 436
28 3300050507 nmdc:mga05p37_4190_c1 nmdc:mga05p37_4190_c1_24_1334 436
29 3300050511 nmdc:mga08y16_4936_c1 nmdc:mga08y16_4936_c1_7411_8826 436
30 3300005440 Ga0070705_100000329 Ga0070705_10000032912 437
31 3300005444 Ga0070694_100001716 Ga0070694_1000017164 437
32 3300005548 Ga0070665_100001095 Ga0070665_10000109520 437
33 3300005615 Ga0070702_100037488 Ga0070702_1000374882 437
34 3300009177 Ga0105248_10082831 Ga0105248_100828313 437
35 3300028379 Ga0268266_10010020 Ga0268266_100100207 437
36 3300046533 Ga0495640_0166920 Ga0495640_0166920_13_1329 437
37 3300005545 Ga0070695_100000033 Ga0070695_10000003334 438
38 3300009147 Ga0114129_10013015 Ga0114129_100130153 439
39 3300050507 nmdc:mga05p37_84859_c1 nmdc:mga05p37_84859_c1_1344_2810 439
40 3300005615 Ga0070702_100074888 Ga0070702_1000748882 440
41 3300013296 Ga0157374_10023770 Ga0157374_100237703 443
42 3300005841 Ga0068863_100008040 Ga0068863_1000080406 446
43 3300026088 Ga0207641_10017923 Ga0207641_100179233 446
44 3300046528 Ga0495642_0038993 Ga0495642_0038993_375_1823 447
45 3300047318 Ga0495636_0017022 Ga0495636_0017022_20_1468 447
46 3300005456 Ga0070678_100196193 Ga0070678_1001961931 448
47 3300005548 Ga0070665_100175919 Ga0070665_1001759192 448
48 3300005844 Ga0068862_100057396 Ga0068862_1000573962 448
49 3300006358 Ga0068871_100003670 Ga0068871_1000036707 448
50 3300006881 Ga0068865_100001376 Ga0068865_1000013769 448
51 3300009176 Ga0105242_10036409 Ga0105242_100364092 448
52 3300014969 Ga0157376_10104329 Ga0157376_101043292 448
53 3300025934 Ga0207686_10055490 Ga0207686_100554902 448
54 3300025938 Ga0207704_10028146 Ga0207704_100281462 448
55 3300026089 Ga0207648_10088849 Ga0207648_100888492 448
56 3300026121 Ga0207683_10057256 Ga0207683_100572561 448
57 3300031548 Ga0307408_100028957 Ga0307408_1000289572 448
58 3300031824 Ga0307413_10045461 Ga0307413_100454612 448
59 3300005354 Ga0070675_100007938 Ga0070675_1000079389 449
60 3300009147 Ga0114129_10087445 Ga0114129_100874453 449
61 3300025972 Ga0207668_10063951 Ga0207668_100639512 449
62 3300053077 Ga0495601_0011933 Ga0495601_0011933_111_1553 449
63 3300005842 Ga0068858_100028072 Ga0068858_1000280723 451
64 3300009101 Ga0105247_10005697 Ga0105247_100056976 451
65 3300009177 Ga0105248_10006231 Ga0105248_100062312 451
66 3300014968 Ga0157379_10009189 Ga0157379_100091892 451
67 3300025900 Ga0207710_10008987 Ga0207710_100089874 451
68 3300035112 Ga0373932_0010995 Ga0373932_0010995_525_1934 451
69 3300048915 Ga0496112_0006268 Ga0496112_0006268_4077_5543 451
70 3300006852 Ga0075433_10108131 Ga0075433_101081312 452
71 3300006914 Ga0075436_100009542 Ga0075436_1000095422 452
72 3300009176 Ga0105242_10036409 Ga0105242_100364093 452
73 3300034816 Ga0373930_0000287 Ga0373930_0000287_1483_2898 452
74 3300034818 Ga0373950_0000334 Ga0373950_0000334_14_1429 452
75 3300034819 Ga0373958_0008318 Ga0373958_0008318_61_1497 452
76 3300034957 Ga0373938_0000205 Ga0373938_0000205_7001_8416 452
77 3300035084 Ga0373928_0000652 Ga0373928_0000652_4166_5581 452
78 3300035088 Ga0373940_0001976 Ga0373940_0001976_14_1429 452
79 3300035090 Ga0373949_0000454 Ga0373949_0000454_4797_6212 452
80 3300035091 Ga0373951_0001177 Ga0373951_0001177_85_1500 452
81 3300035092 Ga0373952_0002265 Ga0373952_0002265_52_1467 452
82 3300035112 Ga0373932_0001500 Ga0373932_0001500_4519_5934 452
83 3300035114 Ga0373939_0004947 Ga0373939_0004947_123_1538 452
84 3300035121 Ga0373960_0020799 Ga0373960_0020799_236_1651 452
85 3300035207 Ga0373942_0000134 Ga0373942_0000134_13540_14955 452
86 3300035241 Ga0373961_0000639 Ga0373961_0000639_5832_7247 452
87 3300035242 Ga0373962_0001584 Ga0373962_0001584_1103_2518 452
88 3300050510 nmdc:mga06r32_57733_c1 nmdc:mga06r32_57733_c1_251_1645 452
89 3300050515 nmdc:mga0a205_80422_c1 nmdc:mga0a205_80422_c1_1043_2458 452
90 3300050515 nmdc:mga0a205_90561_c1 nmdc:mga0a205_90561_c1_1248_2615 452
91 3300007076 Ga0075435_100043864 Ga0075435_1000438644 453
92 3300009094 Ga0111539_10020537 Ga0111539_100205376 453
93 3300045051 Ga0451576_0013724 Ga0451576_0013724_2876_4291 453
94 3300005330 Ga0070690_100006917 Ga0070690_1000069177 454
95 3300005468 Ga0070707_100164376 Ga0070707_1001643762 454
96 3300005544 Ga0070686_100001727 Ga0070686_1000017278 454
97 3300005937 Ga0081455_10020786 Ga0081455_100207863 454
98 3300025922 Ga0207646_10165232 Ga0207646_101652322 454
99 3300026118 Ga0207675_100138737 Ga0207675_1001387372 454
100 3300035115 Ga0373941_0000148 Ga0373941_0000148_8109_9524 454
101 3300050513 nmdc:mga0rr50_34769_c1 nmdc:mga0rr50_34769_c1_2053_3456 454
102 3300005468 Ga0070707_100020367 Ga0070707_1000203676 455
103 3300046683 Ga0495658_0070407 Ga0495658_0070407_599_2014 455
104 3300005719 Ga0068861_100082741 Ga0068861_1000827412 456
105 3300009093 Ga0105240_10170724 Ga0105240_101707242 456
106 3300009147 Ga0114129_10093237 Ga0114129_100932374 456
107 3300009553 Ga0105249_10238820 Ga0105249_102388202 456
108 3300025981 Ga0207640_10055516 Ga0207640_100555162 456
109 3300031824 Ga0307413_10077520 Ga0307413_100775201 456
110 3300032004 Ga0307414_10096430 Ga0307414_100964302 456
111 3300046455 Ga0495603_0058638 Ga0495603_0058638_851_2263 456
112 3300050507 nmdc:mga05p37_142569_c1 nmdc:mga05p37_142569_c1_1430_2815 456
113 3300050513 nmdc:mga0rr50_34769_c1 nmdc:mga0rr50_34769_c1_635_2047 456
114 3300005327 Ga0070658_10008305 Ga0070658_100083057 457
115 3300005339 Ga0070660_100013634 Ga0070660_1000136346 457
116 3300005459 Ga0068867_100007917 Ga0068867_1000079172 457
117 3300005563 Ga0068855_100005232 Ga0068855_10000523215 457
118 3300005563 Ga0068855_100182968 Ga0068855_1001829681 457
119 3300005614 Ga0068856_100037359 Ga0068856_1000373591 457
120 3300005616 Ga0068852_100009563 Ga0068852_1000095636 457
121 3300005718 Ga0068866_10009186 Ga0068866_100091863 457
122 3300006358 Ga0068871_100089043 Ga0068871_1000890432 457
123 3300009093 Ga0105240_10000682 Ga0105240_1000068233 457
124 3300009098 Ga0105245_10001473 Ga0105245_100014734 457
125 3300009098 Ga0105245_10025270 Ga0105245_100252703 457
126 3300009174 Ga0105241_10013219 Ga0105241_100132192 457
127 3300009174 Ga0105241_10041644 Ga0105241_100416444 457
128 3300009545 Ga0105237_10045227 Ga0105237_100452272 457
129 3300009551 Ga0105238_10011900 Ga0105238_100119007 457
130 3300009551 Ga0105238_10154448 Ga0105238_101544482 457
131 3300010375 Ga0105239_10066681 Ga0105239_100666813 457
132 3300010375 Ga0105239_10177059 Ga0105239_101770592 457
133 3300011119 Ga0105246_10015120 Ga0105246_100151204 457
134 3300013104 Ga0157370_10006104 Ga0157370_100061047 457
135 3300013297 Ga0157378_10005959 Ga0157378_100059592 457
136 3300013297 Ga0157378_10022159 Ga0157378_100221592 457
137 3300013307 Ga0157372_10164379 Ga0157372_101643792 457
138 3300013308 Ga0157375_10006173 Ga0157375_100061738 457
139 3300013308 Ga0157375_10195871 Ga0157375_101958712 457
140 3300025913 Ga0207695_10006298 Ga0207695_100062982 457
141 3300025913 Ga0207695_10032557 Ga0207695_100325575 457
142 3300025924 Ga0207694_10026969 Ga0207694_100269694 457
143 3300025924 Ga0207694_10031474 Ga0207694_100314743 457
144 3300025949 Ga0207667_10004233 Ga0207667_100042331 457
145 3300026023 Ga0207677_10240790 Ga0207677_102407901 457
146 3300026078 Ga0207702_10092113 Ga0207702_100921131 457
147 3300026089 Ga0207648_10008701 Ga0207648_100087019 457
148 3300026142 Ga0207698_10089845 Ga0207698_100898451 457
149 3300031711 Ga0265314_10002638 Ga0265314_100026386 457
150 3300050513 nmdc:mga0rr50_6174_c1 nmdc:mga0rr50_6174_c1_1295_2713 457
151 3300005335 Ga0070666_10066507 Ga0070666_100665072 458
152 3300005355 Ga0070671_100143954 Ga0070671_1001439542 458
153 3300005518 Ga0070699_100007611 Ga0070699_1000076112 458
154 3300005841 Ga0068863_100154265 Ga0068863_1001542652 458
155 3300006237 Ga0097621_100071245 Ga0097621_1000712452 458
156 3300006358 Ga0068871_100036037 Ga0068871_1000360373 458
157 3300009147 Ga0114129_10090778 Ga0114129_100907783 458
158 3300025927 Ga0207687_10001474 Ga0207687_100014744 458
159 3300048907 Ga0496104_0061383 Ga0496104_0061383_1196_2611 458
160 3300048913 Ga0496110_0062907 Ga0496110_0062907_1873_3267 458
161 3300050507 nmdc:mga05p37_30157_c1 nmdc:mga05p37_30157_c1_1539_2966 458
162 3300005338 Ga0068868_100014078 Ga0068868_1000140783 459
163 3300005338 Ga0068868_100034116 Ga0068868_1000341163 459
164 3300005445 Ga0070708_100072369 Ga0070708_1000723692 459
165 3300005458 Ga0070681_10046606 Ga0070681_100466062 459
166 3300005548 Ga0070665_100001095 Ga0070665_10000109522 459
167 3300005548 Ga0070665_100071073 Ga0070665_1000710733 459
168 3300005564 Ga0070664_100160365 Ga0070664_1001603652 459
169 3300005842 Ga0068858_100030803 Ga0068858_1000308032 459
170 3300005985 Ga0081539_10016502 Ga0081539_100165025 459
171 3300006871 Ga0075434_100000263 Ga0075434_10000026312 459
172 3300007076 Ga0075435_100000006 Ga0075435_10000000688 459
173 3300007076 Ga0075435_100042263 Ga0075435_1000422632 459
174 3300009098 Ga0105245_10106856 Ga0105245_101068563 459
175 3300009176 Ga0105242_10010353 Ga0105242_100103533 459
176 3300009176 Ga0105242_10146453 Ga0105242_101464531 459
177 3300009545 Ga0105237_10123964 Ga0105237_101239642 459
178 3300010375 Ga0105239_10041783 Ga0105239_100417835 459
179 3300013306 Ga0163162_10001082 Ga0163162_1000108217 459
180 3300014325 Ga0163163_10088335 Ga0163163_100883352 459
181 3300025924 Ga0207694_10027323 Ga0207694_100273234 459
182 3300025934 Ga0207686_10026934 Ga0207686_100269343 459
183 3300026023 Ga0207677_10126394 Ga0207677_101263942 459
184 3300026035 Ga0207703_10017681 Ga0207703_100176813 459
185 3300026095 Ga0207676_10094987 Ga0207676_100949872 459
186 3300028379 Ga0268266_10010020 Ga0268266_100100205 459
187 3300028379 Ga0268266_10020532 Ga0268266_100205322 459
188 3300028379 Ga0268266_10194947 Ga0268266_101949472 459
189 3300050512 nmdc:mga0n895_15_c1 nmdc:mga0n895_15_c1_91016_92437 459
190 3300050513 nmdc:mga0rr50_15_c1 nmdc:mga0rr50_15_c1_96524_97945 459
191 3300005328 Ga0070676_10048393 Ga0070676_100483932 460
192 3300005441 Ga0070700_100015237 Ga0070700_1000152373 460
193 3300005546 Ga0070696_100072567 Ga0070696_1000725671 460
194 3300005549 Ga0070704_100079924 Ga0070704_1000799242 460
195 3300005615 Ga0070702_100016960 Ga0070702_1000169602 460
196 3300005719 Ga0068861_100012800 Ga0068861_1000128001 460
197 3300005842 Ga0068858_100001924 Ga0068858_10000192418 460
198 3300009147 Ga0114129_10154661 Ga0114129_101546611 460
199 3300009148 Ga0105243_10056077 Ga0105243_100560772 460
200 3300009177 Ga0105248_10150429 Ga0105248_101504292 460
201 3300025907 Ga0207645_10003840 Ga0207645_1000384011 460
202 3300025941 Ga0207711_10095824 Ga0207711_100958241 460
203 3300025981 Ga0207640_10017309 Ga0207640_100173093 460
204 3300026035 Ga0207703_10001690 Ga0207703_100016905 460
205 3300026075 Ga0207708_10052075 Ga0207708_100520751 460
206 3300026089 Ga0207648_10118051 Ga0207648_101180512 460
207 3300026118 Ga0207675_100004263 Ga0207675_10000426311 460
208 3300046459 Ga0495629_0076746 Ga0495629_0076746_335_1732 460
209 3300046473 Ga0495582_0089553 Ga0495582_0089553_12_1409 460
210 3300046477 Ga0495664_0078023 Ga0495664_0078023_436_1833 460
211 3300046543 Ga0495645_0020873 Ga0495645_0020873_233_1630 460
212 3300046681 Ga0495647_0015207 Ga0495647_0015207_1261_2652 460
213 3300050507 nmdc:mga05p37_198142_c1 nmdc:mga05p37_198142_c1_507_1919 460
214 3300053077 Ga0495601_0010916 Ga0495601_0010916_1154_2596 460
215 3300053103 Ga0500555_000614 Ga0500555_000614_4355_5776 460
216 3300005335 Ga0070666_10046442 Ga0070666_100464422 461
217 3300005459 Ga0068867_100077138 Ga0068867_1000771382 461
218 3300005544 Ga0070686_100001727 Ga0070686_1000017279 461
219 3300046476 Ga0495662_0082837 Ga0495662_0082837_26_1429 461
220 3300046535 Ga0495586_0016945 Ga0495586_0016945_1442_2845 461
221 3300046689 Ga0495613_0060876 Ga0495613_0060876_851_2254 461
222 3300049575 Ga0501039_0027337 Ga0501039_0027337_317_1714 461
223 3300049587 Ga0501071_0069116 Ga0501071_0069116_598_1995 461
224 3300049592 Ga0501076_0018289 Ga0501076_0018289_234_1631 461
225 3300053085 Ga0495619_0040016 Ga0495619_0040016_16_1419 461
226 3300053146 Ga0500588_0024456 Ga0500588_0024456_29_1471 461
227 3300005456 Ga0070678_100154005 Ga0070678_1001540051 462
228 3300005468 Ga0070707_100126292 Ga0070707_1001262923 462
229 3300005518 Ga0070699_100028472 Ga0070699_1000284725 462
230 3300005546 Ga0070696_100089856 Ga0070696_1000898561 462
231 3300005549 Ga0070704_100011727 Ga0070704_1000117274 462
232 3300005718 Ga0068866_10026567 Ga0068866_100265671 462
233 3300006237 Ga0097621_100173973 Ga0097621_1001739732 462
234 3300006358 Ga0068871_100003670 Ga0068871_1000036705 462
235 3300006358 Ga0068871_100003670 Ga0068871_1000036706 462
236 3300006871 Ga0075434_100179460 Ga0075434_1001794602 462
237 3300006881 Ga0068865_100001376 Ga0068865_1000013767 462
238 3300006881 Ga0068865_100001376 Ga0068865_1000013768 462
239 3300007076 Ga0075435_100028994 Ga0075435_1000289943 462
240 3300009093 Ga0105240_10011382 Ga0105240_100113824 462
241 3300025913 Ga0207695_10004343 Ga0207695_100043434 462
242 3300026121 Ga0207683_10057256 Ga0207683_100572562 462
243 3300046689 Ga0495613_0133265 Ga0495613_0133265_219_1670 462
244 3300048915 Ga0496112_0330706 Ga0496112_0330706_58_1455 462
245 3300053153 Ga0500616_0005583 Ga0500616_0005583_3092_4519 462
246 3300005335 Ga0070666_10110850 Ga0070666_101108502 463
247 3300005343 Ga0070687_100050345 Ga0070687_1000503451 463
248 3300005367 Ga0070667_100101732 Ga0070667_1001017323 463
249 3300005518 Ga0070699_100106478 Ga0070699_1001064781 463
250 3300005543 Ga0070672_100160772 Ga0070672_1001607722 463
251 3300005548 Ga0070665_100001095 Ga0070665_10000109521 463
252 3300005842 Ga0068858_100030803 Ga0068858_1000308033 463
253 3300005844 Ga0068862_100001200 Ga0068862_1000012005 463
254 3300005937 Ga0081455_10023391 Ga0081455_100233912 463
255 3300009094 Ga0111539_10044411 Ga0111539_100444116 463
256 3300009098 Ga0105245_10089932 Ga0105245_100899322 463
257 3300009147 Ga0114129_10007177 Ga0114129_100071773 463
258 3300009176 Ga0105242_10010353 Ga0105242_100103534 463
259 3300009177 Ga0105248_10015101 Ga0105248_100151016 463
260 3300009177 Ga0105248_10082831 Ga0105248_100828312 463
261 3300013296 Ga0157374_10023770 Ga0157374_100237704 463
262 3300013306 Ga0163162_10170923 Ga0163162_101709232 463
263 3300013308 Ga0157375_10112476 Ga0157375_101124762 463
264 3300014968 Ga0157379_10160627 Ga0157379_101606272 463
265 3300014969 Ga0157376_10073067 Ga0157376_100730672 463
266 3300025918 Ga0207662_10061149 Ga0207662_100611492 463
267 3300025923 Ga0207681_10102961 Ga0207681_101029611 463
268 3300025927 Ga0207687_10104451 Ga0207687_101044512 463
269 3300025931 Ga0207644_10040509 Ga0207644_100405092 463
270 3300025934 Ga0207686_10058431 Ga0207686_100584312 463
271 3300025940 Ga0207691_10010269 Ga0207691_100102692 463
272 3300025941 Ga0207711_10034721 Ga0207711_100347213 463
273 3300025941 Ga0207711_10093849 Ga0207711_100938492 463
274 3300025961 Ga0207712_10177497 Ga0207712_101774972 463
275 3300025972 Ga0207668_10119665 Ga0207668_101196652 463
276 3300025986 Ga0207658_10012919 Ga0207658_100129193 463
277 3300026035 Ga0207703_10017681 Ga0207703_100176812 463
278 3300028379 Ga0268266_10010020 Ga0268266_100100206 463
279 3300028380 Ga0268265_10021175 Ga0268265_100211751 463
280 3300031548 Ga0307408_100023634 Ga0307408_1000236344 463
281 3300048909 Ga0496106_0075800 Ga0496106_0075800_196_1605 463
282 3300048918 Ga0496115_0066056 Ga0496115_0066056_1380_2855 463
283 3300050507 nmdc:mga05p37_4748_c1 nmdc:mga05p37_4748_c1_13636_15045 463
284 3300050511 nmdc:mga08y16_4936_c1 nmdc:mga08y16_4936_c1_12461_13870 463
285 3300054114 Ga0501084_0153123 Ga0501084_0153123_408_1811 463
286 3300005295 Ga0065707_10082352 Ga0065707_1008235210 464
287 3300005331 Ga0070670_100091053 Ga0070670_1000910532 464
288 3300005842 Ga0068858_100028072 Ga0068858_1000280724 464
289 3300009101 Ga0105247_10022129 Ga0105247_100221294 464
290 3300009147 Ga0114129_10328726 Ga0114129_103287261 464
291 3300014325 Ga0163163_10011323 Ga0163163_100113238 464
292 3300014968 Ga0157379_10009189 Ga0157379_100091893 464
293 3300025941 Ga0207711_10074376 Ga0207711_100743762 464
294 3300026035 Ga0207703_10093454 Ga0207703_100934542 464
295 3300035119 Ga0373956_0037806 Ga0373956_0037806_150_1592 464
296 3300035171 Ga0373946_0009574 Ga0373946_0009574_1916_3358 464
297 3300035724 Ga0373933_0058821 Ga0373933_0058821_776_2218 464
298 3300042439 Ga0439464_0005008 Ga0439464_0005008_1980_3383 464
299 3300046454 Ga0495592_0057758 Ga0495592_0057758_390_1832 464
300 3300046460 Ga0495638_0013604 Ga0495638_0013604_3860_5272 464
301 3300046511 Ga0495608_0007747 Ga0495608_0007747_5075_6517 464
302 3300046516 Ga0495628_0076259 Ga0495628_0076259_849_2291 464
303 3300046517 Ga0495630_0005516 Ga0495630_0005516_5699_7141 464
304 3300046536 Ga0495587_0015382 Ga0495587_0015382_265_1707 464
305 3300046543 Ga0495645_0021928 Ga0495645_0021928_2924_4366 464
306 3300046559 Ga0495667_0014888 Ga0495667_0014888_2357_3799 464
307 3300046660 Ga0495625_0015060 Ga0495625_0015060_1820_3232 464
308 3300046689 Ga0495613_0001419 Ga0495613_0001419_9634_11076 464
309 3300046809 Ga0495600_0022432 Ga0495600_0022432_2499_3941 464
310 3300047317 Ga0495604_0025341 Ga0495604_0025341_1075_2517 464
311 3300047319 Ga0495674_0141333 Ga0495674_0141333_410_1852 464
312 3300047471 Ga0495684_0000535 Ga0495684_0000535_12220_13662 464
313 3300048911 Ga0496108_0009554 Ga0496108_0009554_128_1579 464
314 3300048915 Ga0496112_0006268 Ga0496112_0006268_2629_4080 464
315 3300048921 Ga0496118_0082357 Ga0496118_0082357_167_1579 464
316 3300005471 Ga0070698_100042148 Ga0070698_1000421482 465
317 3300006844 Ga0075428_100000019 Ga0075428_100000019108 465
318 3300006846 Ga0075430_100071235 Ga0075430_1000712354 465
319 3300006846 Ga0075430_100121042 Ga0075430_1001210422 465
320 3300006847 Ga0075431_100083175 Ga0075431_1000831752 465
321 3300006847 Ga0075431_100091906 Ga0075431_1000919062 465
322 3300006852 Ga0075433_10008665 Ga0075433_100086659 465
323 3300006871 Ga0075434_100003861 Ga0075434_1000038618 465
324 3300006914 Ga0075436_100003783 Ga0075436_1000037836 465
325 3300007076 Ga0075435_100004562 Ga0075435_1000045629 465
326 3300009094 Ga0111539_10000002 Ga0111539_10000002578 465
327 3300009147 Ga0114129_10039244 Ga0114129_100392443 465
328 3300014326 Ga0157380_10192491 Ga0157380_101924911 465
329 3300025923 Ga0207681_10061031 Ga0207681_100610312 465
330 3300026118 Ga0207675_100011699 Ga0207675_1000116996 465
331 3300027907 Ga0207428_10000004 Ga0207428_1000000478 465
332 3300032002 Ga0307416_100092952 Ga0307416_1000929522 465
333 3300045051 Ga0451576_0138669 Ga0451576_0138669_530_1945 465
334 3300050507 nmdc:mga05p37_14868_c1 nmdc:mga05p37_14868_c1_5105_6508 465
335 3300050510 nmdc:mga06r32_57733_c1 nmdc:mga06r32_57733_c1_1684_3096 465
336 3300050511 nmdc:mga08y16_2_c1 nmdc:mga08y16_2_c1_346692_348122 465
337 3300050513 nmdc:mga0rr50_17685_c1 nmdc:mga0rr50_17685_c1_164_1606 465
338 3300050514 nmdc:mga08x19_16873_c1 nmdc:mga08x19_16873_c1_915_2357 465
339 3300005340 Ga0070689_100037384 Ga0070689_1000373842 466
340 3300005441 Ga0070700_100015237 Ga0070700_1000152372 466
341 3300005445 Ga0070708_100308637 Ga0070708_1003086371 466
342 3300005467 Ga0070706_100069396 Ga0070706_1000693963 466
343 3300005518 Ga0070699_100075079 Ga0070699_1000750792 466
344 3300005615 Ga0070702_100016960 Ga0070702_1000169603 466
345 3300005719 Ga0068861_100012800 Ga0068861_1000128002 466
346 3300005842 Ga0068858_100028072 Ga0068858_1000280722 466
347 3300006051 Ga0075364_10007817 Ga0075364_100078175 466
348 3300006177 Ga0075362_10003580 Ga0075362_100035802 466
349 3300006178 Ga0075367_10002473 Ga0075367_100024734 466
350 3300006195 Ga0075366_10003024 Ga0075366_100030247 466
351 3300006844 Ga0075428_100057678 Ga0075428_1000576783 466
352 3300006847 Ga0075431_100029103 Ga0075431_1000291034 466
353 3300006852 Ga0075433_10122667 Ga0075433_101226672 466
354 3300006852 Ga0075433_10254740 Ga0075433_102547401 466
355 3300009094 Ga0111539_10020537 Ga0111539_100205375 466
356 3300009101 Ga0105247_10005697 Ga0105247_100056975 466
357 3300009147 Ga0114129_10002572 Ga0114129_100025728 466
358 3300009147 Ga0114129_10007177 Ga0114129_100071777 466
359 3300009147 Ga0114129_10008163 Ga0114129_100081633 466
360 3300009147 Ga0114129_10010213 Ga0114129_100102132 466
361 3300009147 Ga0114129_10052812 Ga0114129_100528123 466
362 3300009147 Ga0114129_10225996 Ga0114129_102259961 466
363 3300009148 Ga0105243_10029586 Ga0105243_100295862 466
364 3300009177 Ga0105248_10006231 Ga0105248_100062313 466
365 3300014325 Ga0163163_10002582 Ga0163163_1000258211 466
366 3300025907 Ga0207645_10003840 Ga0207645_1000384012 466
367 3300025912 Ga0207707_10079151 Ga0207707_100791512 466
368 3300025923 Ga0207681_10028375 Ga0207681_100283752 466
369 3300025936 Ga0207670_10024450 Ga0207670_100244502 466
370 3300025941 Ga0207711_10006875 Ga0207711_100068752 466
371 3300026075 Ga0207708_10052075 Ga0207708_100520752 466
372 3300026075 Ga0207708_10209208 Ga0207708_102092081 466
373 3300026095 Ga0207676_10006605 Ga0207676_100066055 466
374 3300026118 Ga0207675_100004263 Ga0207675_10000426312 466
375 3300027907 Ga0207428_10023973 Ga0207428_100239734 466
376 3300028379 Ga0268266_10194039 Ga0268266_101940392 466
377 3300028380 Ga0268265_10011257 Ga0268265_100112573 466
378 3300046543 Ga0495645_0004139 Ga0495645_0004139_3841_5256 466
379 3300046663 Ga0495635_0076057 Ga0495635_0076057_856_2271 466
380 3300047319 Ga0495674_0026054 Ga0495674_0026054_337_1752 466
381 3300048907 Ga0496104_0009794 Ga0496104_0009794_566_1981 466
382 3300048911 Ga0496108_0071750 Ga0496108_0071750_182_1597 466
383 3300048915 Ga0496112_0006268 Ga0496112_0006268_5540_6955 466
384 3300048916 Ga0496113_0054153 Ga0496113_0054153_980_2395 466
385 3300048917 Ga0496114_0058787 Ga0496114_0058787_991_2406 466
386 3300048917 Ga0496114_0095886 Ga0496114_0095886_828_2243 466
387 3300050491 nmdc:mga00v17_13810_c1 nmdc:mga00v17_13810_c1_2274_3698 466
388 3300050493 nmdc:mga0k408_14691_c1 nmdc:mga0k408_14691_c1_2432_3856 466
389 3300050494 nmdc:mga06z11_15651_c1 nmdc:mga06z11_15651_c1_1381_2805 466
390 3300050507 nmdc:mga05p37_252439_c1 nmdc:mga05p37_252439_c1_252_1670 466
391 3300050507 nmdc:mga05p37_313201_c1 nmdc:mga05p37_313201_c1_33_1448 466
392 3300050507 nmdc:mga05p37_4748_c1 nmdc:mga05p37_4748_c1_8423_9838 466
393 3300050507 nmdc:mga05p37_73403_c1 nmdc:mga05p37_73403_c1_2149_3564 466
394 3300050508 nmdc:mga09592_63077_c1 nmdc:mga09592_63077_c1_836_2254 466
395 3300050510 nmdc:mga06r32_87217_c1 nmdc:mga06r32_87217_c1_1360_2805 466
396 3300050511 nmdc:mga08y16_93932_c1 nmdc:mga08y16_93932_c1_1233_2654 466
397 3300050515 nmdc:mga0a205_145295_c1 nmdc:mga0a205_145295_c1_821_2245 466
398 3300053077 Ga0495601_0074628 Ga0495601_0074628_51_1466 466
399 3300059423 Ga0590074_001505 Ga0590074_001505_816_2228 466
400 3300005530 Ga0070679_100077773 Ga0070679_1000777731 467
401 3300005617 Ga0068859_100021903 Ga0068859_1000219031 467
402 3300005618 Ga0068864_100064805 Ga0068864_1000648052 467
403 3300006931 Ga0097620_100021903 Ga0097620_1000219035 467
404 3300009094 Ga0111539_10078188 Ga0111539_100781883 467
405 3300009147 Ga0114129_10120476 Ga0114129_101204762 467
406 3300014326 Ga0157380_10095627 Ga0157380_100956272 467
407 3300025912 Ga0207707_10131760 Ga0207707_101317603 467
408 3300026095 Ga0207676_10075371 Ga0207676_100753711 467
409 3300048907 Ga0496104_0134450 Ga0496104_0134450_187_1632 467
410 3300050511 nmdc:mga08y16_169526_c1 nmdc:mga08y16_169526_c1_208_1641 467
411 3300053085 Ga0495619_0112338 Ga0495619_0112338_126_1577 467
412 3300059421 Ga0590071_000017 Ga0590071_000017_38371_39801 467
413 3300059424 Ga0590075_000326 Ga0590075_000326_10555_11985 467
414 3300059424 Ga0590075_011606 Ga0590075_011606_420_1850 467
415 3300059426 Ga0590077_000494 Ga0590077_000494_4972_6402 467
416 3300005337 Ga0070682_100122433 Ga0070682_1001224331 468
417 3300005356 Ga0070674_100007478 Ga0070674_1000074787 468
418 3300005719 Ga0068861_100076040 Ga0068861_1000760403 468
419 3300005844 Ga0068862_100058329 Ga0068862_1000583292 468
420 3300006844 Ga0075428_100002764 Ga0075428_1000027645 468
421 3300006846 Ga0075430_100003635 Ga0075430_1000036355 468
422 3300006847 Ga0075431_100002890 Ga0075431_1000028907 468
423 3300006847 Ga0075431_100012771 Ga0075431_1000127713 468
424 3300006880 Ga0075429_100111197 Ga0075429_1001111971 468
425 3300009147 Ga0114129_10006237 Ga0114129_100062372 468
426 3300009147 Ga0114129_10008560 Ga0114129_100085606 468
427 3300009148 Ga0105243_10029586 Ga0105243_100295863 468
428 3300009553 Ga0105249_10175770 Ga0105249_101757701 468
429 3300025935 Ga0207709_10145412 Ga0207709_101454121 468
430 3300025937 Ga0207669_10017958 Ga0207669_100179582 468
431 3300025961 Ga0207712_10081419 Ga0207712_100814192 468
432 3300026118 Ga0207675_100011699 Ga0207675_1000116994 468
433 3300034816 Ga0373930_0000287 Ga0373930_0000287_2895_4328 468
434 3300034817 Ga0373948_0002828 Ga0373948_0002828_951_2384 468
435 3300034957 Ga0373938_0000205 Ga0373938_0000205_5571_7004 468
436 3300035084 Ga0373928_0000652 Ga0373928_0000652_2736_4169 468
437 3300035085 Ga0373929_0001227 Ga0373929_0001227_2731_4164 468
438 3300035088 Ga0373940_0001976 Ga0373940_0001976_1426_2859 468
439 3300035090 Ga0373949_0000454 Ga0373949_0000454_6209_7642 468
440 3300035091 Ga0373951_0019588 Ga0373951_0019588_43_1476 468
441 3300035092 Ga0373952_0002265 Ga0373952_0002265_1464_2897 468
442 3300035114 Ga0373939_0004947 Ga0373939_0004947_1535_2968 468
443 3300035115 Ga0373941_0000148 Ga0373941_0000148_6679_8112 468
444 3300035121 Ga0373960_0000908 Ga0373960_0000908_63_1496 468
445 3300035207 Ga0373942_0000134 Ga0373942_0000134_12110_13543 468
446 3300035241 Ga0373961_0000639 Ga0373961_0000639_4402_5835 468
447 3300035691 Ga0373931_0015092 Ga0373931_0015092_1355_2788 468
448 3300042461 Ga0439460_0006862 Ga0439460_0006862_91_1503 468
449 3300045051 Ga0451576_0013724 Ga0451576_0013724_4288_5721 468
450 3300050507 nmdc:mga05p37_159228_c1 nmdc:mga05p37_159228_c1_584_2005 468
451 3300050507 nmdc:mga05p37_7044_c1 nmdc:mga05p37_7044_c1_1188_2630 468
452 3300050508 nmdc:mga09592_106332_c1 nmdc:mga09592_106332_c1_180_1607 468
453 3300050509 nmdc:mga0qj67_1336_c1 nmdc:mga0qj67_1336_c1_7599_9041 468
454 3300050510 nmdc:mga06r32_58747_c1 nmdc:mga06r32_58747_c1_2220_3647 468
455 3300035113 Ga0373936_0015317 Ga0373936_0015317_854_2296 469
456 3300035725 Ga0373947_0012629 Ga0373947_0012629_537_1979 469
457 3300025972 Ga0207668_10107761 Ga0207668_101077611 470
458 3300041408 Ga0439453_0002413 Ga0439453_0002413_822_2309 470
459 3300005293 Ga0065715_10091972 Ga0065715_100919722 471
460 3300005356 Ga0070674_100122162 Ga0070674_1001221622 471
461 3300006844 Ga0075428_100034183 Ga0075428_1000341834 471
462 3300025937 Ga0207669_10107368 Ga0207669_101073681 471
463 3300026121 Ga0207683_10044666 Ga0207683_100446665 471
464 3300050507 nmdc:mga05p37_77033_c1 nmdc:mga05p37_77033_c1_2603_4045 471

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07687

M20_dimer

Peptidase dimerisation domain

245

394

0.94

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

125

493

0.87

PF04389

Peptidase_M28

Peptidase family M28

110

220

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1q7l-assembly1.cif.gz_A zn-binding domain of the t347g mutant of human aminoacylase-i 0.887 31 193
4h2k-assembly2.cif.gz_B crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae 0.8845 29 465
4h2k-assembly2.cif.gz_B crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae 0.8746 29 465
4h2k-assembly1.cif.gz_A crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae 0.863 27 213
5vo3-assembly1.cif.gz_A-2 crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) 0.8589 25 465
ID Description Score Start End Superfamily
1q7lC00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9272 31 193 3.40.630.10
af_Q2FWN8_3_180_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.918 29 191 3.40.630.10
af_Q55DP8_2_191_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9159 31 193 3.40.630.10
af_Q57899_2_199_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8741 28 191 3.40.630.10
4mmoA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8697 31 462 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A143PK28-F1-model_v4 Putative succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) 0.9786 34 468 GO:0009014
GO:0046872
AF-A0A4P5ZDR6-F1-model_v4 Peptidase M20 dimerisation domain-containing protein 0.9745 36 468 GO:0006508
GO:0008233
AF-A0A143PK28-F1-model_v4 Putative succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) 0.9741 34 468 GO:0009014
GO:0046872
AF-A0A4P5ZDR6-F1-model_v4 Peptidase M20 dimerisation domain-containing protein 0.97 36 468 GO:0006508
GO:0008233
AF-A0A3N5Y9B0-F1-model_v4 deleted 0.9699 26 194

Feature Viewer

pLDDT pTM Quality
90.78 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map