F449256
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 464 | 259 | 464 | 252 |
Family's Representative Sequence
| Representative Sequence | 3300005536|Ga0070697_100127760|Ga0070697_1001277603 |
| Length | 282 |
| Sequence | LINLKTAHEIDLMARAGALLASVLPPLKDACEPGVKTNELDRIAEKLIRDGGATPGFLGYHGYPKSICVSINDEAVHGIPGSRKIAAGDLVSLDLGLVLDGFWADVGITVGVGKITKEADRLVKVTEEALYVGIDKAQPGGWLGDVSSAIQKHVEKAGFSVIRQFVGHGIGRQMHEDPQVPNFGTPGTPPRLKPGMTLAIEPMVNAGSHEVYMKADGWTICTVDGALSAYFEHTVAITDKGPLILTAQGSPLAGSSRRAEGAPGVGTSAPKASNGRANGAAH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 95 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 96 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 160 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 163 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 164 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 165 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 167 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 168 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 169 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 170 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 171 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 172 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 173 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 174 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 175 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 178 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 179 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 181 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 182 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 183 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 184 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 185 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 186 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 187 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 188 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 189 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 190 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 191 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 192 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 193 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 194 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 195 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 196 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 197 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 198 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 199 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 200 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 214 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 234 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 235 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 241 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 242 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 243 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 244 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 255 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 258 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.35 |
| Metatranscriptomes | 0.65 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.29 |
| Nodule | 0 |
| Rhizoplane | 0.22 |
| Rhizosphere | 96.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3021854 | 2162886007 | Unclassified | 1179 |
| 2 | JGI24746J21847_1000439 | 3300001977 | Bacteria | 6214 |
| 3 | Ga0058862_12677821 | 3300004803 | Unclassified | 1696 |
| 4 | Ga0058862_12781598 | 3300004803 | Bacteria | 1552 |
| 5 | Ga0065704_10094280 | 3300005289 | Bacteria | 2551 |
| 6 | Ga0065707_10117488 | 3300005295 | Bacteria | 2176 |
| 7 | Ga0065707_10124509 | 3300005295 | Unclassified | 2042 |
| 8 | Ga0065707_10157277 | 3300005295 | Bacteria | 1596 |
| 9 | Ga0070676_10002352 | 3300005328 | Bacteria | 9683 |
| 10 | Ga0070676_10089255 | 3300005328 | Bacteria | 1885 |
| 11 | Ga0070683_100029138 | 3300005329 | Bacteria | 4995 |
| 12 | Ga0070690_100001487 | 3300005330 | Bacteria | 12272 |
| 13 | Ga0070690_100025120 | 3300005330 | Bacteria | 3667 |
| 14 | Ga0070670_100007145 | 3300005331 | Bacteria | 9456 |
| 15 | Ga0070677_10000876 | 3300005333 | Bacteria | 9918 |
| 16 | Ga0068869_100002424 | 3300005334 | Bacteria | 11243 |
| 17 | Ga0070666_10056014 | 3300005335 | Bacteria | 2661 |
| 18 | Ga0070680_100001398 | 3300005336 | Bacteria | 17425 |
| 19 | Ga0070682_100039950 | 3300005337 | Bacteria | 2885 |
| 20 | Ga0068868_100436321 | 3300005338 | Bacteria | 1136 |
| 21 | Ga0070660_100018135 | 3300005339 | Bacteria | 5136 |
| 22 | Ga0070689_100047490 | 3300005340 | Bacteria | 3310 |
| 23 | Ga0070691_10034998 | 3300005341 | Bacteria | 2364 |
| 24 | Ga0070687_100018120 | 3300005343 | Bacteria | 3250 |
| 25 | Ga0070687_100220404 | 3300005343 | Bacteria | 1161 |
| 26 | Ga0070661_100004891 | 3300005344 | Bacteria | 9227 |
| 27 | Ga0070661_100025478 | 3300005344 | Bacteria | 4251 |
| 28 | Ga0070692_10105828 | 3300005345 | Unclassified | 1549 |
| 29 | Ga0070668_100039054 | 3300005347 | Bacteria | 3631 |
| 30 | Ga0070669_100070016 | 3300005353 | Bacteria | 2592 |
| 31 | Ga0070671_100021110 | 3300005355 | Bacteria | 5317 |
| 32 | Ga0070674_100011117 | 3300005356 | Bacteria | 5466 |
| 33 | Ga0070673_100028371 | 3300005364 | Bacteria | 4162 |
| 34 | Ga0070673_100746429 | 3300005364 | Bacteria | 901 |
| 35 | Ga0070659_100118915 | 3300005366 | Bacteria | 2138 |
| 36 | Ga0070703_10005450 | 3300005406 | Bacteria | 3558 |
| 37 | Ga0070714_100027086 | 3300005435 | Bacteria | 4743 |
| 38 | Ga0070714_100091616 | 3300005435 | Bacteria | 2664 |
| 39 | Ga0070714_100272636 | 3300005435 | Bacteria | 1569 |
| 40 | Ga0070714_100321409 | 3300005435 | Bacteria | 1447 |
| 41 | Ga0070713_100021996 | 3300005436 | Bacteria | 4918 |
| 42 | Ga0070710_10306865 | 3300005437 | Bacteria | 1037 |
| 43 | Ga0070711_100457267 | 3300005439 | Bacteria | 1046 |
| 44 | Ga0070705_100015576 | 3300005440 | Bacteria | 3935 |
| 45 | Ga0070705_100025577 | 3300005440 | Bacteria | 3201 |
| 46 | Ga0070705_100030655 | 3300005440 | Bacteria | 2971 |
| 47 | Ga0070705_100091803 | 3300005440 | Bacteria | 1894 |
| 48 | Ga0070705_100125705 | 3300005440 | Bacteria | 1664 |
| 49 | Ga0070705_100261142 | 3300005440 | Bacteria | 1221 |
| 50 | Ga0070700_100007161 | 3300005441 | Bacteria | 6007 |
| 51 | Ga0070694_100033008 | 3300005444 | Bacteria | 3402 |
| 52 | Ga0070694_100050477 | 3300005444 | Bacteria | 2804 |
| 53 | Ga0070708_100000027 | 3300005445 | Bacteria | 97468 |
| 54 | Ga0070708_100001490 | 3300005445 | Bacteria | 17884 |
| 55 | Ga0070708_100049189 | 3300005445 | Bacteria | 3729 |
| 56 | Ga0070708_100059463 | 3300005445 | Bacteria | 3407 |
| 57 | Ga0070708_100170936 | 3300005445 | Bacteria | 2029 |
| 58 | Ga0070708_100234209 | 3300005445 | Bacteria | 1723 |
| 59 | Ga0070663_100110033 | 3300005455 | Unclassified | 2069 |
| 60 | Ga0070678_100000687 | 3300005456 | Bacteria | 16686 |
| 61 | Ga0070681_10007331 | 3300005458 | Bacteria | 10773 |
| 62 | Ga0068867_100000218 | 3300005459 | Bacteria | 37862 |
| 63 | Ga0068867_100002011 | 3300005459 | Bacteria | 14198 |
| 64 | Ga0070706_100000117 | 3300005467 | Bacteria | 97475 |
| 65 | Ga0070706_100000547 | 3300005467 | Bacteria | 43712 |
| 66 | Ga0070706_100001931 | 3300005467 | Bacteria | 21364 |
| 67 | Ga0070706_100009741 | 3300005467 | Bacteria | 8929 |
| 68 | Ga0070706_100011793 | 3300005467 | Bacteria | 8112 |
| 69 | Ga0070706_100016257 | 3300005467 | Bacteria | 6873 |
| 70 | Ga0070707_100000060 | 3300005468 | Bacteria | 97475 |
| 71 | Ga0070707_100001828 | 3300005468 | Bacteria | 20464 |
| 72 | Ga0070707_100010596 | 3300005468 | Bacteria | 8585 |
| 73 | Ga0070707_100043111 | 3300005468 | Bacteria | 4319 |
| 74 | Ga0070707_100064893 | 3300005468 | Bacteria | 3507 |
| 75 | Ga0070707_100102186 | 3300005468 | Bacteria | 2777 |
| 76 | Ga0070707_100250604 | 3300005468 | Bacteria | 1723 |
| 77 | Ga0070707_100256847 | 3300005468 | Bacteria | 1700 |
| 78 | Ga0070707_100294316 | 3300005468 | Bacteria | 1577 |
| 79 | Ga0070707_100578572 | 3300005468 | Bacteria | 1085 |
| 80 | Ga0070698_100018273 | 3300005471 | Bacteria | 7382 |
| 81 | Ga0070698_100023059 | 3300005471 | Bacteria | 6509 |
| 82 | Ga0070698_100102838 | 3300005471 | Bacteria | 2827 |
| 83 | Ga0070698_100201083 | 3300005471 | Bacteria | 1928 |
| 84 | Ga0070698_100456312 | 3300005471 | Bacteria | 1214 |
| 85 | Ga0070698_100473801 | 3300005471 | Bacteria | 1188 |
| 86 | Ga0070698_100558399 | 3300005471 | Bacteria | 1084 |
| 87 | Ga0070698_100659716 | 3300005471 | Unclassified | 987 |
| 88 | Ga0070699_100000685 | 3300005518 | Bacteria | 31595 |
| 89 | Ga0070699_100000784 | 3300005518 | Bacteria | 29316 |
| 90 | Ga0070699_100002925 | 3300005518 | Bacteria | 15183 |
| 91 | Ga0070699_100046351 | 3300005518 | Bacteria | 3761 |
| 92 | Ga0070699_100053088 | 3300005518 | Bacteria | 3508 |
| 93 | Ga0070699_100065427 | 3300005518 | Bacteria | 3155 |
| 94 | Ga0070699_100221941 | 3300005518 | Bacteria | 1684 |
| 95 | Ga0070699_100378282 | 3300005518 | Bacteria | 1278 |
| 96 | Ga0070684_100092388 | 3300005535 | Bacteria | 2693 |
| 97 | Ga0070697_100000351 | 3300005536 | Bacteria | 36223 |
| 98 | Ga0070697_100001474 | 3300005536 | Bacteria | 17878 |
| 99 | Ga0070697_100014335 | 3300005536 | Bacteria | 6228 |
| 100 | Ga0070697_100016182 | 3300005536 | Bacteria | 5864 |
| 101 | Ga0070697_100052182 | 3300005536 | Bacteria | 3322 |
| 102 | Ga0070697_100077619 | 3300005536 | Bacteria | 2733 |
| 103 | Ga0070697_100095218 | 3300005536 | Bacteria | 2468 |
| 104 | Ga0070697_100127760 | 3300005536 | Bacteria | 2130 |
| 105 | Ga0070697_100219435 | 3300005536 | Bacteria | 1620 |
| 106 | Ga0070697_100231399 | 3300005536 | Bacteria | 1577 |
| 107 | Ga0070697_100445092 | 3300005536 | Bacteria | 1128 |
| 108 | Ga0070672_100010522 | 3300005543 | Bacteria | 6420 |
| 109 | Ga0070672_100016350 | 3300005543 | Bacteria | 5311 |
| 110 | Ga0070686_100027236 | 3300005544 | Bacteria | 3458 |
| 111 | Ga0070695_100005251 | 3300005545 | Bacteria | 7628 |
| 112 | Ga0070695_100029506 | 3300005545 | Bacteria | 3408 |
| 113 | Ga0070695_100471286 | 3300005545 | Unclassified | 966 |
| 114 | Ga0070696_100051210 | 3300005546 | Bacteria | 2871 |
| 115 | Ga0070696_100403131 | 3300005546 | Bacteria | 1070 |
| 116 | Ga0070693_100203796 | 3300005547 | Unclassified | 1286 |
| 117 | Ga0070693_100363412 | 3300005547 | Bacteria | 994 |
| 118 | Ga0070704_100004934 | 3300005549 | Bacteria | 7747 |
| 119 | Ga0070704_100006043 | 3300005549 | Bacteria | 7100 |
| 120 | Ga0070704_100130670 | 3300005549 | Bacteria | 1946 |
| 121 | Ga0070664_100004346 | 3300005564 | Bacteria | 11393 |
| 122 | Ga0068857_100091178 | 3300005577 | Bacteria | 2727 |
| 123 | Ga0068864_100106443 | 3300005618 | Bacteria | 2494 |
| 124 | Ga0068864_100191261 | 3300005618 | Bacteria | 1876 |
| 125 | Ga0068866_10018240 | 3300005718 | Bacteria | 3170 |
| 126 | Ga0068866_10025428 | 3300005718 | Bacteria | 2783 |
| 127 | Ga0068858_100131773 | 3300005842 | Unclassified | 2345 |
| 128 | Ga0068860_100029433 | 3300005843 | Bacteria | 5283 |
| 129 | Ga0068862_100007798 | 3300005844 | Bacteria | 8853 |
| 130 | Ga0081455_10003827 | 3300005937 | Bacteria | 17166 |
| 131 | Ga0081538_10020098 | 3300005981 | Bacteria | 4932 |
| 132 | Ga0081538_10022736 | 3300005981 | Bacteria | 4532 |
| 133 | Ga0081538_10082674 | 3300005981 | Bacteria | 1701 |
| 134 | Ga0081539_10000187 | 3300005985 | Bacteria | 145407 |
| 135 | Ga0081539_10023492 | 3300005985 | Bacteria | 4039 |
| 136 | Ga0070717_10000007 | 3300006028 | Bacteria | 304340 |
| 137 | Ga0070717_10008688 | 3300006028 | Bacteria | 7600 |
| 138 | Ga0070717_10034873 | 3300006028 | Bacteria | 4069 |
| 139 | Ga0075364_10047604 | 3300006051 | Bacteria | 2794 |
| 140 | Ga0070716_100076540 | 3300006173 | Bacteria | 1983 |
| 141 | Ga0075367_10010858 | 3300006178 | Bacteria | 4799 |
| 142 | Ga0097621_100030761 | 3300006237 | Bacteria | 4254 |
| 143 | Ga0097621_100037374 | 3300006237 | Bacteria | 3890 |
| 144 | Ga0068871_100285934 | 3300006358 | Unclassified | 1444 |
| 145 | Ga0075428_100123908 | 3300006844 | Unclassified | 2813 |
| 146 | Ga0075428_100289686 | 3300006844 | Unclassified | 1761 |
| 147 | Ga0075430_100003584 | 3300006846 | Bacteria | 13009 |
| 148 | Ga0075430_100011986 | 3300006846 | Bacteria | 7378 |
| 149 | Ga0075431_100009425 | 3300006847 | Bacteria | 9799 |
| 150 | Ga0075431_100009466 | 3300006847 | Bacteria | 9782 |
| 151 | Ga0075433_10012940 | 3300006852 | Bacteria | 6763 |
| 152 | Ga0075433_10137694 | 3300006852 | Bacteria | 2170 |
| 153 | Ga0075434_100163257 | 3300006871 | Bacteria | 2247 |
| 154 | Ga0075434_100207960 | 3300006871 | Bacteria | 1978 |
| 155 | Ga0075434_100364703 | 3300006871 | Bacteria | 1465 |
| 156 | Ga0075429_100030783 | 3300006880 | Bacteria | 4663 |
| 157 | Ga0068865_100001372 | 3300006881 | Bacteria | 14168 |
| 158 | Ga0075436_100038296 | 3300006914 | Bacteria | 3309 |
| 159 | Ga0075436_100041209 | 3300006914 | Bacteria | 3185 |
| 160 | Ga0075436_100160869 | 3300006914 | Bacteria | 1583 |
| 161 | Ga0075435_100061967 | 3300007076 | Bacteria | 3035 |
| 162 | Ga0075435_100140037 | 3300007076 | Bacteria | 2029 |
| 163 | Ga0075435_100181585 | 3300007076 | Bacteria | 1778 |
| 164 | Ga0099794_10000117 | 3300007265 | Bacteria | 29179 |
| 165 | Ga0099794_10004600 | 3300007265 | Bacteria | 5445 |
| 166 | Ga0099794_10225257 | 3300007265 | Bacteria | 964 |
| 167 | Ga0111539_10493398 | 3300009094 | Bacteria | 1426 |
| 168 | Ga0105245_10002155 | 3300009098 | Bacteria | 17830 |
| 169 | Ga0114129_10015428 | 3300009147 | Bacteria | 10869 |
| 170 | Ga0114129_10025977 | 3300009147 | Bacteria | 8293 |
| 171 | Ga0114129_10033158 | 3300009147 | Bacteria | 7298 |
| 172 | Ga0114129_10119665 | 3300009147 | Bacteria | 3627 |
| 173 | Ga0114129_10270489 | 3300009147 | Bacteria | 2273 |
| 174 | Ga0114129_10418863 | 3300009147 | Bacteria | 1762 |
| 175 | Ga0114129_10630303 | 3300009147 | Bacteria | 1386 |
| 176 | Ga0105243_10000049 | 3300009148 | Bacteria | 145575 |
| 177 | Ga0105243_10002596 | 3300009148 | Bacteria | 15060 |
| 178 | Ga0105242_10001315 | 3300009176 | Bacteria | 19631 |
| 179 | Ga0105249_10001784 | 3300009553 | Bacteria | 18752 |
| 180 | Ga0105239_10132652 | 3300010375 | Bacteria | 2771 |
| 181 | Ga0105246_10000933 | 3300011119 | Bacteria | 16728 |
| 182 | Ga0157369_10031128 | 3300013105 | Bacteria | 5879 |
| 183 | Ga0157369_10667919 | 3300013105 | Bacteria | 1071 |
| 184 | Ga0157374_10004664 | 3300013296 | Bacteria | 11502 |
| 185 | Ga0157378_10017169 | 3300013297 | Bacteria | 6344 |
| 186 | Ga0163162_10226389 | 3300013306 | Bacteria | 2000 |
| 187 | Ga0157380_10015563 | 3300014326 | Bacteria | 5593 |
| 188 | Ga0157380_10032645 | 3300014326 | Bacteria | 4007 |
| 189 | Ga0157377_10040483 | 3300014745 | Bacteria | 2580 |
| 190 | Ga0157377_10043021 | 3300014745 | Bacteria | 2512 |
| 191 | Ga0157376_10000962 | 3300014969 | Bacteria | 18762 |
| 192 | Ga0157376_10011279 | 3300014969 | Bacteria | 6579 |
| 193 | Ga0213876_10009713 | 3300021384 | Bacteria | 5178 |
| 194 | Ga0213876_10016993 | 3300021384 | Bacteria | 3843 |
| 195 | Ga0213875_10006988 | 3300021388 | Bacteria | 5875 |
| 196 | Ga0224712_10179793 | 3300022467 | Bacteria | 952 |
| 197 | Ga0207653_10001462 | 3300025885 | Bacteria | 7662 |
| 198 | Ga0207682_10030281 | 3300025893 | Bacteria | 2167 |
| 199 | Ga0207692_10263003 | 3300025898 | Bacteria | 1038 |
| 200 | Ga0207642_10245301 | 3300025899 | Bacteria | 1013 |
| 201 | Ga0207688_10001296 | 3300025901 | Bacteria | 12973 |
| 202 | Ga0207680_10004142 | 3300025903 | Bacteria | 6866 |
| 203 | Ga0207680_10025370 | 3300025903 | Bacteria | 3269 |
| 204 | Ga0207647_10095905 | 3300025904 | Bacteria | 1766 |
| 205 | Ga0207645_10001331 | 3300025907 | Bacteria | 20306 |
| 206 | Ga0207645_10193102 | 3300025907 | Bacteria | 1338 |
| 207 | Ga0207684_10000002 | 3300025910 | Bacteria | 1042751 |
| 208 | Ga0207684_10000026 | 3300025910 | Bacteria | 316711 |
| 209 | Ga0207684_10000148 | 3300025910 | Bacteria | 124604 |
| 210 | Ga0207684_10000222 | 3300025910 | Bacteria | 87705 |
| 211 | Ga0207684_10002609 | 3300025910 | Bacteria | 18023 |
| 212 | Ga0207684_10022921 | 3300025910 | Bacteria | 5332 |
| 213 | Ga0207684_10067051 | 3300025910 | Bacteria | 3049 |
| 214 | Ga0207684_10139657 | 3300025910 | Bacteria | 2082 |
| 215 | Ga0207684_10225000 | 3300025910 | Bacteria | 1619 |
| 216 | Ga0207684_10285644 | 3300025910 | Bacteria | 1423 |
| 217 | Ga0207684_10296857 | 3300025910 | Bacteria | 1393 |
| 218 | Ga0207707_10005817 | 3300025912 | Bacteria | 10774 |
| 219 | Ga0207707_10037560 | 3300025912 | Bacteria | 4233 |
| 220 | Ga0207693_10131173 | 3300025915 | Unclassified | 1970 |
| 221 | Ga0207663_10365566 | 3300025916 | Bacteria | 1096 |
| 222 | Ga0207660_10034701 | 3300025917 | Bacteria | 3497 |
| 223 | Ga0207660_10047074 | 3300025917 | Bacteria | 3047 |
| 224 | Ga0207662_10023453 | 3300025918 | Bacteria | 3545 |
| 225 | Ga0207657_10003006 | 3300025919 | Bacteria | 18068 |
| 226 | Ga0207649_10003938 | 3300025920 | Bacteria | 8099 |
| 227 | Ga0207649_10006351 | 3300025920 | Bacteria | 6423 |
| 228 | Ga0207646_10000143 | 3300025922 | Bacteria | 97493 |
| 229 | Ga0207646_10000394 | 3300025922 | Bacteria | 58624 |
| 230 | Ga0207646_10000668 | 3300025922 | Bacteria | 44376 |
| 231 | Ga0207646_10001744 | 3300025922 | Bacteria | 26445 |
| 232 | Ga0207646_10005654 | 3300025922 | Bacteria | 13120 |
| 233 | Ga0207646_10017539 | 3300025922 | Bacteria | 6697 |
| 234 | Ga0207646_10033781 | 3300025922 | Bacteria | 4624 |
| 235 | Ga0207646_10103108 | 3300025922 | Bacteria | 2558 |
| 236 | Ga0207646_10230501 | 3300025922 | Bacteria | 1673 |
| 237 | Ga0207646_10230535 | 3300025922 | Bacteria | 1673 |
| 238 | Ga0207646_10578177 | 3300025922 | Bacteria | 1009 |
| 239 | Ga0207681_10027152 | 3300025923 | Bacteria | 3699 |
| 240 | Ga0207650_10157615 | 3300025925 | Unclassified | 1796 |
| 241 | Ga0207659_10009763 | 3300025926 | Bacteria | 6003 |
| 242 | Ga0207687_10047613 | 3300025927 | Bacteria | 2973 |
| 243 | Ga0207700_10066664 | 3300025928 | Bacteria | 2752 |
| 244 | Ga0207664_10001273 | 3300025929 | Bacteria | 16631 |
| 245 | Ga0207644_10033413 | 3300025931 | Bacteria | 3594 |
| 246 | Ga0207644_10171807 | 3300025931 | Bacteria | 1693 |
| 247 | Ga0207690_10045187 | 3300025932 | Bacteria | 2908 |
| 248 | Ga0207706_10002541 | 3300025933 | Bacteria | 17781 |
| 249 | Ga0207686_10113734 | 3300025934 | Unclassified | 1830 |
| 250 | Ga0207709_10000097 | 3300025935 | Bacteria | 136507 |
| 251 | Ga0207709_10113365 | 3300025935 | Unclassified | 1817 |
| 252 | Ga0207670_10013450 | 3300025936 | Bacteria | 4827 |
| 253 | Ga0207670_10051099 | 3300025936 | Bacteria | 2774 |
| 254 | Ga0207669_10001785 | 3300025937 | Bacteria | 9123 |
| 255 | Ga0207704_10001466 | 3300025938 | Bacteria | 10546 |
| 256 | Ga0207704_10102930 | 3300025938 | Bacteria | 1909 |
| 257 | Ga0207665_10027217 | 3300025939 | Bacteria | 3778 |
| 258 | Ga0207665_10190708 | 3300025939 | Bacteria | 1489 |
| 259 | Ga0207665_10307824 | 3300025939 | Bacteria | 1186 |
| 260 | Ga0207665_10313529 | 3300025939 | Bacteria | 1175 |
| 261 | Ga0207691_10000955 | 3300025940 | Bacteria | 28629 |
| 262 | Ga0207691_10041727 | 3300025940 | Bacteria | 4234 |
| 263 | Ga0207689_10014066 | 3300025942 | Bacteria | 6811 |
| 264 | Ga0207689_10269063 | 3300025942 | Bacteria | 1411 |
| 265 | Ga0207661_10090706 | 3300025944 | Bacteria | 2545 |
| 266 | Ga0207679_10000541 | 3300025945 | Bacteria | 25439 |
| 267 | Ga0207679_10030510 | 3300025945 | Bacteria | 3765 |
| 268 | Ga0207651_10130399 | 3300025960 | Bacteria | 1923 |
| 269 | Ga0207668_10050776 | 3300025972 | Bacteria | 2860 |
| 270 | Ga0207658_10098720 | 3300025986 | Unclassified | 2282 |
| 271 | Ga0207678_10094564 | 3300026067 | Bacteria | 2554 |
| 272 | Ga0207708_10000561 | 3300026075 | Bacteria | 28687 |
| 273 | Ga0207648_10000083 | 3300026089 | Bacteria | 89416 |
| 274 | Ga0207648_10001233 | 3300026089 | Bacteria | 28717 |
| 275 | Ga0207676_10239087 | 3300026095 | Bacteria | 1628 |
| 276 | Ga0207674_10051238 | 3300026116 | Bacteria | 4213 |
| 277 | Ga0207674_10286345 | 3300026116 | Bacteria | 1596 |
| 278 | Ga0207683_10000895 | 3300026121 | Bacteria | 27406 |
| 279 | Ga0207683_10276926 | 3300026121 | Bacteria | 1533 |
| 280 | Ga0209973_1002123 | 3300027252 | Unclassified | 1817 |
| 281 | Ga0209969_1000104 | 3300027360 | Bacteria | 10560 |
| 282 | Ga0209967_1000038 | 3300027364 | Bacteria | 16833 |
| 283 | Ga0209981_1000268 | 3300027378 | Bacteria | 6709 |
| 284 | Ga0209996_1000062 | 3300027395 | Bacteria | 14921 |
| 285 | Ga0209984_1000027 | 3300027424 | Bacteria | 15251 |
| 286 | Ga0210000_1000018 | 3300027462 | Bacteria | 28094 |
| 287 | Ga0209995_1000015 | 3300027471 | Bacteria | 26669 |
| 288 | Ga0209968_1000052 | 3300027526 | Bacteria | 21189 |
| 289 | Ga0209982_1000018 | 3300027552 | Bacteria | 15162 |
| 290 | Ga0209970_1000260 | 3300027614 | Bacteria | 8679 |
| 291 | Ga0210002_1000043 | 3300027617 | Bacteria | 19508 |
| 292 | Ga0209588_1000036 | 3300027671 | Bacteria | 65612 |
| 293 | Ga0209971_1000266 | 3300027682 | Bacteria | 14793 |
| 294 | Ga0209971_1009970 | 3300027682 | Bacteria | 2247 |
| 295 | Ga0209966_1000180 | 3300027695 | Bacteria | 25869 |
| 296 | Ga0209998_10000137 | 3300027717 | Bacteria | 28713 |
| 297 | Ga0209974_10003579 | 3300027876 | Bacteria | 5585 |
| 298 | Ga0207428_10000452 | 3300027907 | Bacteria | 49793 |
| 299 | Ga0268265_10007292 | 3300028380 | Bacteria | 7469 |
| 300 | Ga0268264_10319587 | 3300028381 | Bacteria | 1467 |
| 301 | Ga0316182_1102604 | 3300030745 | Bacteria | 1151 |
| 302 | Ga0265325_10039150 | 3300031241 | Bacteria | 2498 |
| 303 | Ga0307408_100139674 | 3300031548 | Bacteria | 1900 |
| 304 | Ga0307405_10396215 | 3300031731 | Bacteria | 1079 |
| 305 | Ga0307405_10668491 | 3300031731 | Bacteria | 856 |
| 306 | Ga0307413_10052889 | 3300031824 | Bacteria | 2456 |
| 307 | Ga0307413_10268332 | 3300031824 | Bacteria | 1276 |
| 308 | Ga0307410_10175784 | 3300031852 | Bacteria | 1617 |
| 309 | Ga0307406_10164704 | 3300031901 | Bacteria | 1598 |
| 310 | Ga0307407_10090510 | 3300031903 | Bacteria | 1874 |
| 311 | Ga0307407_10365109 | 3300031903 | Bacteria | 1026 |
| 312 | Ga0307409_100092397 | 3300031995 | Bacteria | 2483 |
| 313 | Ga0307409_100336532 | 3300031995 | Bacteria | 1418 |
| 314 | Ga0307416_100076811 | 3300032002 | Bacteria | 2801 |
| 315 | Ga0307416_100216144 | 3300032002 | Bacteria | 1834 |
| 316 | Ga0307414_10054992 | 3300032004 | Bacteria | 2785 |
| 317 | Ga0307414_10095671 | 3300032004 | Bacteria | 2220 |
| 318 | Ga0307411_10096077 | 3300032005 | Bacteria | 2082 |
| 319 | Ga0307415_100316471 | 3300032126 | Bacteria | 1299 |
| 320 | Ga0307415_100514262 | 3300032126 | Bacteria | 1049 |
| 321 | Ga0373931_0078226 | 3300035691 | Unclassified | 1819 |
| 322 | Ga0373935_0190004 | 3300035692 | Bacteria | 1414 |
| 323 | Ga0373933_0029081 | 3300035724 | Bacteria | 3192 |
| 324 | Ga0316582_0007903 | 3300036647 | Bacteria | 5685 |
| 325 | Ga0373925_0039769 | 3300037068 | Bacteria | 3480 |
| 326 | Ga0316581_0012351 | 3300037588 | Bacteria | 2403 |
| 327 | Ga0436364_0367212 | 3300037853 | Bacteria | 15974 |
| 328 | Ga0436364_1270093 | 3300037853 | Bacteria | 2392 |
| 329 | Ga0400483_168849 | 3300039062 | Bacteria | 24271 |
| 330 | Ga0436365_0222942 | 3300039437 | Bacteria | 6189 |
| 331 | Ga0436365_1544784 | 3300039437 | Bacteria | 5536 |
| 332 | Ga0436365_1662543 | 3300039437 | Bacteria | 16980 |
| 333 | Ga0436363_0133663 | 3300039450 | Bacteria | 6873 |
| 334 | Ga0436363_0145734 | 3300039450 | Bacteria | 3290 |
| 335 | Ga0439453_0000086 | 3300041408 | Bacteria | 7091 |
| 336 | Ga0439437_007560 | 3300042000 | Bacteria | 1215 |
| 337 | Ga0450889_004721 | 3300042144 | Bacteria | 1349 |
| 338 | Ga0450889_006936 | 3300042144 | Bacteria | 1140 |
| 339 | Ga0451577_0000006 | 3300042876 | Bacteria | 709265 |
| 340 | Ga0451577_0341592 | 3300042876 | Unclassified | 1358 |
| 341 | Ga0453683_0000088 | 3300044673 | Bacteria | 138620 |
| 342 | Ga0453683_0149263 | 3300044673 | Bacteria | 1477 |
| 343 | Ga0466966_0216255 | 3300044684 | Bacteria | 1157 |
| 344 | Ga0466961_0009202 | 3300044693 | Bacteria | 6289 |
| 345 | Ga0466963_0001026 | 3300044694 | Bacteria | 14486 |
| 346 | Ga0466963_0363027 | 3300044694 | Bacteria | 1020 |
| 347 | Ga0453684_0000037 | 3300044712 | Bacteria | 709327 |
| 348 | Ga0453684_0008501 | 3300044712 | Bacteria | 18357 |
| 349 | Ga0453684_0025015 | 3300044712 | Bacteria | 8688 |
| 350 | Ga0453684_0043756 | 3300044712 | Bacteria | 6010 |
| 351 | Ga0453684_0057007 | 3300044712 | Bacteria | 5063 |
| 352 | Ga0453684_0086711 | 3300044712 | Bacteria | 3883 |
| 353 | Ga0466970_0034497 | 3300044765 | Bacteria | 2679 |
| 354 | Ga0466957_0069240 | 3300044842 | Bacteria | 2180 |
| 355 | Ga0466959_0000810 | 3300045049 | Bacteria | 18412 |
| 356 | Ga0466959_0146969 | 3300045049 | Bacteria | 1663 |
| 357 | Ga0451576_0000298 | 3300045051 | Bacteria | 120202 |
| 358 | Ga0451576_0005300 | 3300045051 | Bacteria | 16207 |
| 359 | Ga0451576_0047121 | 3300045051 | Bacteria | 4533 |
| 360 | Ga0451576_0310218 | 3300045051 | Bacteria | 1650 |
| 361 | Ga0466958_0001100 | 3300045836 | Bacteria | 12465 |
| 362 | Ga0466958_0210397 | 3300045836 | Bacteria | 1239 |
| 363 | Ga0466967_0062465 | 3300045976 | Bacteria | 3306 |
| 364 | Ga0495591_060169 | 3300046458 | Bacteria | 1011 |
| 365 | Ga0495629_0043853 | 3300046459 | Bacteria | 3140 |
| 366 | Ga0495662_0114250 | 3300046476 | Bacteria | 1324 |
| 367 | Ga0495584_0108087 | 3300046491 | Bacteria | 1407 |
| 368 | Ga0495594_0044035 | 3300046499 | Bacteria | 2447 |
| 369 | Ga0495630_0023183 | 3300046517 | Bacteria | 4588 |
| 370 | Ga0495657_0003784 | 3300046675 | Bacteria | 12244 |
| 371 | Ga0495624_0068025 | 3300046690 | Bacteria | 2221 |
| 372 | Ga0495600_0112103 | 3300046809 | Bacteria | 1776 |
| 373 | Ga0495581_0106549 | 3300047315 | Bacteria | 1629 |
| 374 | Ga0495674_0408008 | 3300047319 | Bacteria | 1096 |
| 375 | Ga0495676_0043484 | 3300047321 | Bacteria | 3675 |
| 376 | Ga0495680_0029262 | 3300047322 | Bacteria | 4511 |
| 377 | Ga0496110_0336238 | 3300048913 | Unclassified | 1376 |
| 378 | Ga0501032_0016350 | 3300049569 | Bacteria | 5220 |
| 379 | Ga0501032_0086233 | 3300049569 | Bacteria | 2087 |
| 380 | Ga0501033_0075609 | 3300049570 | Bacteria | 2472 |
| 381 | Ga0501036_0130131 | 3300049572 | Bacteria | 2125 |
| 382 | Ga0501037_0045287 | 3300049573 | Bacteria | 3230 |
| 383 | Ga0501038_0002519 | 3300049574 | Bacteria | 17073 |
| 384 | Ga0501038_0116576 | 3300049574 | Bacteria | 2207 |
| 385 | Ga0501039_0048103 | 3300049575 | Bacteria | 3297 |
| 386 | Ga0501039_0147062 | 3300049575 | Bacteria | 1851 |
| 387 | Ga0501039_0155387 | 3300049575 | Bacteria | 1797 |
| 388 | Ga0501040_0060308 | 3300049576 | Bacteria | 2607 |
| 389 | Ga0501040_0131209 | 3300049576 | Bacteria | 1762 |
| 390 | Ga0501041_0007026 | 3300049577 | Bacteria | 6607 |
| 391 | Ga0501042_0005863 | 3300049578 | Bacteria | 7940 |
| 392 | Ga0501042_0269598 | 3300049578 | Bacteria | 1229 |
| 393 | Ga0501043_0202306 | 3300049579 | Bacteria | 1541 |
| 394 | Ga0501046_0013923 | 3300049580 | Bacteria | 6793 |
| 395 | Ga0501046_0017452 | 3300049580 | Bacteria | 5990 |
| 396 | Ga0501047_0112209 | 3300049581 | Bacteria | 2608 |
| 397 | Ga0501048_0201899 | 3300049582 | Bacteria | 1409 |
| 398 | Ga0501069_0053996 | 3300049585 | Bacteria | 2238 |
| 399 | Ga0501070_0241693 | 3300049586 | Bacteria | 1478 |
| 400 | Ga0501071_0020859 | 3300049587 | Bacteria | 4558 |
| 401 | Ga0501072_0021548 | 3300049588 | Bacteria | 4998 |
| 402 | Ga0501072_0044375 | 3300049588 | Bacteria | 3496 |
| 403 | Ga0501075_0022983 | 3300049591 | Bacteria | 4561 |
| 404 | Ga0501075_0173693 | 3300049591 | Bacteria | 1644 |
| 405 | Ga0501076_0021046 | 3300049592 | Bacteria | 4998 |
| 406 | Ga0501076_0162505 | 3300049592 | Bacteria | 1820 |
| 407 | Ga0501209_150795 | 3300049656 | Bacteria | 700 |
| 408 | Ga0501221_008057 | 3300049704 | Bacteria | 1824 |
| 409 | Ga0501079_0081357 | 3300049741 | Bacteria | 2504 |
| 410 | Ga0501079_0437783 | 3300049741 | Bacteria | 1026 |
| 411 | Ga0501079_0445035 | 3300049741 | Bacteria | 1017 |
| 412 | Ga0501080_0090233 | 3300049742 | Bacteria | 2847 |
| 413 | Ga0501080_0166791 | 3300049742 | Bacteria | 2032 |
| 414 | Ga0501081_0019551 | 3300049743 | Bacteria | 4510 |
| 415 | Ga0501081_0211390 | 3300049743 | Bacteria | 1409 |
| 416 | Ga0501035_0012778 | 3300049822 | Bacteria | 7756 |
| 417 | Ga0501035_0408060 | 3300049822 | Bacteria | 1129 |
| 418 | Ga0501045_0095074 | 3300049824 | Bacteria | 2204 |
| 419 | Ga0501212_001657 | 3300049851 | Bacteria | 2549 |
| 420 | nmdc:mga03n38_66559_c1 | 3300050490 | Bacteria | 1655 |
| 421 | nmdc:mga0yw44_375828_c1 | 3300050492 | Bacteria | 959 |
| 422 | nmdc:mga04h51_57298_c1 | 3300050495 | Bacteria | 1325 |
| 423 | nmdc:mga05p37_150384_c1 | 3300050507 | Bacteria | 2848 |
| 424 | nmdc:mga05p37_16103_c1 | 3300050507 | Bacteria | 9000 |
| 425 | nmdc:mga05p37_335929_c1 | 3300050507 | Bacteria | 1783 |
| 426 | nmdc:mga05p37_431200_c1 | 3300050507 | Bacteria | 1531 |
| 427 | nmdc:mga05p37_49727_c1 | 3300050507 | Bacteria | 5157 |
| 428 | nmdc:mga09592_285521_c1 | 3300050508 | Unclassified | 1431 |
| 429 | nmdc:mga0qj67_14052_c1 | 3300050509 | Bacteria | 6046 |
| 430 | nmdc:mga0qj67_2019_c1 | 3300050509 | Bacteria | 10913 |
| 431 | nmdc:mga0qj67_25295_c1 | 3300050509 | Bacteria | 4586 |
| 432 | nmdc:mga0qj67_46834_c1 | 3300050509 | Bacteria | 3414 |
| 433 | nmdc:mga06r32_27115_c1 | 3300050510 | Bacteria | 5348 |
| 434 | nmdc:mga06r32_3627_c1 | 3300050510 | Bacteria | 13776 |
| 435 | nmdc:mga06r32_37753_c1 | 3300050510 | Bacteria | 4570 |
| 436 | nmdc:mga08y16_238397_c1 | 3300050511 | Bacteria | 1881 |
| 437 | nmdc:mga0n895_375668_c1 | 3300050512 | Bacteria | 1439 |
| 438 | nmdc:mga0n895_478423_c1 | 3300050512 | Bacteria | 1256 |
| 439 | nmdc:mga0n895_77732_c1 | 3300050512 | Bacteria | 3302 |
| 440 | nmdc:mga0rr50_546936_c1 | 3300050513 | Bacteria | 986 |
| 441 | nmdc:mga0rr50_88436_c1 | 3300050513 | Bacteria | 2407 |
| 442 | nmdc:mga08x19_164304_c1 | 3300050514 | Bacteria | 1509 |
| 443 | nmdc:mga08x19_319527_c1 | 3300050514 | Bacteria | 1080 |
| 444 | nmdc:mga08x19_375111_c1 | 3300050514 | Bacteria | 996 |
| 445 | nmdc:mga08x19_55626_c1 | 3300050514 | Bacteria | 2551 |
| 446 | nmdc:mga08x19_63277_c1 | 3300050514 | Bacteria | 2400 |
| 447 | nmdc:mga0a205_186553_c1 | 3300050515 | Bacteria | 1967 |
| 448 | nmdc:mga0a205_23315_c1 | 3300050515 | Bacteria | 4418 |
| 449 | nmdc:mga0a205_404340_c1 | 3300050515 | Bacteria | 1229 |
| 450 | nmdc:mga0a205_8227_c1 | 3300050515 | Bacteria | 9480 |
| 451 | nmdc:mga0a205_97995_c1 | 3300050515 | Bacteria | 2831 |
| 452 | Ga0495601_0058326 | 3300053077 | Bacteria | 2446 |
| 453 | Ga0500635_0005767 | 3300053080 | Bacteria | 3272 |
| 454 | Ga0495619_0031129 | 3300053085 | Bacteria | 3456 |
| 455 | Ga0495619_0031481 | 3300053085 | Bacteria | 3437 |
| 456 | Ga0501084_0269216 | 3300054114 | Bacteria | 1438 |
| 457 | Ga0590075_004314 | 3300059424 | Bacteria | 3366 |
| 458 | Ga0590075_005913 | 3300059424 | Bacteria | 2893 |
| 459 | Ga0590075_033582 | 3300059424 | Bacteria | 1303 |
| 460 | Ga0501082_0052100 | 3300060353 | Bacteria | 3527 |
| 461 | Ga0501082_0253440 | 3300060353 | Bacteria | 1531 |
| 462 | Ga0530510_0198298 | 3300061734 | Bacteria | 1490 |
| 463 | Ga0530510_0244239 | 3300061734 | Bacteria | 1337 |
| 464 | Ga0530510_0278578 | 3300061734 | Bacteria | 1249 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026116 | Ga0207674_10286345 | Ga0207674_102863452 | 202 |
| 2 | 3300044673 | Ga0453683_0149263 | Ga0453683_0149263_302_949 | 214 |
| 3 | 3300044712 | Ga0453684_0043756 | Ga0453684_0043756_3168_3815 | 214 |
| 4 | 3300045051 | Ga0451576_0005300 | Ga0451576_0005300_9056_9703 | 214 |
| 5 | 3300049656 | Ga0501209_150795 | Ga0501209_150795_22_675 | 215 |
| 6 | 3300042144 | Ga0450889_004721 | Ga0450889_004721_288_1013 | 226 |
| 7 | 3300049575 | Ga0501039_0048103 | Ga0501039_0048103_2539_3252 | 226 |
| 8 | 3300053077 | Ga0495601_0058326 | Ga0495601_0058326_20_712 | 230 |
| 9 | 3300042876 | Ga0451577_0000006 | Ga0451577_0000006_419134_419883 | 234 |
| 10 | 3300044673 | Ga0453683_0000088 | Ga0453683_0000088_137224_137973 | 234 |
| 11 | 3300044712 | Ga0453684_0000037 | Ga0453684_0000037_419129_419878 | 234 |
| 12 | 3300045051 | Ga0451576_0047121 | Ga0451576_0047121_2287_3036 | 234 |
| 13 | 3300005467 | Ga0070706_100011793 | Ga0070706_1000117936 | 236 |
| 14 | 3300006051 | Ga0075364_10047604 | Ga0075364_100476042 | 236 |
| 15 | 3300006178 | Ga0075367_10010858 | Ga0075367_100108582 | 236 |
| 16 | 3300050490 | nmdc:mga03n38_66559_c1 | nmdc:mga03n38_66559_c1_583_1293 | 236 |
| 17 | 3300050492 | nmdc:mga0yw44_375828_c1 | nmdc:mga0yw44_375828_c1_213_938 | 236 |
| 18 | 3300050495 | nmdc:mga04h51_57298_c1 | nmdc:mga04h51_57298_c1_48_758 | 236 |
| 19 | 3300004803 | Ga0058862_12677821 | Ga0058862_126778211 | 237 |
| 20 | 3300004803 | Ga0058862_12781598 | Ga0058862_127815983 | 237 |
| 21 | 3300021384 | Ga0213876_10016993 | Ga0213876_100169931 | 237 |
| 22 | 3300031903 | Ga0307407_10090510 | Ga0307407_100905102 | 237 |
| 23 | 3300031903 | Ga0307407_10365109 | Ga0307407_103651092 | 237 |
| 24 | 3300031995 | Ga0307409_100092397 | Ga0307409_1000923975 | 237 |
| 25 | 3300032002 | Ga0307416_100076811 | Ga0307416_1000768112 | 237 |
| 26 | 3300032005 | Ga0307411_10096077 | Ga0307411_100960773 | 237 |
| 27 | 3300059424 | Ga0590075_004314 | Ga0590075_004314_2142_2870 | 237 |
| 28 | 3300030745 | Ga0316182_1102604 | Ga0316182_11026042 | 242 |
| 29 | 3300005295 | Ga0065707_10157277 | Ga0065707_101572772 | 247 |
| 30 | 3300009094 | Ga0111539_10493398 | Ga0111539_104933982 | 247 |
| 31 | 3300009147 | Ga0114129_10025977 | Ga0114129_100259777 | 247 |
| 32 | 3300046517 | Ga0495630_0023183 | Ga0495630_0023183_3416_4159 | 247 |
| 33 | 3300050507 | nmdc:mga05p37_49727_c1 | nmdc:mga05p37_49727_c1_4018_4764 | 247 |
| 34 | 3300053080 | Ga0500635_0005767 | Ga0500635_0005767_548_1291 | 247 |
| 35 | 3300001977 | JGI24746J21847_1000439 | JGI24746J21847_10004395 | 248 |
| 36 | 3300005328 | Ga0070676_10089255 | Ga0070676_100892552 | 248 |
| 37 | 3300005344 | Ga0070661_100025478 | Ga0070661_1000254783 | 248 |
| 38 | 3300005435 | Ga0070714_100272636 | Ga0070714_1002726362 | 248 |
| 39 | 3300005444 | Ga0070694_100033008 | Ga0070694_1000330085 | 248 |
| 40 | 3300005445 | Ga0070708_100234209 | Ga0070708_1002342093 | 248 |
| 41 | 3300005459 | Ga0068867_100000218 | Ga0068867_10000021817 | 248 |
| 42 | 3300005468 | Ga0070707_100250604 | Ga0070707_1002506042 | 248 |
| 43 | 3300005468 | Ga0070707_100578572 | Ga0070707_1005785721 | 248 |
| 44 | 3300005471 | Ga0070698_100473801 | Ga0070698_1004738011 | 248 |
| 45 | 3300005471 | Ga0070698_100558399 | Ga0070698_1005583992 | 248 |
| 46 | 3300005471 | Ga0070698_100659716 | Ga0070698_1006597162 | 248 |
| 47 | 3300005518 | Ga0070699_100046351 | Ga0070699_1000463511 | 248 |
| 48 | 3300005518 | Ga0070699_100378282 | Ga0070699_1003782822 | 248 |
| 49 | 3300005536 | Ga0070697_100000351 | Ga0070697_10000035143 | 248 |
| 50 | 3300005536 | Ga0070697_100445092 | Ga0070697_1004450922 | 248 |
| 51 | 3300005545 | Ga0070695_100005251 | Ga0070695_1000052519 | 248 |
| 52 | 3300005718 | Ga0068866_10018240 | Ga0068866_100182402 | 248 |
| 53 | 3300006871 | Ga0075434_100207960 | Ga0075434_1002079603 | 248 |
| 54 | 3300009147 | Ga0114129_10418863 | Ga0114129_104188632 | 248 |
| 55 | 3300009147 | Ga0114129_10630303 | Ga0114129_106303032 | 248 |
| 56 | 3300009148 | Ga0105243_10000049 | Ga0105243_10000049138 | 248 |
| 57 | 3300014745 | Ga0157377_10040483 | Ga0157377_100404833 | 248 |
| 58 | 3300014969 | Ga0157376_10011279 | Ga0157376_100112793 | 248 |
| 59 | 3300025907 | Ga0207645_10193102 | Ga0207645_101931022 | 248 |
| 60 | 3300025910 | Ga0207684_10002609 | Ga0207684_100026092 | 248 |
| 61 | 3300025910 | Ga0207684_10022921 | Ga0207684_100229215 | 248 |
| 62 | 3300025910 | Ga0207684_10139657 | Ga0207684_101396574 | 248 |
| 63 | 3300025920 | Ga0207649_10006351 | Ga0207649_100063513 | 248 |
| 64 | 3300025922 | Ga0207646_10001744 | Ga0207646_1000174426 | 248 |
| 65 | 3300025922 | Ga0207646_10230535 | Ga0207646_102305352 | 248 |
| 66 | 3300025935 | Ga0207709_10000097 | Ga0207709_1000009716 | 248 |
| 67 | 3300025938 | Ga0207704_10102930 | Ga0207704_101029302 | 248 |
| 68 | 3300025945 | Ga0207679_10000541 | Ga0207679_1000054128 | 248 |
| 69 | 3300026089 | Ga0207648_10000083 | Ga0207648_1000008375 | 248 |
| 70 | 3300031241 | Ga0265325_10039150 | Ga0265325_100391502 | 248 |
| 71 | 3300039062 | Ga0400483_168849 | Ga0400483_168849_11403_12170 | 248 |
| 72 | 3300041408 | Ga0439453_0000086 | Ga0439453_0000086_5288_6121 | 248 |
| 73 | 3300042144 | Ga0450889_006936 | Ga0450889_006936_162_956 | 248 |
| 74 | 3300044712 | Ga0453684_0057007 | Ga0453684_0057007_1071_1841 | 248 |
| 75 | 3300049578 | Ga0501042_0269598 | Ga0501042_0269598_431_1183 | 248 |
| 76 | 3300049586 | Ga0501070_0241693 | Ga0501070_0241693_439_1233 | 248 |
| 77 | 3300049588 | Ga0501072_0021548 | Ga0501072_0021548_635_1387 | 248 |
| 78 | 3300049741 | Ga0501079_0445035 | Ga0501079_0445035_98_850 | 248 |
| 79 | 3300049742 | Ga0501080_0166791 | Ga0501080_0166791_269_1021 | 248 |
| 80 | 3300049743 | Ga0501081_0019551 | Ga0501081_0019551_2217_2969 | 248 |
| 81 | 3300050507 | nmdc:mga05p37_335929_c1 | nmdc:mga05p37_335929_c1_346_1101 | 248 |
| 82 | 3300050507 | nmdc:mga05p37_431200_c1 | nmdc:mga05p37_431200_c1_501_1256 | 248 |
| 83 | 3300050514 | nmdc:mga08x19_319527_c1 | nmdc:mga08x19_319527_c1_148_897 | 248 |
| 84 | 3300050515 | nmdc:mga0a205_404340_c1 | nmdc:mga0a205_404340_c1_115_864 | 248 |
| 85 | 3300061734 | Ga0530510_0244239 | Ga0530510_0244239_267_1019 | 248 |
| 86 | 2162886007 | SwRhRL2b_contig_3021854 | SwRhRL2b_0356.00001310 | 249 |
| 87 | 3300005289 | Ga0065704_10094280 | Ga0065704_100942802 | 249 |
| 88 | 3300005295 | Ga0065707_10117488 | Ga0065707_101174882 | 249 |
| 89 | 3300005295 | Ga0065707_10124509 | Ga0065707_101245093 | 249 |
| 90 | 3300005328 | Ga0070676_10002352 | Ga0070676_100023522 | 249 |
| 91 | 3300005329 | Ga0070683_100029138 | Ga0070683_1000291386 | 249 |
| 92 | 3300005330 | Ga0070690_100001487 | Ga0070690_1000014878 | 249 |
| 93 | 3300005330 | Ga0070690_100025120 | Ga0070690_1000251203 | 249 |
| 94 | 3300005331 | Ga0070670_100007145 | Ga0070670_10000714517 | 249 |
| 95 | 3300005333 | Ga0070677_10000876 | Ga0070677_1000087619 | 249 |
| 96 | 3300005334 | Ga0068869_100002424 | Ga0068869_1000024243 | 249 |
| 97 | 3300005335 | Ga0070666_10056014 | Ga0070666_100560145 | 249 |
| 98 | 3300005336 | Ga0070680_100001398 | Ga0070680_10000139810 | 249 |
| 99 | 3300005337 | Ga0070682_100039950 | Ga0070682_1000399503 | 249 |
| 100 | 3300005338 | Ga0068868_100436321 | Ga0068868_1004363212 | 249 |
| 101 | 3300005339 | Ga0070660_100018135 | Ga0070660_1000181358 | 249 |
| 102 | 3300005340 | Ga0070689_100047490 | Ga0070689_1000474906 | 249 |
| 103 | 3300005341 | Ga0070691_10034998 | Ga0070691_100349984 | 249 |
| 104 | 3300005343 | Ga0070687_100018120 | Ga0070687_1000181203 | 249 |
| 105 | 3300005343 | Ga0070687_100220404 | Ga0070687_1002204041 | 249 |
| 106 | 3300005344 | Ga0070661_100004891 | Ga0070661_10000489110 | 249 |
| 107 | 3300005345 | Ga0070692_10105828 | Ga0070692_101058282 | 249 |
| 108 | 3300005347 | Ga0070668_100039054 | Ga0070668_1000390543 | 249 |
| 109 | 3300005353 | Ga0070669_100070016 | Ga0070669_1000700162 | 249 |
| 110 | 3300005355 | Ga0070671_100021110 | Ga0070671_1000211103 | 249 |
| 111 | 3300005356 | Ga0070674_100011117 | Ga0070674_1000111178 | 249 |
| 112 | 3300005364 | Ga0070673_100028371 | Ga0070673_1000283712 | 249 |
| 113 | 3300005364 | Ga0070673_100746429 | Ga0070673_1007464291 | 249 |
| 114 | 3300005366 | Ga0070659_100118915 | Ga0070659_1001189153 | 249 |
| 115 | 3300005406 | Ga0070703_10005450 | Ga0070703_100054503 | 249 |
| 116 | 3300005435 | Ga0070714_100027086 | Ga0070714_1000270868 | 249 |
| 117 | 3300005435 | Ga0070714_100091616 | Ga0070714_1000916162 | 249 |
| 118 | 3300005435 | Ga0070714_100321409 | Ga0070714_1003214092 | 249 |
| 119 | 3300005436 | Ga0070713_100021996 | Ga0070713_1000219962 | 249 |
| 120 | 3300005437 | Ga0070710_10306865 | Ga0070710_103068651 | 249 |
| 121 | 3300005439 | Ga0070711_100457267 | Ga0070711_1004572672 | 249 |
| 122 | 3300005440 | Ga0070705_100015576 | Ga0070705_1000155763 | 249 |
| 123 | 3300005440 | Ga0070705_100025577 | Ga0070705_1000255772 | 249 |
| 124 | 3300005440 | Ga0070705_100030655 | Ga0070705_1000306554 | 249 |
| 125 | 3300005440 | Ga0070705_100091803 | Ga0070705_1000918032 | 249 |
| 126 | 3300005440 | Ga0070705_100125705 | Ga0070705_1001257051 | 249 |
| 127 | 3300005440 | Ga0070705_100261142 | Ga0070705_1002611422 | 249 |
| 128 | 3300005441 | Ga0070700_100007161 | Ga0070700_1000071617 | 249 |
| 129 | 3300005444 | Ga0070694_100050477 | Ga0070694_1000504772 | 249 |
| 130 | 3300005445 | Ga0070708_100000027 | Ga0070708_1000000276 | 249 |
| 131 | 3300005445 | Ga0070708_100001490 | Ga0070708_1000014905 | 249 |
| 132 | 3300005445 | Ga0070708_100049189 | Ga0070708_1000491893 | 249 |
| 133 | 3300005445 | Ga0070708_100059463 | Ga0070708_1000594632 | 249 |
| 134 | 3300005445 | Ga0070708_100170936 | Ga0070708_1001709363 | 249 |
| 135 | 3300005455 | Ga0070663_100110033 | Ga0070663_1001100332 | 249 |
| 136 | 3300005456 | Ga0070678_100000687 | Ga0070678_10000068718 | 249 |
| 137 | 3300005458 | Ga0070681_10007331 | Ga0070681_100073312 | 249 |
| 138 | 3300005459 | Ga0068867_100002011 | Ga0068867_1000020116 | 249 |
| 139 | 3300005467 | Ga0070706_100000117 | Ga0070706_1000001176 | 249 |
| 140 | 3300005467 | Ga0070706_100000547 | Ga0070706_10000054736 | 249 |
| 141 | 3300005467 | Ga0070706_100001931 | Ga0070706_10000193120 | 249 |
| 142 | 3300005467 | Ga0070706_100009741 | Ga0070706_10000974113 | 249 |
| 143 | 3300005467 | Ga0070706_100016257 | Ga0070706_1000162576 | 249 |
| 144 | 3300005468 | Ga0070707_100000060 | Ga0070707_100000060113 | 249 |
| 145 | 3300005468 | Ga0070707_100001828 | Ga0070707_10000182828 | 249 |
| 146 | 3300005468 | Ga0070707_100010596 | Ga0070707_1000105969 | 249 |
| 147 | 3300005468 | Ga0070707_100043111 | Ga0070707_1000431112 | 249 |
| 148 | 3300005468 | Ga0070707_100064893 | Ga0070707_1000648936 | 249 |
| 149 | 3300005468 | Ga0070707_100102186 | Ga0070707_1001021863 | 249 |
| 150 | 3300005468 | Ga0070707_100256847 | Ga0070707_1002568473 | 249 |
| 151 | 3300005468 | Ga0070707_100294316 | Ga0070707_1002943162 | 249 |
| 152 | 3300005471 | Ga0070698_100018273 | Ga0070698_1000182739 | 249 |
| 153 | 3300005471 | Ga0070698_100023059 | Ga0070698_1000230592 | 249 |
| 154 | 3300005471 | Ga0070698_100102838 | Ga0070698_1001028385 | 249 |
| 155 | 3300005471 | Ga0070698_100201083 | Ga0070698_1002010834 | 249 |
| 156 | 3300005471 | Ga0070698_100456312 | Ga0070698_1004563122 | 249 |
| 157 | 3300005518 | Ga0070699_100000685 | Ga0070699_10000068531 | 249 |
| 158 | 3300005518 | Ga0070699_100000784 | Ga0070699_1000007846 | 249 |
| 159 | 3300005518 | Ga0070699_100002925 | Ga0070699_10000292518 | 249 |
| 160 | 3300005518 | Ga0070699_100053088 | Ga0070699_1000530883 | 249 |
| 161 | 3300005518 | Ga0070699_100065427 | Ga0070699_1000654275 | 249 |
| 162 | 3300005518 | Ga0070699_100221941 | Ga0070699_1002219412 | 249 |
| 163 | 3300005535 | Ga0070684_100092388 | Ga0070684_1000923882 | 249 |
| 164 | 3300005536 | Ga0070697_100001474 | Ga0070697_10000147426 | 249 |
| 165 | 3300005536 | Ga0070697_100014335 | Ga0070697_1000143356 | 249 |
| 166 | 3300005536 | Ga0070697_100016182 | Ga0070697_1000161821 | 249 |
| 167 | 3300005536 | Ga0070697_100052182 | Ga0070697_1000521822 | 249 |
| 168 | 3300005536 | Ga0070697_100077619 | Ga0070697_1000776191 | 249 |
| 169 | 3300005536 | Ga0070697_100095218 | Ga0070697_1000952182 | 249 |
| 170 | 3300005536 | Ga0070697_100127760 | Ga0070697_1001277603 | 249 |
| 171 | 3300005536 | Ga0070697_100219435 | Ga0070697_1002194352 | 249 |
| 172 | 3300005536 | Ga0070697_100231399 | Ga0070697_1002313991 | 249 |
| 173 | 3300005543 | Ga0070672_100010522 | Ga0070672_1000105229 | 249 |
| 174 | 3300005543 | Ga0070672_100016350 | Ga0070672_1000163503 | 249 |
| 175 | 3300005544 | Ga0070686_100027236 | Ga0070686_1000272363 | 249 |
| 176 | 3300005545 | Ga0070695_100029506 | Ga0070695_1000295062 | 249 |
| 177 | 3300005545 | Ga0070695_100471286 | Ga0070695_1004712861 | 249 |
| 178 | 3300005546 | Ga0070696_100051210 | Ga0070696_1000512103 | 249 |
| 179 | 3300005546 | Ga0070696_100403131 | Ga0070696_1004031312 | 249 |
| 180 | 3300005547 | Ga0070693_100203796 | Ga0070693_1002037961 | 249 |
| 181 | 3300005547 | Ga0070693_100363412 | Ga0070693_1003634122 | 249 |
| 182 | 3300005549 | Ga0070704_100004934 | Ga0070704_10000493411 | 249 |
| 183 | 3300005549 | Ga0070704_100006043 | Ga0070704_10000604310 | 249 |
| 184 | 3300005549 | Ga0070704_100130670 | Ga0070704_1001306702 | 249 |
| 185 | 3300005564 | Ga0070664_100004346 | Ga0070664_1000043468 | 249 |
| 186 | 3300005577 | Ga0068857_100091178 | Ga0068857_1000911783 | 249 |
| 187 | 3300005618 | Ga0068864_100106443 | Ga0068864_1001064435 | 249 |
| 188 | 3300005618 | Ga0068864_100191261 | Ga0068864_1001912611 | 249 |
| 189 | 3300005718 | Ga0068866_10025428 | Ga0068866_100254283 | 249 |
| 190 | 3300005842 | Ga0068858_100131773 | Ga0068858_1001317734 | 249 |
| 191 | 3300005843 | Ga0068860_100029433 | Ga0068860_1000294338 | 249 |
| 192 | 3300005844 | Ga0068862_100007798 | Ga0068862_1000077982 | 249 |
| 193 | 3300005937 | Ga0081455_10003827 | Ga0081455_1000382710 | 249 |
| 194 | 3300005981 | Ga0081538_10020098 | Ga0081538_100200986 | 249 |
| 195 | 3300005981 | Ga0081538_10022736 | Ga0081538_100227363 | 249 |
| 196 | 3300005981 | Ga0081538_10082674 | Ga0081538_100826743 | 249 |
| 197 | 3300005985 | Ga0081539_10000187 | Ga0081539_10000187153 | 249 |
| 198 | 3300005985 | Ga0081539_10023492 | Ga0081539_100234924 | 249 |
| 199 | 3300006028 | Ga0070717_10000007 | Ga0070717_1000000725 | 249 |
| 200 | 3300006028 | Ga0070717_10008688 | Ga0070717_1000868810 | 249 |
| 201 | 3300006028 | Ga0070717_10034873 | Ga0070717_100348734 | 249 |
| 202 | 3300006173 | Ga0070716_100076540 | Ga0070716_1000765403 | 249 |
| 203 | 3300006237 | Ga0097621_100030761 | Ga0097621_1000307613 | 249 |
| 204 | 3300006237 | Ga0097621_100037374 | Ga0097621_1000373743 | 249 |
| 205 | 3300006358 | Ga0068871_100285934 | Ga0068871_1002859342 | 249 |
| 206 | 3300006844 | Ga0075428_100123908 | Ga0075428_1001239082 | 249 |
| 207 | 3300006844 | Ga0075428_100289686 | Ga0075428_1002896862 | 249 |
| 208 | 3300006846 | Ga0075430_100003584 | Ga0075430_10000358416 | 249 |
| 209 | 3300006846 | Ga0075430_100011986 | Ga0075430_10001198611 | 249 |
| 210 | 3300006847 | Ga0075431_100009425 | Ga0075431_1000094253 | 249 |
| 211 | 3300006847 | Ga0075431_100009466 | Ga0075431_10000946611 | 249 |
| 212 | 3300006852 | Ga0075433_10012940 | Ga0075433_1001294012 | 249 |
| 213 | 3300006852 | Ga0075433_10137694 | Ga0075433_101376943 | 249 |
| 214 | 3300006871 | Ga0075434_100163257 | Ga0075434_1001632572 | 249 |
| 215 | 3300006871 | Ga0075434_100364703 | Ga0075434_1003647032 | 249 |
| 216 | 3300006880 | Ga0075429_100030783 | Ga0075429_1000307837 | 249 |
| 217 | 3300006881 | Ga0068865_100001372 | Ga0068865_10000137225 | 249 |
| 218 | 3300006914 | Ga0075436_100038296 | Ga0075436_1000382962 | 249 |
| 219 | 3300006914 | Ga0075436_100041209 | Ga0075436_1000412093 | 249 |
| 220 | 3300006914 | Ga0075436_100160869 | Ga0075436_1001608691 | 249 |
| 221 | 3300007076 | Ga0075435_100061967 | Ga0075435_1000619672 | 249 |
| 222 | 3300007076 | Ga0075435_100140037 | Ga0075435_1001400374 | 249 |
| 223 | 3300007076 | Ga0075435_100181585 | Ga0075435_1001815853 | 249 |
| 224 | 3300007265 | Ga0099794_10000117 | Ga0099794_1000011723 | 249 |
| 225 | 3300007265 | Ga0099794_10004600 | Ga0099794_100046003 | 249 |
| 226 | 3300007265 | Ga0099794_10225257 | Ga0099794_102252571 | 249 |
| 227 | 3300009098 | Ga0105245_10002155 | Ga0105245_100021552 | 249 |
| 228 | 3300009147 | Ga0114129_10015428 | Ga0114129_1001542813 | 249 |
| 229 | 3300009147 | Ga0114129_10033158 | Ga0114129_100331582 | 249 |
| 230 | 3300009147 | Ga0114129_10119665 | Ga0114129_101196654 | 249 |
| 231 | 3300009147 | Ga0114129_10270489 | Ga0114129_102704894 | 249 |
| 232 | 3300009148 | Ga0105243_10002596 | Ga0105243_100025966 | 249 |
| 233 | 3300009176 | Ga0105242_10001315 | Ga0105242_1000131525 | 249 |
| 234 | 3300009553 | Ga0105249_10001784 | Ga0105249_1000178418 | 249 |
| 235 | 3300010375 | Ga0105239_10132652 | Ga0105239_101326522 | 249 |
| 236 | 3300011119 | Ga0105246_10000933 | Ga0105246_100009339 | 249 |
| 237 | 3300013105 | Ga0157369_10031128 | Ga0157369_100311287 | 249 |
| 238 | 3300013105 | Ga0157369_10667919 | Ga0157369_106679192 | 249 |
| 239 | 3300013296 | Ga0157374_10004664 | Ga0157374_1000466416 | 249 |
| 240 | 3300013297 | Ga0157378_10017169 | Ga0157378_100171692 | 249 |
| 241 | 3300013306 | Ga0163162_10226389 | Ga0163162_102263891 | 249 |
| 242 | 3300014326 | Ga0157380_10015563 | Ga0157380_100155638 | 249 |
| 243 | 3300014326 | Ga0157380_10032645 | Ga0157380_100326454 | 249 |
| 244 | 3300014745 | Ga0157377_10043021 | Ga0157377_100430212 | 249 |
| 245 | 3300014969 | Ga0157376_10000962 | Ga0157376_100009626 | 249 |
| 246 | 3300021384 | Ga0213876_10009713 | Ga0213876_100097134 | 249 |
| 247 | 3300021388 | Ga0213875_10006988 | Ga0213875_100069883 | 249 |
| 248 | 3300022467 | Ga0224712_10179793 | Ga0224712_101797931 | 249 |
| 249 | 3300025885 | Ga0207653_10001462 | Ga0207653_100014626 | 249 |
| 250 | 3300025893 | Ga0207682_10030281 | Ga0207682_100302812 | 249 |
| 251 | 3300025898 | Ga0207692_10263003 | Ga0207692_102630032 | 249 |
| 252 | 3300025899 | Ga0207642_10245301 | Ga0207642_102453012 | 249 |
| 253 | 3300025901 | Ga0207688_10001296 | Ga0207688_1000129623 | 249 |
| 254 | 3300025903 | Ga0207680_10004142 | Ga0207680_1000414211 | 249 |
| 255 | 3300025903 | Ga0207680_10025370 | Ga0207680_100253704 | 249 |
| 256 | 3300025904 | Ga0207647_10095905 | Ga0207647_100959053 | 249 |
| 257 | 3300025907 | Ga0207645_10001331 | Ga0207645_1000133123 | 249 |
| 258 | 3300025910 | Ga0207684_10000002 | Ga0207684_10000002396 | 249 |
| 259 | 3300025910 | Ga0207684_10000026 | Ga0207684_1000002636 | 249 |
| 260 | 3300025910 | Ga0207684_10000148 | Ga0207684_1000014837 | 249 |
| 261 | 3300025910 | Ga0207684_10000222 | Ga0207684_1000022238 | 249 |
| 262 | 3300025910 | Ga0207684_10067051 | Ga0207684_100670511 | 249 |
| 263 | 3300025910 | Ga0207684_10225000 | Ga0207684_102250002 | 249 |
| 264 | 3300025910 | Ga0207684_10285644 | Ga0207684_102856442 | 249 |
| 265 | 3300025910 | Ga0207684_10296857 | Ga0207684_102968571 | 249 |
| 266 | 3300025912 | Ga0207707_10005817 | Ga0207707_100058175 | 249 |
| 267 | 3300025912 | Ga0207707_10037560 | Ga0207707_100375603 | 249 |
| 268 | 3300025915 | Ga0207693_10131173 | Ga0207693_101311733 | 249 |
| 269 | 3300025916 | Ga0207663_10365566 | Ga0207663_103655661 | 249 |
| 270 | 3300025917 | Ga0207660_10034701 | Ga0207660_100347013 | 249 |
| 271 | 3300025917 | Ga0207660_10047074 | Ga0207660_100470743 | 249 |
| 272 | 3300025918 | Ga0207662_10023453 | Ga0207662_100234535 | 249 |
| 273 | 3300025919 | Ga0207657_10003006 | Ga0207657_1000300613 | 249 |
| 274 | 3300025920 | Ga0207649_10003938 | Ga0207649_100039384 | 249 |
| 275 | 3300025922 | Ga0207646_10000143 | Ga0207646_100001436 | 249 |
| 276 | 3300025922 | Ga0207646_10000394 | Ga0207646_1000039437 | 249 |
| 277 | 3300025922 | Ga0207646_10000668 | Ga0207646_1000066838 | 249 |
| 278 | 3300025922 | Ga0207646_10005654 | Ga0207646_100056542 | 249 |
| 279 | 3300025922 | Ga0207646_10017539 | Ga0207646_100175397 | 249 |
| 280 | 3300025922 | Ga0207646_10033781 | Ga0207646_100337816 | 249 |
| 281 | 3300025922 | Ga0207646_10103108 | Ga0207646_101031083 | 249 |
| 282 | 3300025922 | Ga0207646_10230501 | Ga0207646_102305013 | 249 |
| 283 | 3300025922 | Ga0207646_10578177 | Ga0207646_105781771 | 249 |
| 284 | 3300025923 | Ga0207681_10027152 | Ga0207681_100271524 | 249 |
| 285 | 3300025925 | Ga0207650_10157615 | Ga0207650_101576152 | 249 |
| 286 | 3300025926 | Ga0207659_10009763 | Ga0207659_100097639 | 249 |
| 287 | 3300025927 | Ga0207687_10047613 | Ga0207687_100476133 | 249 |
| 288 | 3300025928 | Ga0207700_10066664 | Ga0207700_100666643 | 249 |
| 289 | 3300025929 | Ga0207664_10001273 | Ga0207664_1000127322 | 249 |
| 290 | 3300025931 | Ga0207644_10033413 | Ga0207644_100334133 | 249 |
| 291 | 3300025931 | Ga0207644_10171807 | Ga0207644_101718072 | 249 |
| 292 | 3300025932 | Ga0207690_10045187 | Ga0207690_100451875 | 249 |
| 293 | 3300025933 | Ga0207706_10002541 | Ga0207706_1000254124 | 249 |
| 294 | 3300025934 | Ga0207686_10113734 | Ga0207686_101137343 | 249 |
| 295 | 3300025935 | Ga0207709_10113365 | Ga0207709_101133652 | 249 |
| 296 | 3300025936 | Ga0207670_10013450 | Ga0207670_100134506 | 249 |
| 297 | 3300025936 | Ga0207670_10051099 | Ga0207670_100510995 | 249 |
| 298 | 3300025937 | Ga0207669_10001785 | Ga0207669_100017858 | 249 |
| 299 | 3300025938 | Ga0207704_10001466 | Ga0207704_100014667 | 249 |
| 300 | 3300025939 | Ga0207665_10027217 | Ga0207665_100272175 | 249 |
| 301 | 3300025939 | Ga0207665_10190708 | Ga0207665_101907082 | 249 |
| 302 | 3300025939 | Ga0207665_10307824 | Ga0207665_103078242 | 249 |
| 303 | 3300025939 | Ga0207665_10313529 | Ga0207665_103135292 | 249 |
| 304 | 3300025940 | Ga0207691_10000955 | Ga0207691_1000095525 | 249 |
| 305 | 3300025940 | Ga0207691_10041727 | Ga0207691_100417273 | 249 |
| 306 | 3300025942 | Ga0207689_10014066 | Ga0207689_100140668 | 249 |
| 307 | 3300025942 | Ga0207689_10269063 | Ga0207689_102690633 | 249 |
| 308 | 3300025944 | Ga0207661_10090706 | Ga0207661_100907063 | 249 |
| 309 | 3300025945 | Ga0207679_10030510 | Ga0207679_100305103 | 249 |
| 310 | 3300025960 | Ga0207651_10130399 | Ga0207651_101303992 | 249 |
| 311 | 3300025972 | Ga0207668_10050776 | Ga0207668_100507765 | 249 |
| 312 | 3300025986 | Ga0207658_10098720 | Ga0207658_100987202 | 249 |
| 313 | 3300026067 | Ga0207678_10094564 | Ga0207678_100945643 | 249 |
| 314 | 3300026075 | Ga0207708_10000561 | Ga0207708_1000056124 | 249 |
| 315 | 3300026089 | Ga0207648_10001233 | Ga0207648_1000123325 | 249 |
| 316 | 3300026095 | Ga0207676_10239087 | Ga0207676_102390872 | 249 |
| 317 | 3300026116 | Ga0207674_10051238 | Ga0207674_100512385 | 249 |
| 318 | 3300026121 | Ga0207683_10000895 | Ga0207683_1000089525 | 249 |
| 319 | 3300026121 | Ga0207683_10276926 | Ga0207683_102769262 | 249 |
| 320 | 3300027252 | Ga0209973_1002123 | Ga0209973_10021232 | 249 |
| 321 | 3300027360 | Ga0209969_1000104 | Ga0209969_10001044 | 249 |
| 322 | 3300027364 | Ga0209967_1000038 | Ga0209967_10000384 | 249 |
| 323 | 3300027378 | Ga0209981_1000268 | Ga0209981_10002687 | 249 |
| 324 | 3300027395 | Ga0209996_1000062 | Ga0209996_10000625 | 249 |
| 325 | 3300027424 | Ga0209984_1000027 | Ga0209984_10000274 | 249 |
| 326 | 3300027462 | Ga0210000_1000018 | Ga0210000_100001825 | 249 |
| 327 | 3300027471 | Ga0209995_1000015 | Ga0209995_100001525 | 249 |
| 328 | 3300027526 | Ga0209968_1000052 | Ga0209968_100005224 | 249 |
| 329 | 3300027552 | Ga0209982_1000018 | Ga0209982_100001818 | 249 |
| 330 | 3300027614 | Ga0209970_1000260 | Ga0209970_10002608 | 249 |
| 331 | 3300027617 | Ga0210002_1000043 | Ga0210002_100004320 | 249 |
| 332 | 3300027671 | Ga0209588_1000036 | Ga0209588_100003644 | 249 |
| 333 | 3300027682 | Ga0209971_1000266 | Ga0209971_10002664 | 249 |
| 334 | 3300027682 | Ga0209971_1009970 | Ga0209971_10099703 | 249 |
| 335 | 3300027695 | Ga0209966_1000180 | Ga0209966_100018018 | 249 |
| 336 | 3300027717 | Ga0209998_10000137 | Ga0209998_1000013720 | 249 |
| 337 | 3300027876 | Ga0209974_10003579 | Ga0209974_100035798 | 249 |
| 338 | 3300027907 | Ga0207428_10000452 | Ga0207428_100004529 | 249 |
| 339 | 3300028380 | Ga0268265_10007292 | Ga0268265_1000729211 | 249 |
| 340 | 3300028381 | Ga0268264_10319587 | Ga0268264_103195872 | 249 |
| 341 | 3300031548 | Ga0307408_100139674 | Ga0307408_1001396742 | 249 |
| 342 | 3300031731 | Ga0307405_10396215 | Ga0307405_103962151 | 249 |
| 343 | 3300031731 | Ga0307405_10668491 | Ga0307405_106684911 | 249 |
| 344 | 3300031824 | Ga0307413_10052889 | Ga0307413_100528894 | 249 |
| 345 | 3300031824 | Ga0307413_10268332 | Ga0307413_102683322 | 249 |
| 346 | 3300031852 | Ga0307410_10175784 | Ga0307410_101757843 | 249 |
| 347 | 3300031901 | Ga0307406_10164704 | Ga0307406_101647041 | 249 |
| 348 | 3300031995 | Ga0307409_100336532 | Ga0307409_1003365322 | 249 |
| 349 | 3300032002 | Ga0307416_100216144 | Ga0307416_1002161442 | 249 |
| 350 | 3300032004 | Ga0307414_10054992 | Ga0307414_100549923 | 249 |
| 351 | 3300032004 | Ga0307414_10095671 | Ga0307414_100956712 | 249 |
| 352 | 3300032126 | Ga0307415_100316471 | Ga0307415_1003164712 | 249 |
| 353 | 3300032126 | Ga0307415_100514262 | Ga0307415_1005142622 | 249 |
| 354 | 3300035691 | Ga0373931_0078226 | Ga0373931_0078226_675_1424 | 249 |
| 355 | 3300035692 | Ga0373935_0190004 | Ga0373935_0190004_100_849 | 249 |
| 356 | 3300035724 | Ga0373933_0029081 | Ga0373933_0029081_286_1035 | 249 |
| 357 | 3300036647 | Ga0316582_0007903 | Ga0316582_0007903_1722_2504 | 249 |
| 358 | 3300037068 | Ga0373925_0039769 | Ga0373925_0039769_738_1487 | 249 |
| 359 | 3300037588 | Ga0316581_0012351 | Ga0316581_0012351_685_1467 | 249 |
| 360 | 3300037853 | Ga0436364_0367212 | Ga0436364_0367212_13823_14599 | 249 |
| 361 | 3300037853 | Ga0436364_1270093 | Ga0436364_1270093_616_1413 | 249 |
| 362 | 3300039437 | Ga0436365_0222942 | Ga0436365_0222942_2889_3689 | 249 |
| 363 | 3300039437 | Ga0436365_1544784 | Ga0436365_1544784_1500_2276 | 249 |
| 364 | 3300039437 | Ga0436365_1662543 | Ga0436365_1662543_11468_12244 | 249 |
| 365 | 3300039450 | Ga0436363_0133663 | Ga0436363_0133663_5634_6410 | 249 |
| 366 | 3300039450 | Ga0436363_0145734 | Ga0436363_0145734_2013_2789 | 249 |
| 367 | 3300042000 | Ga0439437_007560 | Ga0439437_007560_446_1195 | 249 |
| 368 | 3300042876 | Ga0451577_0341592 | Ga0451577_0341592_407_1156 | 249 |
| 369 | 3300044684 | Ga0466966_0216255 | Ga0466966_0216255_357_1133 | 249 |
| 370 | 3300044693 | Ga0466961_0009202 | Ga0466961_0009202_3706_4482 | 249 |
| 371 | 3300044694 | Ga0466963_0001026 | Ga0466963_0001026_12785_13561 | 249 |
| 372 | 3300044694 | Ga0466963_0363027 | Ga0466963_0363027_146_895 | 249 |
| 373 | 3300044712 | Ga0453684_0008501 | Ga0453684_0008501_5308_6057 | 249 |
| 374 | 3300044712 | Ga0453684_0025015 | Ga0453684_0025015_4944_5747 | 249 |
| 375 | 3300044712 | Ga0453684_0086711 | Ga0453684_0086711_132_935 | 249 |
| 376 | 3300044765 | Ga0466970_0034497 | Ga0466970_0034497_1641_2417 | 249 |
| 377 | 3300044842 | Ga0466957_0069240 | Ga0466957_0069240_1012_1788 | 249 |
| 378 | 3300045049 | Ga0466959_0000810 | Ga0466959_0000810_12644_13420 | 249 |
| 379 | 3300045049 | Ga0466959_0146969 | Ga0466959_0146969_52_828 | 249 |
| 380 | 3300045051 | Ga0451576_0000298 | Ga0451576_0000298_62166_62969 | 249 |
| 381 | 3300045051 | Ga0451576_0310218 | Ga0451576_0310218_248_997 | 249 |
| 382 | 3300045836 | Ga0466958_0001100 | Ga0466958_0001100_10697_11473 | 249 |
| 383 | 3300045836 | Ga0466958_0210397 | Ga0466958_0210397_139_915 | 249 |
| 384 | 3300045976 | Ga0466967_0062465 | Ga0466967_0062465_338_1096 | 249 |
| 385 | 3300046458 | Ga0495591_060169 | Ga0495591_060169_180_929 | 249 |
| 386 | 3300046459 | Ga0495629_0043853 | Ga0495629_0043853_1940_2689 | 249 |
| 387 | 3300046476 | Ga0495662_0114250 | Ga0495662_0114250_502_1251 | 249 |
| 388 | 3300046491 | Ga0495584_0108087 | Ga0495584_0108087_485_1234 | 249 |
| 389 | 3300046499 | Ga0495594_0044035 | Ga0495594_0044035_1078_1827 | 249 |
| 390 | 3300046675 | Ga0495657_0003784 | Ga0495657_0003784_10173_10922 | 249 |
| 391 | 3300046690 | Ga0495624_0068025 | Ga0495624_0068025_1288_2037 | 249 |
| 392 | 3300046809 | Ga0495600_0112103 | Ga0495600_0112103_540_1289 | 249 |
| 393 | 3300047315 | Ga0495581_0106549 | Ga0495581_0106549_353_1102 | 249 |
| 394 | 3300047319 | Ga0495674_0408008 | Ga0495674_0408008_284_1060 | 249 |
| 395 | 3300047321 | Ga0495676_0043484 | Ga0495676_0043484_2095_2886 | 249 |
| 396 | 3300047322 | Ga0495680_0029262 | Ga0495680_0029262_1155_1904 | 249 |
| 397 | 3300048913 | Ga0496110_0336238 | Ga0496110_0336238_496_1245 | 249 |
| 398 | 3300049569 | Ga0501032_0016350 | Ga0501032_0016350_593_1348 | 249 |
| 399 | 3300049569 | Ga0501032_0086233 | Ga0501032_0086233_200_949 | 249 |
| 400 | 3300049570 | Ga0501033_0075609 | Ga0501033_0075609_1585_2334 | 249 |
| 401 | 3300049572 | Ga0501036_0130131 | Ga0501036_0130131_1303_2061 | 249 |
| 402 | 3300049573 | Ga0501037_0045287 | Ga0501037_0045287_2327_3085 | 249 |
| 403 | 3300049574 | Ga0501038_0002519 | Ga0501038_0002519_5104_5859 | 249 |
| 404 | 3300049574 | Ga0501038_0116576 | Ga0501038_0116576_539_1288 | 249 |
| 405 | 3300049575 | Ga0501039_0147062 | Ga0501039_0147062_470_1225 | 249 |
| 406 | 3300049575 | Ga0501039_0155387 | Ga0501039_0155387_475_1233 | 249 |
| 407 | 3300049576 | Ga0501040_0060308 | Ga0501040_0060308_1788_2543 | 249 |
| 408 | 3300049576 | Ga0501040_0131209 | Ga0501040_0131209_975_1733 | 249 |
| 409 | 3300049577 | Ga0501041_0007026 | Ga0501041_0007026_4414_5169 | 249 |
| 410 | 3300049578 | Ga0501042_0005863 | Ga0501042_0005863_5653_6408 | 249 |
| 411 | 3300049579 | Ga0501043_0202306 | Ga0501043_0202306_46_795 | 249 |
| 412 | 3300049580 | Ga0501046_0013923 | Ga0501046_0013923_1603_2352 | 249 |
| 413 | 3300049580 | Ga0501046_0017452 | Ga0501046_0017452_4731_5486 | 249 |
| 414 | 3300049581 | Ga0501047_0112209 | Ga0501047_0112209_191_994 | 249 |
| 415 | 3300049582 | Ga0501048_0201899 | Ga0501048_0201899_439_1197 | 249 |
| 416 | 3300049585 | Ga0501069_0053996 | Ga0501069_0053996_387_1136 | 249 |
| 417 | 3300049587 | Ga0501071_0020859 | Ga0501071_0020859_1758_2507 | 249 |
| 418 | 3300049588 | Ga0501072_0044375 | Ga0501072_0044375_1967_2716 | 249 |
| 419 | 3300049591 | Ga0501075_0022983 | Ga0501075_0022983_3132_3887 | 249 |
| 420 | 3300049591 | Ga0501075_0173693 | Ga0501075_0173693_762_1511 | 249 |
| 421 | 3300049592 | Ga0501076_0021046 | Ga0501076_0021046_2052_2801 | 249 |
| 422 | 3300049592 | Ga0501076_0162505 | Ga0501076_0162505_163_918 | 249 |
| 423 | 3300049704 | Ga0501221_008057 | Ga0501221_008057_615_1379 | 249 |
| 424 | 3300049741 | Ga0501079_0081357 | Ga0501079_0081357_1561_2310 | 249 |
| 425 | 3300049741 | Ga0501079_0437783 | Ga0501079_0437783_80_835 | 249 |
| 426 | 3300049742 | Ga0501080_0090233 | Ga0501080_0090233_1981_2757 | 249 |
| 427 | 3300049743 | Ga0501081_0211390 | Ga0501081_0211390_538_1317 | 249 |
| 428 | 3300049822 | Ga0501035_0012778 | Ga0501035_0012778_5418_6173 | 249 |
| 429 | 3300049822 | Ga0501035_0408060 | Ga0501035_0408060_151_900 | 249 |
| 430 | 3300049824 | Ga0501045_0095074 | Ga0501045_0095074_140_889 | 249 |
| 431 | 3300049851 | Ga0501212_001657 | Ga0501212_001657_1425_2189 | 249 |
| 432 | 3300050507 | nmdc:mga05p37_150384_c1 | nmdc:mga05p37_150384_c1_1757_2506 | 249 |
| 433 | 3300050507 | nmdc:mga05p37_16103_c1 | nmdc:mga05p37_16103_c1_146_895 | 249 |
| 434 | 3300050508 | nmdc:mga09592_285521_c1 | nmdc:mga09592_285521_c1_509_1258 | 249 |
| 435 | 3300050509 | nmdc:mga0qj67_14052_c1 | nmdc:mga0qj67_14052_c1_2842_3636 | 249 |
| 436 | 3300050509 | nmdc:mga0qj67_2019_c1 | nmdc:mga0qj67_2019_c1_5974_6723 | 249 |
| 437 | 3300050509 | nmdc:mga0qj67_25295_c1 | nmdc:mga0qj67_25295_c1_1282_2031 | 249 |
| 438 | 3300050509 | nmdc:mga0qj67_46834_c1 | nmdc:mga0qj67_46834_c1_2498_3247 | 249 |
| 439 | 3300050510 | nmdc:mga06r32_27115_c1 | nmdc:mga06r32_27115_c1_4141_4890 | 249 |
| 440 | 3300050510 | nmdc:mga06r32_3627_c1 | nmdc:mga06r32_3627_c1_3761_4510 | 249 |
| 441 | 3300050510 | nmdc:mga06r32_37753_c1 | nmdc:mga06r32_37753_c1_817_1611 | 249 |
| 442 | 3300050511 | nmdc:mga08y16_238397_c1 | nmdc:mga08y16_238397_c1_789_1538 | 249 |
| 443 | 3300050512 | nmdc:mga0n895_375668_c1 | nmdc:mga0n895_375668_c1_251_1045 | 249 |
| 444 | 3300050512 | nmdc:mga0n895_478423_c1 | nmdc:mga0n895_478423_c1_237_992 | 249 |
| 445 | 3300050512 | nmdc:mga0n895_77732_c1 | nmdc:mga0n895_77732_c1_927_1682 | 249 |
| 446 | 3300050513 | nmdc:mga0rr50_546936_c1 | nmdc:mga0rr50_546936_c1_221_970 | 249 |
| 447 | 3300050513 | nmdc:mga0rr50_88436_c1 | nmdc:mga0rr50_88436_c1_361_1116 | 249 |
| 448 | 3300050514 | nmdc:mga08x19_164304_c1 | nmdc:mga08x19_164304_c1_225_974 | 249 |
| 449 | 3300050514 | nmdc:mga08x19_375111_c1 | nmdc:mga08x19_375111_c1_11_778 | 249 |
| 450 | 3300050514 | nmdc:mga08x19_55626_c1 | nmdc:mga08x19_55626_c1_448_1197 | 249 |
| 451 | 3300050514 | nmdc:mga08x19_63277_c1 | nmdc:mga08x19_63277_c1_194_943 | 249 |
| 452 | 3300050515 | nmdc:mga0a205_186553_c1 | nmdc:mga0a205_186553_c1_425_1219 | 249 |
| 453 | 3300050515 | nmdc:mga0a205_23315_c1 | nmdc:mga0a205_23315_c1_954_1703 | 249 |
| 454 | 3300050515 | nmdc:mga0a205_8227_c1 | nmdc:mga0a205_8227_c1_4326_5081 | 249 |
| 455 | 3300050515 | nmdc:mga0a205_97995_c1 | nmdc:mga0a205_97995_c1_1113_1862 | 249 |
| 456 | 3300053085 | Ga0495619_0031129 | Ga0495619_0031129_1590_2339 | 249 |
| 457 | 3300053085 | Ga0495619_0031481 | Ga0495619_0031481_2566_3315 | 249 |
| 458 | 3300054114 | Ga0501084_0269216 | Ga0501084_0269216_140_889 | 249 |
| 459 | 3300059424 | Ga0590075_005913 | Ga0590075_005913_76_825 | 249 |
| 460 | 3300059424 | Ga0590075_033582 | Ga0590075_033582_385_1149 | 249 |
| 461 | 3300060353 | Ga0501082_0052100 | Ga0501082_0052100_639_1388 | 249 |
| 462 | 3300060353 | Ga0501082_0253440 | Ga0501082_0253440_260_1015 | 249 |
| 463 | 3300061734 | Ga0530510_0198298 | Ga0530510_0198298_294_1043 | 249 |
| 464 | 3300061734 | Ga0530510_0278578 | Ga0530510_0278578_192_947 | 249 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4juq-assembly1.cif.gz_A | pseudomonas aeruginosa metap t2n mutant, in mn form | 0.9867 | 1 | 248 |
| 3mr1-assembly2.cif.gz_B | crystal structure of methionine aminopeptidase from rickettsia prowazekii | 0.9854 | 1 | 248 |
| 1o0x-assembly1.cif.gz_A | crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution | 0.985 | 1 | 249 |
| 3tb5-assembly2.cif.gz_B | crystal structure of the enterococcus faecalis methionine aminopeptidase apo form | 0.9849 | 1 | 248 |
| 5yxf-assembly1.cif.gz_A | mycobacterium tuberculosis methionine aminopeptidase type 1c (c105l mutant) in complex with methionine | 0.9833 | 4 | 249 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6Z3V9_1_121_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9914 | 16 | 124 | 3.90.230.10 |
| 4juqD00 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9867 | 1 | 248 | 3.90.230.10 |
| 1o0xA00 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.985 | 1 | 249 | 3.90.230.10 |
| af_Q9VKV9_33_317_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9849 | 1 | 248 | 3.90.230.10 |
| af_P9WK19_6_284_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9848 | 4 | 248 | 3.90.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C3XA93-F1-model_v4 | Methionine aminopeptidase (EC 3.4.11.18) | 0.9981 | 1 | 196 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
| AF-A0A356ZCU1-F1-model_v4 | Type I methionyl aminopeptidase | 0.9975 | 83 | 188 |
GO:0005829
GO:0006508 GO:0070006 |
| AF-I3VU54-F1-model_v4 | Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) | 0.9971 | 1 | 249 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
| AF-A0A3D0E855-F1-model_v4 | deleted | 0.997 | 1 | 249 |
|
| AF-A0A7C7DIY6-F1-model_v4 | Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) | 0.9968 | 1 | 249 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar