F449256

General Info

Members Datasets Scaffolds Average Seq Length
464 259 464 252

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100127760|Ga0070697_1001277603
Length 282
Sequence LINLKTAHEIDLMARAGALLASVLPPLKDACEPGVKTNELDRIAEKLIRDGGATPGFLGYHGYPKSICVSINDEAVHGIPGSRKIAAGDLVSLDLGLVLDGFWADVGITVGVGKITKEADRLVKVTEEALYVGIDKAQPGGWLGDVSSAIQKHVEKAGFSVIRQFVGHGIGRQMHEDPQVPNFGTPGTPPRLKPGMTLAIEPMVNAGSHEVYMKADGWTICTVDGALSAYFEHTVAITDKGPLILTAQGSPLAGSSRRAEGAPGVGTSAPKASNGRANGAAH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
163 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
185 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
186 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
187 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
203 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
234 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
241 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.29
Nodule 0
Rhizoplane 0.22
Rhizosphere 96.12
Stem 0
Stem Tuber 0
Unclassified 2.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3021854 2162886007 Unclassified 1179
2 JGI24746J21847_1000439 3300001977 Bacteria 6214
3 Ga0058862_12677821 3300004803 Unclassified 1696
4 Ga0058862_12781598 3300004803 Bacteria 1552
5 Ga0065704_10094280 3300005289 Bacteria 2551
6 Ga0065707_10117488 3300005295 Bacteria 2176
7 Ga0065707_10124509 3300005295 Unclassified 2042
8 Ga0065707_10157277 3300005295 Bacteria 1596
9 Ga0070676_10002352 3300005328 Bacteria 9683
10 Ga0070676_10089255 3300005328 Bacteria 1885
11 Ga0070683_100029138 3300005329 Bacteria 4995
12 Ga0070690_100001487 3300005330 Bacteria 12272
13 Ga0070690_100025120 3300005330 Bacteria 3667
14 Ga0070670_100007145 3300005331 Bacteria 9456
15 Ga0070677_10000876 3300005333 Bacteria 9918
16 Ga0068869_100002424 3300005334 Bacteria 11243
17 Ga0070666_10056014 3300005335 Bacteria 2661
18 Ga0070680_100001398 3300005336 Bacteria 17425
19 Ga0070682_100039950 3300005337 Bacteria 2885
20 Ga0068868_100436321 3300005338 Bacteria 1136
21 Ga0070660_100018135 3300005339 Bacteria 5136
22 Ga0070689_100047490 3300005340 Bacteria 3310
23 Ga0070691_10034998 3300005341 Bacteria 2364
24 Ga0070687_100018120 3300005343 Bacteria 3250
25 Ga0070687_100220404 3300005343 Bacteria 1161
26 Ga0070661_100004891 3300005344 Bacteria 9227
27 Ga0070661_100025478 3300005344 Bacteria 4251
28 Ga0070692_10105828 3300005345 Unclassified 1549
29 Ga0070668_100039054 3300005347 Bacteria 3631
30 Ga0070669_100070016 3300005353 Bacteria 2592
31 Ga0070671_100021110 3300005355 Bacteria 5317
32 Ga0070674_100011117 3300005356 Bacteria 5466
33 Ga0070673_100028371 3300005364 Bacteria 4162
34 Ga0070673_100746429 3300005364 Bacteria 901
35 Ga0070659_100118915 3300005366 Bacteria 2138
36 Ga0070703_10005450 3300005406 Bacteria 3558
37 Ga0070714_100027086 3300005435 Bacteria 4743
38 Ga0070714_100091616 3300005435 Bacteria 2664
39 Ga0070714_100272636 3300005435 Bacteria 1569
40 Ga0070714_100321409 3300005435 Bacteria 1447
41 Ga0070713_100021996 3300005436 Bacteria 4918
42 Ga0070710_10306865 3300005437 Bacteria 1037
43 Ga0070711_100457267 3300005439 Bacteria 1046
44 Ga0070705_100015576 3300005440 Bacteria 3935
45 Ga0070705_100025577 3300005440 Bacteria 3201
46 Ga0070705_100030655 3300005440 Bacteria 2971
47 Ga0070705_100091803 3300005440 Bacteria 1894
48 Ga0070705_100125705 3300005440 Bacteria 1664
49 Ga0070705_100261142 3300005440 Bacteria 1221
50 Ga0070700_100007161 3300005441 Bacteria 6007
51 Ga0070694_100033008 3300005444 Bacteria 3402
52 Ga0070694_100050477 3300005444 Bacteria 2804
53 Ga0070708_100000027 3300005445 Bacteria 97468
54 Ga0070708_100001490 3300005445 Bacteria 17884
55 Ga0070708_100049189 3300005445 Bacteria 3729
56 Ga0070708_100059463 3300005445 Bacteria 3407
57 Ga0070708_100170936 3300005445 Bacteria 2029
58 Ga0070708_100234209 3300005445 Bacteria 1723
59 Ga0070663_100110033 3300005455 Unclassified 2069
60 Ga0070678_100000687 3300005456 Bacteria 16686
61 Ga0070681_10007331 3300005458 Bacteria 10773
62 Ga0068867_100000218 3300005459 Bacteria 37862
63 Ga0068867_100002011 3300005459 Bacteria 14198
64 Ga0070706_100000117 3300005467 Bacteria 97475
65 Ga0070706_100000547 3300005467 Bacteria 43712
66 Ga0070706_100001931 3300005467 Bacteria 21364
67 Ga0070706_100009741 3300005467 Bacteria 8929
68 Ga0070706_100011793 3300005467 Bacteria 8112
69 Ga0070706_100016257 3300005467 Bacteria 6873
70 Ga0070707_100000060 3300005468 Bacteria 97475
71 Ga0070707_100001828 3300005468 Bacteria 20464
72 Ga0070707_100010596 3300005468 Bacteria 8585
73 Ga0070707_100043111 3300005468 Bacteria 4319
74 Ga0070707_100064893 3300005468 Bacteria 3507
75 Ga0070707_100102186 3300005468 Bacteria 2777
76 Ga0070707_100250604 3300005468 Bacteria 1723
77 Ga0070707_100256847 3300005468 Bacteria 1700
78 Ga0070707_100294316 3300005468 Bacteria 1577
79 Ga0070707_100578572 3300005468 Bacteria 1085
80 Ga0070698_100018273 3300005471 Bacteria 7382
81 Ga0070698_100023059 3300005471 Bacteria 6509
82 Ga0070698_100102838 3300005471 Bacteria 2827
83 Ga0070698_100201083 3300005471 Bacteria 1928
84 Ga0070698_100456312 3300005471 Bacteria 1214
85 Ga0070698_100473801 3300005471 Bacteria 1188
86 Ga0070698_100558399 3300005471 Bacteria 1084
87 Ga0070698_100659716 3300005471 Unclassified 987
88 Ga0070699_100000685 3300005518 Bacteria 31595
89 Ga0070699_100000784 3300005518 Bacteria 29316
90 Ga0070699_100002925 3300005518 Bacteria 15183
91 Ga0070699_100046351 3300005518 Bacteria 3761
92 Ga0070699_100053088 3300005518 Bacteria 3508
93 Ga0070699_100065427 3300005518 Bacteria 3155
94 Ga0070699_100221941 3300005518 Bacteria 1684
95 Ga0070699_100378282 3300005518 Bacteria 1278
96 Ga0070684_100092388 3300005535 Bacteria 2693
97 Ga0070697_100000351 3300005536 Bacteria 36223
98 Ga0070697_100001474 3300005536 Bacteria 17878
99 Ga0070697_100014335 3300005536 Bacteria 6228
100 Ga0070697_100016182 3300005536 Bacteria 5864
101 Ga0070697_100052182 3300005536 Bacteria 3322
102 Ga0070697_100077619 3300005536 Bacteria 2733
103 Ga0070697_100095218 3300005536 Bacteria 2468
104 Ga0070697_100127760 3300005536 Bacteria 2130
105 Ga0070697_100219435 3300005536 Bacteria 1620
106 Ga0070697_100231399 3300005536 Bacteria 1577
107 Ga0070697_100445092 3300005536 Bacteria 1128
108 Ga0070672_100010522 3300005543 Bacteria 6420
109 Ga0070672_100016350 3300005543 Bacteria 5311
110 Ga0070686_100027236 3300005544 Bacteria 3458
111 Ga0070695_100005251 3300005545 Bacteria 7628
112 Ga0070695_100029506 3300005545 Bacteria 3408
113 Ga0070695_100471286 3300005545 Unclassified 966
114 Ga0070696_100051210 3300005546 Bacteria 2871
115 Ga0070696_100403131 3300005546 Bacteria 1070
116 Ga0070693_100203796 3300005547 Unclassified 1286
117 Ga0070693_100363412 3300005547 Bacteria 994
118 Ga0070704_100004934 3300005549 Bacteria 7747
119 Ga0070704_100006043 3300005549 Bacteria 7100
120 Ga0070704_100130670 3300005549 Bacteria 1946
121 Ga0070664_100004346 3300005564 Bacteria 11393
122 Ga0068857_100091178 3300005577 Bacteria 2727
123 Ga0068864_100106443 3300005618 Bacteria 2494
124 Ga0068864_100191261 3300005618 Bacteria 1876
125 Ga0068866_10018240 3300005718 Bacteria 3170
126 Ga0068866_10025428 3300005718 Bacteria 2783
127 Ga0068858_100131773 3300005842 Unclassified 2345
128 Ga0068860_100029433 3300005843 Bacteria 5283
129 Ga0068862_100007798 3300005844 Bacteria 8853
130 Ga0081455_10003827 3300005937 Bacteria 17166
131 Ga0081538_10020098 3300005981 Bacteria 4932
132 Ga0081538_10022736 3300005981 Bacteria 4532
133 Ga0081538_10082674 3300005981 Bacteria 1701
134 Ga0081539_10000187 3300005985 Bacteria 145407
135 Ga0081539_10023492 3300005985 Bacteria 4039
136 Ga0070717_10000007 3300006028 Bacteria 304340
137 Ga0070717_10008688 3300006028 Bacteria 7600
138 Ga0070717_10034873 3300006028 Bacteria 4069
139 Ga0075364_10047604 3300006051 Bacteria 2794
140 Ga0070716_100076540 3300006173 Bacteria 1983
141 Ga0075367_10010858 3300006178 Bacteria 4799
142 Ga0097621_100030761 3300006237 Bacteria 4254
143 Ga0097621_100037374 3300006237 Bacteria 3890
144 Ga0068871_100285934 3300006358 Unclassified 1444
145 Ga0075428_100123908 3300006844 Unclassified 2813
146 Ga0075428_100289686 3300006844 Unclassified 1761
147 Ga0075430_100003584 3300006846 Bacteria 13009
148 Ga0075430_100011986 3300006846 Bacteria 7378
149 Ga0075431_100009425 3300006847 Bacteria 9799
150 Ga0075431_100009466 3300006847 Bacteria 9782
151 Ga0075433_10012940 3300006852 Bacteria 6763
152 Ga0075433_10137694 3300006852 Bacteria 2170
153 Ga0075434_100163257 3300006871 Bacteria 2247
154 Ga0075434_100207960 3300006871 Bacteria 1978
155 Ga0075434_100364703 3300006871 Bacteria 1465
156 Ga0075429_100030783 3300006880 Bacteria 4663
157 Ga0068865_100001372 3300006881 Bacteria 14168
158 Ga0075436_100038296 3300006914 Bacteria 3309
159 Ga0075436_100041209 3300006914 Bacteria 3185
160 Ga0075436_100160869 3300006914 Bacteria 1583
161 Ga0075435_100061967 3300007076 Bacteria 3035
162 Ga0075435_100140037 3300007076 Bacteria 2029
163 Ga0075435_100181585 3300007076 Bacteria 1778
164 Ga0099794_10000117 3300007265 Bacteria 29179
165 Ga0099794_10004600 3300007265 Bacteria 5445
166 Ga0099794_10225257 3300007265 Bacteria 964
167 Ga0111539_10493398 3300009094 Bacteria 1426
168 Ga0105245_10002155 3300009098 Bacteria 17830
169 Ga0114129_10015428 3300009147 Bacteria 10869
170 Ga0114129_10025977 3300009147 Bacteria 8293
171 Ga0114129_10033158 3300009147 Bacteria 7298
172 Ga0114129_10119665 3300009147 Bacteria 3627
173 Ga0114129_10270489 3300009147 Bacteria 2273
174 Ga0114129_10418863 3300009147 Bacteria 1762
175 Ga0114129_10630303 3300009147 Bacteria 1386
176 Ga0105243_10000049 3300009148 Bacteria 145575
177 Ga0105243_10002596 3300009148 Bacteria 15060
178 Ga0105242_10001315 3300009176 Bacteria 19631
179 Ga0105249_10001784 3300009553 Bacteria 18752
180 Ga0105239_10132652 3300010375 Bacteria 2771
181 Ga0105246_10000933 3300011119 Bacteria 16728
182 Ga0157369_10031128 3300013105 Bacteria 5879
183 Ga0157369_10667919 3300013105 Bacteria 1071
184 Ga0157374_10004664 3300013296 Bacteria 11502
185 Ga0157378_10017169 3300013297 Bacteria 6344
186 Ga0163162_10226389 3300013306 Bacteria 2000
187 Ga0157380_10015563 3300014326 Bacteria 5593
188 Ga0157380_10032645 3300014326 Bacteria 4007
189 Ga0157377_10040483 3300014745 Bacteria 2580
190 Ga0157377_10043021 3300014745 Bacteria 2512
191 Ga0157376_10000962 3300014969 Bacteria 18762
192 Ga0157376_10011279 3300014969 Bacteria 6579
193 Ga0213876_10009713 3300021384 Bacteria 5178
194 Ga0213876_10016993 3300021384 Bacteria 3843
195 Ga0213875_10006988 3300021388 Bacteria 5875
196 Ga0224712_10179793 3300022467 Bacteria 952
197 Ga0207653_10001462 3300025885 Bacteria 7662
198 Ga0207682_10030281 3300025893 Bacteria 2167
199 Ga0207692_10263003 3300025898 Bacteria 1038
200 Ga0207642_10245301 3300025899 Bacteria 1013
201 Ga0207688_10001296 3300025901 Bacteria 12973
202 Ga0207680_10004142 3300025903 Bacteria 6866
203 Ga0207680_10025370 3300025903 Bacteria 3269
204 Ga0207647_10095905 3300025904 Bacteria 1766
205 Ga0207645_10001331 3300025907 Bacteria 20306
206 Ga0207645_10193102 3300025907 Bacteria 1338
207 Ga0207684_10000002 3300025910 Bacteria 1042751
208 Ga0207684_10000026 3300025910 Bacteria 316711
209 Ga0207684_10000148 3300025910 Bacteria 124604
210 Ga0207684_10000222 3300025910 Bacteria 87705
211 Ga0207684_10002609 3300025910 Bacteria 18023
212 Ga0207684_10022921 3300025910 Bacteria 5332
213 Ga0207684_10067051 3300025910 Bacteria 3049
214 Ga0207684_10139657 3300025910 Bacteria 2082
215 Ga0207684_10225000 3300025910 Bacteria 1619
216 Ga0207684_10285644 3300025910 Bacteria 1423
217 Ga0207684_10296857 3300025910 Bacteria 1393
218 Ga0207707_10005817 3300025912 Bacteria 10774
219 Ga0207707_10037560 3300025912 Bacteria 4233
220 Ga0207693_10131173 3300025915 Unclassified 1970
221 Ga0207663_10365566 3300025916 Bacteria 1096
222 Ga0207660_10034701 3300025917 Bacteria 3497
223 Ga0207660_10047074 3300025917 Bacteria 3047
224 Ga0207662_10023453 3300025918 Bacteria 3545
225 Ga0207657_10003006 3300025919 Bacteria 18068
226 Ga0207649_10003938 3300025920 Bacteria 8099
227 Ga0207649_10006351 3300025920 Bacteria 6423
228 Ga0207646_10000143 3300025922 Bacteria 97493
229 Ga0207646_10000394 3300025922 Bacteria 58624
230 Ga0207646_10000668 3300025922 Bacteria 44376
231 Ga0207646_10001744 3300025922 Bacteria 26445
232 Ga0207646_10005654 3300025922 Bacteria 13120
233 Ga0207646_10017539 3300025922 Bacteria 6697
234 Ga0207646_10033781 3300025922 Bacteria 4624
235 Ga0207646_10103108 3300025922 Bacteria 2558
236 Ga0207646_10230501 3300025922 Bacteria 1673
237 Ga0207646_10230535 3300025922 Bacteria 1673
238 Ga0207646_10578177 3300025922 Bacteria 1009
239 Ga0207681_10027152 3300025923 Bacteria 3699
240 Ga0207650_10157615 3300025925 Unclassified 1796
241 Ga0207659_10009763 3300025926 Bacteria 6003
242 Ga0207687_10047613 3300025927 Bacteria 2973
243 Ga0207700_10066664 3300025928 Bacteria 2752
244 Ga0207664_10001273 3300025929 Bacteria 16631
245 Ga0207644_10033413 3300025931 Bacteria 3594
246 Ga0207644_10171807 3300025931 Bacteria 1693
247 Ga0207690_10045187 3300025932 Bacteria 2908
248 Ga0207706_10002541 3300025933 Bacteria 17781
249 Ga0207686_10113734 3300025934 Unclassified 1830
250 Ga0207709_10000097 3300025935 Bacteria 136507
251 Ga0207709_10113365 3300025935 Unclassified 1817
252 Ga0207670_10013450 3300025936 Bacteria 4827
253 Ga0207670_10051099 3300025936 Bacteria 2774
254 Ga0207669_10001785 3300025937 Bacteria 9123
255 Ga0207704_10001466 3300025938 Bacteria 10546
256 Ga0207704_10102930 3300025938 Bacteria 1909
257 Ga0207665_10027217 3300025939 Bacteria 3778
258 Ga0207665_10190708 3300025939 Bacteria 1489
259 Ga0207665_10307824 3300025939 Bacteria 1186
260 Ga0207665_10313529 3300025939 Bacteria 1175
261 Ga0207691_10000955 3300025940 Bacteria 28629
262 Ga0207691_10041727 3300025940 Bacteria 4234
263 Ga0207689_10014066 3300025942 Bacteria 6811
264 Ga0207689_10269063 3300025942 Bacteria 1411
265 Ga0207661_10090706 3300025944 Bacteria 2545
266 Ga0207679_10000541 3300025945 Bacteria 25439
267 Ga0207679_10030510 3300025945 Bacteria 3765
268 Ga0207651_10130399 3300025960 Bacteria 1923
269 Ga0207668_10050776 3300025972 Bacteria 2860
270 Ga0207658_10098720 3300025986 Unclassified 2282
271 Ga0207678_10094564 3300026067 Bacteria 2554
272 Ga0207708_10000561 3300026075 Bacteria 28687
273 Ga0207648_10000083 3300026089 Bacteria 89416
274 Ga0207648_10001233 3300026089 Bacteria 28717
275 Ga0207676_10239087 3300026095 Bacteria 1628
276 Ga0207674_10051238 3300026116 Bacteria 4213
277 Ga0207674_10286345 3300026116 Bacteria 1596
278 Ga0207683_10000895 3300026121 Bacteria 27406
279 Ga0207683_10276926 3300026121 Bacteria 1533
280 Ga0209973_1002123 3300027252 Unclassified 1817
281 Ga0209969_1000104 3300027360 Bacteria 10560
282 Ga0209967_1000038 3300027364 Bacteria 16833
283 Ga0209981_1000268 3300027378 Bacteria 6709
284 Ga0209996_1000062 3300027395 Bacteria 14921
285 Ga0209984_1000027 3300027424 Bacteria 15251
286 Ga0210000_1000018 3300027462 Bacteria 28094
287 Ga0209995_1000015 3300027471 Bacteria 26669
288 Ga0209968_1000052 3300027526 Bacteria 21189
289 Ga0209982_1000018 3300027552 Bacteria 15162
290 Ga0209970_1000260 3300027614 Bacteria 8679
291 Ga0210002_1000043 3300027617 Bacteria 19508
292 Ga0209588_1000036 3300027671 Bacteria 65612
293 Ga0209971_1000266 3300027682 Bacteria 14793
294 Ga0209971_1009970 3300027682 Bacteria 2247
295 Ga0209966_1000180 3300027695 Bacteria 25869
296 Ga0209998_10000137 3300027717 Bacteria 28713
297 Ga0209974_10003579 3300027876 Bacteria 5585
298 Ga0207428_10000452 3300027907 Bacteria 49793
299 Ga0268265_10007292 3300028380 Bacteria 7469
300 Ga0268264_10319587 3300028381 Bacteria 1467
301 Ga0316182_1102604 3300030745 Bacteria 1151
302 Ga0265325_10039150 3300031241 Bacteria 2498
303 Ga0307408_100139674 3300031548 Bacteria 1900
304 Ga0307405_10396215 3300031731 Bacteria 1079
305 Ga0307405_10668491 3300031731 Bacteria 856
306 Ga0307413_10052889 3300031824 Bacteria 2456
307 Ga0307413_10268332 3300031824 Bacteria 1276
308 Ga0307410_10175784 3300031852 Bacteria 1617
309 Ga0307406_10164704 3300031901 Bacteria 1598
310 Ga0307407_10090510 3300031903 Bacteria 1874
311 Ga0307407_10365109 3300031903 Bacteria 1026
312 Ga0307409_100092397 3300031995 Bacteria 2483
313 Ga0307409_100336532 3300031995 Bacteria 1418
314 Ga0307416_100076811 3300032002 Bacteria 2801
315 Ga0307416_100216144 3300032002 Bacteria 1834
316 Ga0307414_10054992 3300032004 Bacteria 2785
317 Ga0307414_10095671 3300032004 Bacteria 2220
318 Ga0307411_10096077 3300032005 Bacteria 2082
319 Ga0307415_100316471 3300032126 Bacteria 1299
320 Ga0307415_100514262 3300032126 Bacteria 1049
321 Ga0373931_0078226 3300035691 Unclassified 1819
322 Ga0373935_0190004 3300035692 Bacteria 1414
323 Ga0373933_0029081 3300035724 Bacteria 3192
324 Ga0316582_0007903 3300036647 Bacteria 5685
325 Ga0373925_0039769 3300037068 Bacteria 3480
326 Ga0316581_0012351 3300037588 Bacteria 2403
327 Ga0436364_0367212 3300037853 Bacteria 15974
328 Ga0436364_1270093 3300037853 Bacteria 2392
329 Ga0400483_168849 3300039062 Bacteria 24271
330 Ga0436365_0222942 3300039437 Bacteria 6189
331 Ga0436365_1544784 3300039437 Bacteria 5536
332 Ga0436365_1662543 3300039437 Bacteria 16980
333 Ga0436363_0133663 3300039450 Bacteria 6873
334 Ga0436363_0145734 3300039450 Bacteria 3290
335 Ga0439453_0000086 3300041408 Bacteria 7091
336 Ga0439437_007560 3300042000 Bacteria 1215
337 Ga0450889_004721 3300042144 Bacteria 1349
338 Ga0450889_006936 3300042144 Bacteria 1140
339 Ga0451577_0000006 3300042876 Bacteria 709265
340 Ga0451577_0341592 3300042876 Unclassified 1358
341 Ga0453683_0000088 3300044673 Bacteria 138620
342 Ga0453683_0149263 3300044673 Bacteria 1477
343 Ga0466966_0216255 3300044684 Bacteria 1157
344 Ga0466961_0009202 3300044693 Bacteria 6289
345 Ga0466963_0001026 3300044694 Bacteria 14486
346 Ga0466963_0363027 3300044694 Bacteria 1020
347 Ga0453684_0000037 3300044712 Bacteria 709327
348 Ga0453684_0008501 3300044712 Bacteria 18357
349 Ga0453684_0025015 3300044712 Bacteria 8688
350 Ga0453684_0043756 3300044712 Bacteria 6010
351 Ga0453684_0057007 3300044712 Bacteria 5063
352 Ga0453684_0086711 3300044712 Bacteria 3883
353 Ga0466970_0034497 3300044765 Bacteria 2679
354 Ga0466957_0069240 3300044842 Bacteria 2180
355 Ga0466959_0000810 3300045049 Bacteria 18412
356 Ga0466959_0146969 3300045049 Bacteria 1663
357 Ga0451576_0000298 3300045051 Bacteria 120202
358 Ga0451576_0005300 3300045051 Bacteria 16207
359 Ga0451576_0047121 3300045051 Bacteria 4533
360 Ga0451576_0310218 3300045051 Bacteria 1650
361 Ga0466958_0001100 3300045836 Bacteria 12465
362 Ga0466958_0210397 3300045836 Bacteria 1239
363 Ga0466967_0062465 3300045976 Bacteria 3306
364 Ga0495591_060169 3300046458 Bacteria 1011
365 Ga0495629_0043853 3300046459 Bacteria 3140
366 Ga0495662_0114250 3300046476 Bacteria 1324
367 Ga0495584_0108087 3300046491 Bacteria 1407
368 Ga0495594_0044035 3300046499 Bacteria 2447
369 Ga0495630_0023183 3300046517 Bacteria 4588
370 Ga0495657_0003784 3300046675 Bacteria 12244
371 Ga0495624_0068025 3300046690 Bacteria 2221
372 Ga0495600_0112103 3300046809 Bacteria 1776
373 Ga0495581_0106549 3300047315 Bacteria 1629
374 Ga0495674_0408008 3300047319 Bacteria 1096
375 Ga0495676_0043484 3300047321 Bacteria 3675
376 Ga0495680_0029262 3300047322 Bacteria 4511
377 Ga0496110_0336238 3300048913 Unclassified 1376
378 Ga0501032_0016350 3300049569 Bacteria 5220
379 Ga0501032_0086233 3300049569 Bacteria 2087
380 Ga0501033_0075609 3300049570 Bacteria 2472
381 Ga0501036_0130131 3300049572 Bacteria 2125
382 Ga0501037_0045287 3300049573 Bacteria 3230
383 Ga0501038_0002519 3300049574 Bacteria 17073
384 Ga0501038_0116576 3300049574 Bacteria 2207
385 Ga0501039_0048103 3300049575 Bacteria 3297
386 Ga0501039_0147062 3300049575 Bacteria 1851
387 Ga0501039_0155387 3300049575 Bacteria 1797
388 Ga0501040_0060308 3300049576 Bacteria 2607
389 Ga0501040_0131209 3300049576 Bacteria 1762
390 Ga0501041_0007026 3300049577 Bacteria 6607
391 Ga0501042_0005863 3300049578 Bacteria 7940
392 Ga0501042_0269598 3300049578 Bacteria 1229
393 Ga0501043_0202306 3300049579 Bacteria 1541
394 Ga0501046_0013923 3300049580 Bacteria 6793
395 Ga0501046_0017452 3300049580 Bacteria 5990
396 Ga0501047_0112209 3300049581 Bacteria 2608
397 Ga0501048_0201899 3300049582 Bacteria 1409
398 Ga0501069_0053996 3300049585 Bacteria 2238
399 Ga0501070_0241693 3300049586 Bacteria 1478
400 Ga0501071_0020859 3300049587 Bacteria 4558
401 Ga0501072_0021548 3300049588 Bacteria 4998
402 Ga0501072_0044375 3300049588 Bacteria 3496
403 Ga0501075_0022983 3300049591 Bacteria 4561
404 Ga0501075_0173693 3300049591 Bacteria 1644
405 Ga0501076_0021046 3300049592 Bacteria 4998
406 Ga0501076_0162505 3300049592 Bacteria 1820
407 Ga0501209_150795 3300049656 Bacteria 700
408 Ga0501221_008057 3300049704 Bacteria 1824
409 Ga0501079_0081357 3300049741 Bacteria 2504
410 Ga0501079_0437783 3300049741 Bacteria 1026
411 Ga0501079_0445035 3300049741 Bacteria 1017
412 Ga0501080_0090233 3300049742 Bacteria 2847
413 Ga0501080_0166791 3300049742 Bacteria 2032
414 Ga0501081_0019551 3300049743 Bacteria 4510
415 Ga0501081_0211390 3300049743 Bacteria 1409
416 Ga0501035_0012778 3300049822 Bacteria 7756
417 Ga0501035_0408060 3300049822 Bacteria 1129
418 Ga0501045_0095074 3300049824 Bacteria 2204
419 Ga0501212_001657 3300049851 Bacteria 2549
420 nmdc:mga03n38_66559_c1 3300050490 Bacteria 1655
421 nmdc:mga0yw44_375828_c1 3300050492 Bacteria 959
422 nmdc:mga04h51_57298_c1 3300050495 Bacteria 1325
423 nmdc:mga05p37_150384_c1 3300050507 Bacteria 2848
424 nmdc:mga05p37_16103_c1 3300050507 Bacteria 9000
425 nmdc:mga05p37_335929_c1 3300050507 Bacteria 1783
426 nmdc:mga05p37_431200_c1 3300050507 Bacteria 1531
427 nmdc:mga05p37_49727_c1 3300050507 Bacteria 5157
428 nmdc:mga09592_285521_c1 3300050508 Unclassified 1431
429 nmdc:mga0qj67_14052_c1 3300050509 Bacteria 6046
430 nmdc:mga0qj67_2019_c1 3300050509 Bacteria 10913
431 nmdc:mga0qj67_25295_c1 3300050509 Bacteria 4586
432 nmdc:mga0qj67_46834_c1 3300050509 Bacteria 3414
433 nmdc:mga06r32_27115_c1 3300050510 Bacteria 5348
434 nmdc:mga06r32_3627_c1 3300050510 Bacteria 13776
435 nmdc:mga06r32_37753_c1 3300050510 Bacteria 4570
436 nmdc:mga08y16_238397_c1 3300050511 Bacteria 1881
437 nmdc:mga0n895_375668_c1 3300050512 Bacteria 1439
438 nmdc:mga0n895_478423_c1 3300050512 Bacteria 1256
439 nmdc:mga0n895_77732_c1 3300050512 Bacteria 3302
440 nmdc:mga0rr50_546936_c1 3300050513 Bacteria 986
441 nmdc:mga0rr50_88436_c1 3300050513 Bacteria 2407
442 nmdc:mga08x19_164304_c1 3300050514 Bacteria 1509
443 nmdc:mga08x19_319527_c1 3300050514 Bacteria 1080
444 nmdc:mga08x19_375111_c1 3300050514 Bacteria 996
445 nmdc:mga08x19_55626_c1 3300050514 Bacteria 2551
446 nmdc:mga08x19_63277_c1 3300050514 Bacteria 2400
447 nmdc:mga0a205_186553_c1 3300050515 Bacteria 1967
448 nmdc:mga0a205_23315_c1 3300050515 Bacteria 4418
449 nmdc:mga0a205_404340_c1 3300050515 Bacteria 1229
450 nmdc:mga0a205_8227_c1 3300050515 Bacteria 9480
451 nmdc:mga0a205_97995_c1 3300050515 Bacteria 2831
452 Ga0495601_0058326 3300053077 Bacteria 2446
453 Ga0500635_0005767 3300053080 Bacteria 3272
454 Ga0495619_0031129 3300053085 Bacteria 3456
455 Ga0495619_0031481 3300053085 Bacteria 3437
456 Ga0501084_0269216 3300054114 Bacteria 1438
457 Ga0590075_004314 3300059424 Bacteria 3366
458 Ga0590075_005913 3300059424 Bacteria 2893
459 Ga0590075_033582 3300059424 Bacteria 1303
460 Ga0501082_0052100 3300060353 Bacteria 3527
461 Ga0501082_0253440 3300060353 Bacteria 1531
462 Ga0530510_0198298 3300061734 Bacteria 1490
463 Ga0530510_0244239 3300061734 Bacteria 1337
464 Ga0530510_0278578 3300061734 Bacteria 1249

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_10286345 Ga0207674_102863452 202
2 3300044673 Ga0453683_0149263 Ga0453683_0149263_302_949 214
3 3300044712 Ga0453684_0043756 Ga0453684_0043756_3168_3815 214
4 3300045051 Ga0451576_0005300 Ga0451576_0005300_9056_9703 214
5 3300049656 Ga0501209_150795 Ga0501209_150795_22_675 215
6 3300042144 Ga0450889_004721 Ga0450889_004721_288_1013 226
7 3300049575 Ga0501039_0048103 Ga0501039_0048103_2539_3252 226
8 3300053077 Ga0495601_0058326 Ga0495601_0058326_20_712 230
9 3300042876 Ga0451577_0000006 Ga0451577_0000006_419134_419883 234
10 3300044673 Ga0453683_0000088 Ga0453683_0000088_137224_137973 234
11 3300044712 Ga0453684_0000037 Ga0453684_0000037_419129_419878 234
12 3300045051 Ga0451576_0047121 Ga0451576_0047121_2287_3036 234
13 3300005467 Ga0070706_100011793 Ga0070706_1000117936 236
14 3300006051 Ga0075364_10047604 Ga0075364_100476042 236
15 3300006178 Ga0075367_10010858 Ga0075367_100108582 236
16 3300050490 nmdc:mga03n38_66559_c1 nmdc:mga03n38_66559_c1_583_1293 236
17 3300050492 nmdc:mga0yw44_375828_c1 nmdc:mga0yw44_375828_c1_213_938 236
18 3300050495 nmdc:mga04h51_57298_c1 nmdc:mga04h51_57298_c1_48_758 236
19 3300004803 Ga0058862_12677821 Ga0058862_126778211 237
20 3300004803 Ga0058862_12781598 Ga0058862_127815983 237
21 3300021384 Ga0213876_10016993 Ga0213876_100169931 237
22 3300031903 Ga0307407_10090510 Ga0307407_100905102 237
23 3300031903 Ga0307407_10365109 Ga0307407_103651092 237
24 3300031995 Ga0307409_100092397 Ga0307409_1000923975 237
25 3300032002 Ga0307416_100076811 Ga0307416_1000768112 237
26 3300032005 Ga0307411_10096077 Ga0307411_100960773 237
27 3300059424 Ga0590075_004314 Ga0590075_004314_2142_2870 237
28 3300030745 Ga0316182_1102604 Ga0316182_11026042 242
29 3300005295 Ga0065707_10157277 Ga0065707_101572772 247
30 3300009094 Ga0111539_10493398 Ga0111539_104933982 247
31 3300009147 Ga0114129_10025977 Ga0114129_100259777 247
32 3300046517 Ga0495630_0023183 Ga0495630_0023183_3416_4159 247
33 3300050507 nmdc:mga05p37_49727_c1 nmdc:mga05p37_49727_c1_4018_4764 247
34 3300053080 Ga0500635_0005767 Ga0500635_0005767_548_1291 247
35 3300001977 JGI24746J21847_1000439 JGI24746J21847_10004395 248
36 3300005328 Ga0070676_10089255 Ga0070676_100892552 248
37 3300005344 Ga0070661_100025478 Ga0070661_1000254783 248
38 3300005435 Ga0070714_100272636 Ga0070714_1002726362 248
39 3300005444 Ga0070694_100033008 Ga0070694_1000330085 248
40 3300005445 Ga0070708_100234209 Ga0070708_1002342093 248
41 3300005459 Ga0068867_100000218 Ga0068867_10000021817 248
42 3300005468 Ga0070707_100250604 Ga0070707_1002506042 248
43 3300005468 Ga0070707_100578572 Ga0070707_1005785721 248
44 3300005471 Ga0070698_100473801 Ga0070698_1004738011 248
45 3300005471 Ga0070698_100558399 Ga0070698_1005583992 248
46 3300005471 Ga0070698_100659716 Ga0070698_1006597162 248
47 3300005518 Ga0070699_100046351 Ga0070699_1000463511 248
48 3300005518 Ga0070699_100378282 Ga0070699_1003782822 248
49 3300005536 Ga0070697_100000351 Ga0070697_10000035143 248
50 3300005536 Ga0070697_100445092 Ga0070697_1004450922 248
51 3300005545 Ga0070695_100005251 Ga0070695_1000052519 248
52 3300005718 Ga0068866_10018240 Ga0068866_100182402 248
53 3300006871 Ga0075434_100207960 Ga0075434_1002079603 248
54 3300009147 Ga0114129_10418863 Ga0114129_104188632 248
55 3300009147 Ga0114129_10630303 Ga0114129_106303032 248
56 3300009148 Ga0105243_10000049 Ga0105243_10000049138 248
57 3300014745 Ga0157377_10040483 Ga0157377_100404833 248
58 3300014969 Ga0157376_10011279 Ga0157376_100112793 248
59 3300025907 Ga0207645_10193102 Ga0207645_101931022 248
60 3300025910 Ga0207684_10002609 Ga0207684_100026092 248
61 3300025910 Ga0207684_10022921 Ga0207684_100229215 248
62 3300025910 Ga0207684_10139657 Ga0207684_101396574 248
63 3300025920 Ga0207649_10006351 Ga0207649_100063513 248
64 3300025922 Ga0207646_10001744 Ga0207646_1000174426 248
65 3300025922 Ga0207646_10230535 Ga0207646_102305352 248
66 3300025935 Ga0207709_10000097 Ga0207709_1000009716 248
67 3300025938 Ga0207704_10102930 Ga0207704_101029302 248
68 3300025945 Ga0207679_10000541 Ga0207679_1000054128 248
69 3300026089 Ga0207648_10000083 Ga0207648_1000008375 248
70 3300031241 Ga0265325_10039150 Ga0265325_100391502 248
71 3300039062 Ga0400483_168849 Ga0400483_168849_11403_12170 248
72 3300041408 Ga0439453_0000086 Ga0439453_0000086_5288_6121 248
73 3300042144 Ga0450889_006936 Ga0450889_006936_162_956 248
74 3300044712 Ga0453684_0057007 Ga0453684_0057007_1071_1841 248
75 3300049578 Ga0501042_0269598 Ga0501042_0269598_431_1183 248
76 3300049586 Ga0501070_0241693 Ga0501070_0241693_439_1233 248
77 3300049588 Ga0501072_0021548 Ga0501072_0021548_635_1387 248
78 3300049741 Ga0501079_0445035 Ga0501079_0445035_98_850 248
79 3300049742 Ga0501080_0166791 Ga0501080_0166791_269_1021 248
80 3300049743 Ga0501081_0019551 Ga0501081_0019551_2217_2969 248
81 3300050507 nmdc:mga05p37_335929_c1 nmdc:mga05p37_335929_c1_346_1101 248
82 3300050507 nmdc:mga05p37_431200_c1 nmdc:mga05p37_431200_c1_501_1256 248
83 3300050514 nmdc:mga08x19_319527_c1 nmdc:mga08x19_319527_c1_148_897 248
84 3300050515 nmdc:mga0a205_404340_c1 nmdc:mga0a205_404340_c1_115_864 248
85 3300061734 Ga0530510_0244239 Ga0530510_0244239_267_1019 248
86 2162886007 SwRhRL2b_contig_3021854 SwRhRL2b_0356.00001310 249
87 3300005289 Ga0065704_10094280 Ga0065704_100942802 249
88 3300005295 Ga0065707_10117488 Ga0065707_101174882 249
89 3300005295 Ga0065707_10124509 Ga0065707_101245093 249
90 3300005328 Ga0070676_10002352 Ga0070676_100023522 249
91 3300005329 Ga0070683_100029138 Ga0070683_1000291386 249
92 3300005330 Ga0070690_100001487 Ga0070690_1000014878 249
93 3300005330 Ga0070690_100025120 Ga0070690_1000251203 249
94 3300005331 Ga0070670_100007145 Ga0070670_10000714517 249
95 3300005333 Ga0070677_10000876 Ga0070677_1000087619 249
96 3300005334 Ga0068869_100002424 Ga0068869_1000024243 249
97 3300005335 Ga0070666_10056014 Ga0070666_100560145 249
98 3300005336 Ga0070680_100001398 Ga0070680_10000139810 249
99 3300005337 Ga0070682_100039950 Ga0070682_1000399503 249
100 3300005338 Ga0068868_100436321 Ga0068868_1004363212 249
101 3300005339 Ga0070660_100018135 Ga0070660_1000181358 249
102 3300005340 Ga0070689_100047490 Ga0070689_1000474906 249
103 3300005341 Ga0070691_10034998 Ga0070691_100349984 249
104 3300005343 Ga0070687_100018120 Ga0070687_1000181203 249
105 3300005343 Ga0070687_100220404 Ga0070687_1002204041 249
106 3300005344 Ga0070661_100004891 Ga0070661_10000489110 249
107 3300005345 Ga0070692_10105828 Ga0070692_101058282 249
108 3300005347 Ga0070668_100039054 Ga0070668_1000390543 249
109 3300005353 Ga0070669_100070016 Ga0070669_1000700162 249
110 3300005355 Ga0070671_100021110 Ga0070671_1000211103 249
111 3300005356 Ga0070674_100011117 Ga0070674_1000111178 249
112 3300005364 Ga0070673_100028371 Ga0070673_1000283712 249
113 3300005364 Ga0070673_100746429 Ga0070673_1007464291 249
114 3300005366 Ga0070659_100118915 Ga0070659_1001189153 249
115 3300005406 Ga0070703_10005450 Ga0070703_100054503 249
116 3300005435 Ga0070714_100027086 Ga0070714_1000270868 249
117 3300005435 Ga0070714_100091616 Ga0070714_1000916162 249
118 3300005435 Ga0070714_100321409 Ga0070714_1003214092 249
119 3300005436 Ga0070713_100021996 Ga0070713_1000219962 249
120 3300005437 Ga0070710_10306865 Ga0070710_103068651 249
121 3300005439 Ga0070711_100457267 Ga0070711_1004572672 249
122 3300005440 Ga0070705_100015576 Ga0070705_1000155763 249
123 3300005440 Ga0070705_100025577 Ga0070705_1000255772 249
124 3300005440 Ga0070705_100030655 Ga0070705_1000306554 249
125 3300005440 Ga0070705_100091803 Ga0070705_1000918032 249
126 3300005440 Ga0070705_100125705 Ga0070705_1001257051 249
127 3300005440 Ga0070705_100261142 Ga0070705_1002611422 249
128 3300005441 Ga0070700_100007161 Ga0070700_1000071617 249
129 3300005444 Ga0070694_100050477 Ga0070694_1000504772 249
130 3300005445 Ga0070708_100000027 Ga0070708_1000000276 249
131 3300005445 Ga0070708_100001490 Ga0070708_1000014905 249
132 3300005445 Ga0070708_100049189 Ga0070708_1000491893 249
133 3300005445 Ga0070708_100059463 Ga0070708_1000594632 249
134 3300005445 Ga0070708_100170936 Ga0070708_1001709363 249
135 3300005455 Ga0070663_100110033 Ga0070663_1001100332 249
136 3300005456 Ga0070678_100000687 Ga0070678_10000068718 249
137 3300005458 Ga0070681_10007331 Ga0070681_100073312 249
138 3300005459 Ga0068867_100002011 Ga0068867_1000020116 249
139 3300005467 Ga0070706_100000117 Ga0070706_1000001176 249
140 3300005467 Ga0070706_100000547 Ga0070706_10000054736 249
141 3300005467 Ga0070706_100001931 Ga0070706_10000193120 249
142 3300005467 Ga0070706_100009741 Ga0070706_10000974113 249
143 3300005467 Ga0070706_100016257 Ga0070706_1000162576 249
144 3300005468 Ga0070707_100000060 Ga0070707_100000060113 249
145 3300005468 Ga0070707_100001828 Ga0070707_10000182828 249
146 3300005468 Ga0070707_100010596 Ga0070707_1000105969 249
147 3300005468 Ga0070707_100043111 Ga0070707_1000431112 249
148 3300005468 Ga0070707_100064893 Ga0070707_1000648936 249
149 3300005468 Ga0070707_100102186 Ga0070707_1001021863 249
150 3300005468 Ga0070707_100256847 Ga0070707_1002568473 249
151 3300005468 Ga0070707_100294316 Ga0070707_1002943162 249
152 3300005471 Ga0070698_100018273 Ga0070698_1000182739 249
153 3300005471 Ga0070698_100023059 Ga0070698_1000230592 249
154 3300005471 Ga0070698_100102838 Ga0070698_1001028385 249
155 3300005471 Ga0070698_100201083 Ga0070698_1002010834 249
156 3300005471 Ga0070698_100456312 Ga0070698_1004563122 249
157 3300005518 Ga0070699_100000685 Ga0070699_10000068531 249
158 3300005518 Ga0070699_100000784 Ga0070699_1000007846 249
159 3300005518 Ga0070699_100002925 Ga0070699_10000292518 249
160 3300005518 Ga0070699_100053088 Ga0070699_1000530883 249
161 3300005518 Ga0070699_100065427 Ga0070699_1000654275 249
162 3300005518 Ga0070699_100221941 Ga0070699_1002219412 249
163 3300005535 Ga0070684_100092388 Ga0070684_1000923882 249
164 3300005536 Ga0070697_100001474 Ga0070697_10000147426 249
165 3300005536 Ga0070697_100014335 Ga0070697_1000143356 249
166 3300005536 Ga0070697_100016182 Ga0070697_1000161821 249
167 3300005536 Ga0070697_100052182 Ga0070697_1000521822 249
168 3300005536 Ga0070697_100077619 Ga0070697_1000776191 249
169 3300005536 Ga0070697_100095218 Ga0070697_1000952182 249
170 3300005536 Ga0070697_100127760 Ga0070697_1001277603 249
171 3300005536 Ga0070697_100219435 Ga0070697_1002194352 249
172 3300005536 Ga0070697_100231399 Ga0070697_1002313991 249
173 3300005543 Ga0070672_100010522 Ga0070672_1000105229 249
174 3300005543 Ga0070672_100016350 Ga0070672_1000163503 249
175 3300005544 Ga0070686_100027236 Ga0070686_1000272363 249
176 3300005545 Ga0070695_100029506 Ga0070695_1000295062 249
177 3300005545 Ga0070695_100471286 Ga0070695_1004712861 249
178 3300005546 Ga0070696_100051210 Ga0070696_1000512103 249
179 3300005546 Ga0070696_100403131 Ga0070696_1004031312 249
180 3300005547 Ga0070693_100203796 Ga0070693_1002037961 249
181 3300005547 Ga0070693_100363412 Ga0070693_1003634122 249
182 3300005549 Ga0070704_100004934 Ga0070704_10000493411 249
183 3300005549 Ga0070704_100006043 Ga0070704_10000604310 249
184 3300005549 Ga0070704_100130670 Ga0070704_1001306702 249
185 3300005564 Ga0070664_100004346 Ga0070664_1000043468 249
186 3300005577 Ga0068857_100091178 Ga0068857_1000911783 249
187 3300005618 Ga0068864_100106443 Ga0068864_1001064435 249
188 3300005618 Ga0068864_100191261 Ga0068864_1001912611 249
189 3300005718 Ga0068866_10025428 Ga0068866_100254283 249
190 3300005842 Ga0068858_100131773 Ga0068858_1001317734 249
191 3300005843 Ga0068860_100029433 Ga0068860_1000294338 249
192 3300005844 Ga0068862_100007798 Ga0068862_1000077982 249
193 3300005937 Ga0081455_10003827 Ga0081455_1000382710 249
194 3300005981 Ga0081538_10020098 Ga0081538_100200986 249
195 3300005981 Ga0081538_10022736 Ga0081538_100227363 249
196 3300005981 Ga0081538_10082674 Ga0081538_100826743 249
197 3300005985 Ga0081539_10000187 Ga0081539_10000187153 249
198 3300005985 Ga0081539_10023492 Ga0081539_100234924 249
199 3300006028 Ga0070717_10000007 Ga0070717_1000000725 249
200 3300006028 Ga0070717_10008688 Ga0070717_1000868810 249
201 3300006028 Ga0070717_10034873 Ga0070717_100348734 249
202 3300006173 Ga0070716_100076540 Ga0070716_1000765403 249
203 3300006237 Ga0097621_100030761 Ga0097621_1000307613 249
204 3300006237 Ga0097621_100037374 Ga0097621_1000373743 249
205 3300006358 Ga0068871_100285934 Ga0068871_1002859342 249
206 3300006844 Ga0075428_100123908 Ga0075428_1001239082 249
207 3300006844 Ga0075428_100289686 Ga0075428_1002896862 249
208 3300006846 Ga0075430_100003584 Ga0075430_10000358416 249
209 3300006846 Ga0075430_100011986 Ga0075430_10001198611 249
210 3300006847 Ga0075431_100009425 Ga0075431_1000094253 249
211 3300006847 Ga0075431_100009466 Ga0075431_10000946611 249
212 3300006852 Ga0075433_10012940 Ga0075433_1001294012 249
213 3300006852 Ga0075433_10137694 Ga0075433_101376943 249
214 3300006871 Ga0075434_100163257 Ga0075434_1001632572 249
215 3300006871 Ga0075434_100364703 Ga0075434_1003647032 249
216 3300006880 Ga0075429_100030783 Ga0075429_1000307837 249
217 3300006881 Ga0068865_100001372 Ga0068865_10000137225 249
218 3300006914 Ga0075436_100038296 Ga0075436_1000382962 249
219 3300006914 Ga0075436_100041209 Ga0075436_1000412093 249
220 3300006914 Ga0075436_100160869 Ga0075436_1001608691 249
221 3300007076 Ga0075435_100061967 Ga0075435_1000619672 249
222 3300007076 Ga0075435_100140037 Ga0075435_1001400374 249
223 3300007076 Ga0075435_100181585 Ga0075435_1001815853 249
224 3300007265 Ga0099794_10000117 Ga0099794_1000011723 249
225 3300007265 Ga0099794_10004600 Ga0099794_100046003 249
226 3300007265 Ga0099794_10225257 Ga0099794_102252571 249
227 3300009098 Ga0105245_10002155 Ga0105245_100021552 249
228 3300009147 Ga0114129_10015428 Ga0114129_1001542813 249
229 3300009147 Ga0114129_10033158 Ga0114129_100331582 249
230 3300009147 Ga0114129_10119665 Ga0114129_101196654 249
231 3300009147 Ga0114129_10270489 Ga0114129_102704894 249
232 3300009148 Ga0105243_10002596 Ga0105243_100025966 249
233 3300009176 Ga0105242_10001315 Ga0105242_1000131525 249
234 3300009553 Ga0105249_10001784 Ga0105249_1000178418 249
235 3300010375 Ga0105239_10132652 Ga0105239_101326522 249
236 3300011119 Ga0105246_10000933 Ga0105246_100009339 249
237 3300013105 Ga0157369_10031128 Ga0157369_100311287 249
238 3300013105 Ga0157369_10667919 Ga0157369_106679192 249
239 3300013296 Ga0157374_10004664 Ga0157374_1000466416 249
240 3300013297 Ga0157378_10017169 Ga0157378_100171692 249
241 3300013306 Ga0163162_10226389 Ga0163162_102263891 249
242 3300014326 Ga0157380_10015563 Ga0157380_100155638 249
243 3300014326 Ga0157380_10032645 Ga0157380_100326454 249
244 3300014745 Ga0157377_10043021 Ga0157377_100430212 249
245 3300014969 Ga0157376_10000962 Ga0157376_100009626 249
246 3300021384 Ga0213876_10009713 Ga0213876_100097134 249
247 3300021388 Ga0213875_10006988 Ga0213875_100069883 249
248 3300022467 Ga0224712_10179793 Ga0224712_101797931 249
249 3300025885 Ga0207653_10001462 Ga0207653_100014626 249
250 3300025893 Ga0207682_10030281 Ga0207682_100302812 249
251 3300025898 Ga0207692_10263003 Ga0207692_102630032 249
252 3300025899 Ga0207642_10245301 Ga0207642_102453012 249
253 3300025901 Ga0207688_10001296 Ga0207688_1000129623 249
254 3300025903 Ga0207680_10004142 Ga0207680_1000414211 249
255 3300025903 Ga0207680_10025370 Ga0207680_100253704 249
256 3300025904 Ga0207647_10095905 Ga0207647_100959053 249
257 3300025907 Ga0207645_10001331 Ga0207645_1000133123 249
258 3300025910 Ga0207684_10000002 Ga0207684_10000002396 249
259 3300025910 Ga0207684_10000026 Ga0207684_1000002636 249
260 3300025910 Ga0207684_10000148 Ga0207684_1000014837 249
261 3300025910 Ga0207684_10000222 Ga0207684_1000022238 249
262 3300025910 Ga0207684_10067051 Ga0207684_100670511 249
263 3300025910 Ga0207684_10225000 Ga0207684_102250002 249
264 3300025910 Ga0207684_10285644 Ga0207684_102856442 249
265 3300025910 Ga0207684_10296857 Ga0207684_102968571 249
266 3300025912 Ga0207707_10005817 Ga0207707_100058175 249
267 3300025912 Ga0207707_10037560 Ga0207707_100375603 249
268 3300025915 Ga0207693_10131173 Ga0207693_101311733 249
269 3300025916 Ga0207663_10365566 Ga0207663_103655661 249
270 3300025917 Ga0207660_10034701 Ga0207660_100347013 249
271 3300025917 Ga0207660_10047074 Ga0207660_100470743 249
272 3300025918 Ga0207662_10023453 Ga0207662_100234535 249
273 3300025919 Ga0207657_10003006 Ga0207657_1000300613 249
274 3300025920 Ga0207649_10003938 Ga0207649_100039384 249
275 3300025922 Ga0207646_10000143 Ga0207646_100001436 249
276 3300025922 Ga0207646_10000394 Ga0207646_1000039437 249
277 3300025922 Ga0207646_10000668 Ga0207646_1000066838 249
278 3300025922 Ga0207646_10005654 Ga0207646_100056542 249
279 3300025922 Ga0207646_10017539 Ga0207646_100175397 249
280 3300025922 Ga0207646_10033781 Ga0207646_100337816 249
281 3300025922 Ga0207646_10103108 Ga0207646_101031083 249
282 3300025922 Ga0207646_10230501 Ga0207646_102305013 249
283 3300025922 Ga0207646_10578177 Ga0207646_105781771 249
284 3300025923 Ga0207681_10027152 Ga0207681_100271524 249
285 3300025925 Ga0207650_10157615 Ga0207650_101576152 249
286 3300025926 Ga0207659_10009763 Ga0207659_100097639 249
287 3300025927 Ga0207687_10047613 Ga0207687_100476133 249
288 3300025928 Ga0207700_10066664 Ga0207700_100666643 249
289 3300025929 Ga0207664_10001273 Ga0207664_1000127322 249
290 3300025931 Ga0207644_10033413 Ga0207644_100334133 249
291 3300025931 Ga0207644_10171807 Ga0207644_101718072 249
292 3300025932 Ga0207690_10045187 Ga0207690_100451875 249
293 3300025933 Ga0207706_10002541 Ga0207706_1000254124 249
294 3300025934 Ga0207686_10113734 Ga0207686_101137343 249
295 3300025935 Ga0207709_10113365 Ga0207709_101133652 249
296 3300025936 Ga0207670_10013450 Ga0207670_100134506 249
297 3300025936 Ga0207670_10051099 Ga0207670_100510995 249
298 3300025937 Ga0207669_10001785 Ga0207669_100017858 249
299 3300025938 Ga0207704_10001466 Ga0207704_100014667 249
300 3300025939 Ga0207665_10027217 Ga0207665_100272175 249
301 3300025939 Ga0207665_10190708 Ga0207665_101907082 249
302 3300025939 Ga0207665_10307824 Ga0207665_103078242 249
303 3300025939 Ga0207665_10313529 Ga0207665_103135292 249
304 3300025940 Ga0207691_10000955 Ga0207691_1000095525 249
305 3300025940 Ga0207691_10041727 Ga0207691_100417273 249
306 3300025942 Ga0207689_10014066 Ga0207689_100140668 249
307 3300025942 Ga0207689_10269063 Ga0207689_102690633 249
308 3300025944 Ga0207661_10090706 Ga0207661_100907063 249
309 3300025945 Ga0207679_10030510 Ga0207679_100305103 249
310 3300025960 Ga0207651_10130399 Ga0207651_101303992 249
311 3300025972 Ga0207668_10050776 Ga0207668_100507765 249
312 3300025986 Ga0207658_10098720 Ga0207658_100987202 249
313 3300026067 Ga0207678_10094564 Ga0207678_100945643 249
314 3300026075 Ga0207708_10000561 Ga0207708_1000056124 249
315 3300026089 Ga0207648_10001233 Ga0207648_1000123325 249
316 3300026095 Ga0207676_10239087 Ga0207676_102390872 249
317 3300026116 Ga0207674_10051238 Ga0207674_100512385 249
318 3300026121 Ga0207683_10000895 Ga0207683_1000089525 249
319 3300026121 Ga0207683_10276926 Ga0207683_102769262 249
320 3300027252 Ga0209973_1002123 Ga0209973_10021232 249
321 3300027360 Ga0209969_1000104 Ga0209969_10001044 249
322 3300027364 Ga0209967_1000038 Ga0209967_10000384 249
323 3300027378 Ga0209981_1000268 Ga0209981_10002687 249
324 3300027395 Ga0209996_1000062 Ga0209996_10000625 249
325 3300027424 Ga0209984_1000027 Ga0209984_10000274 249
326 3300027462 Ga0210000_1000018 Ga0210000_100001825 249
327 3300027471 Ga0209995_1000015 Ga0209995_100001525 249
328 3300027526 Ga0209968_1000052 Ga0209968_100005224 249
329 3300027552 Ga0209982_1000018 Ga0209982_100001818 249
330 3300027614 Ga0209970_1000260 Ga0209970_10002608 249
331 3300027617 Ga0210002_1000043 Ga0210002_100004320 249
332 3300027671 Ga0209588_1000036 Ga0209588_100003644 249
333 3300027682 Ga0209971_1000266 Ga0209971_10002664 249
334 3300027682 Ga0209971_1009970 Ga0209971_10099703 249
335 3300027695 Ga0209966_1000180 Ga0209966_100018018 249
336 3300027717 Ga0209998_10000137 Ga0209998_1000013720 249
337 3300027876 Ga0209974_10003579 Ga0209974_100035798 249
338 3300027907 Ga0207428_10000452 Ga0207428_100004529 249
339 3300028380 Ga0268265_10007292 Ga0268265_1000729211 249
340 3300028381 Ga0268264_10319587 Ga0268264_103195872 249
341 3300031548 Ga0307408_100139674 Ga0307408_1001396742 249
342 3300031731 Ga0307405_10396215 Ga0307405_103962151 249
343 3300031731 Ga0307405_10668491 Ga0307405_106684911 249
344 3300031824 Ga0307413_10052889 Ga0307413_100528894 249
345 3300031824 Ga0307413_10268332 Ga0307413_102683322 249
346 3300031852 Ga0307410_10175784 Ga0307410_101757843 249
347 3300031901 Ga0307406_10164704 Ga0307406_101647041 249
348 3300031995 Ga0307409_100336532 Ga0307409_1003365322 249
349 3300032002 Ga0307416_100216144 Ga0307416_1002161442 249
350 3300032004 Ga0307414_10054992 Ga0307414_100549923 249
351 3300032004 Ga0307414_10095671 Ga0307414_100956712 249
352 3300032126 Ga0307415_100316471 Ga0307415_1003164712 249
353 3300032126 Ga0307415_100514262 Ga0307415_1005142622 249
354 3300035691 Ga0373931_0078226 Ga0373931_0078226_675_1424 249
355 3300035692 Ga0373935_0190004 Ga0373935_0190004_100_849 249
356 3300035724 Ga0373933_0029081 Ga0373933_0029081_286_1035 249
357 3300036647 Ga0316582_0007903 Ga0316582_0007903_1722_2504 249
358 3300037068 Ga0373925_0039769 Ga0373925_0039769_738_1487 249
359 3300037588 Ga0316581_0012351 Ga0316581_0012351_685_1467 249
360 3300037853 Ga0436364_0367212 Ga0436364_0367212_13823_14599 249
361 3300037853 Ga0436364_1270093 Ga0436364_1270093_616_1413 249
362 3300039437 Ga0436365_0222942 Ga0436365_0222942_2889_3689 249
363 3300039437 Ga0436365_1544784 Ga0436365_1544784_1500_2276 249
364 3300039437 Ga0436365_1662543 Ga0436365_1662543_11468_12244 249
365 3300039450 Ga0436363_0133663 Ga0436363_0133663_5634_6410 249
366 3300039450 Ga0436363_0145734 Ga0436363_0145734_2013_2789 249
367 3300042000 Ga0439437_007560 Ga0439437_007560_446_1195 249
368 3300042876 Ga0451577_0341592 Ga0451577_0341592_407_1156 249
369 3300044684 Ga0466966_0216255 Ga0466966_0216255_357_1133 249
370 3300044693 Ga0466961_0009202 Ga0466961_0009202_3706_4482 249
371 3300044694 Ga0466963_0001026 Ga0466963_0001026_12785_13561 249
372 3300044694 Ga0466963_0363027 Ga0466963_0363027_146_895 249
373 3300044712 Ga0453684_0008501 Ga0453684_0008501_5308_6057 249
374 3300044712 Ga0453684_0025015 Ga0453684_0025015_4944_5747 249
375 3300044712 Ga0453684_0086711 Ga0453684_0086711_132_935 249
376 3300044765 Ga0466970_0034497 Ga0466970_0034497_1641_2417 249
377 3300044842 Ga0466957_0069240 Ga0466957_0069240_1012_1788 249
378 3300045049 Ga0466959_0000810 Ga0466959_0000810_12644_13420 249
379 3300045049 Ga0466959_0146969 Ga0466959_0146969_52_828 249
380 3300045051 Ga0451576_0000298 Ga0451576_0000298_62166_62969 249
381 3300045051 Ga0451576_0310218 Ga0451576_0310218_248_997 249
382 3300045836 Ga0466958_0001100 Ga0466958_0001100_10697_11473 249
383 3300045836 Ga0466958_0210397 Ga0466958_0210397_139_915 249
384 3300045976 Ga0466967_0062465 Ga0466967_0062465_338_1096 249
385 3300046458 Ga0495591_060169 Ga0495591_060169_180_929 249
386 3300046459 Ga0495629_0043853 Ga0495629_0043853_1940_2689 249
387 3300046476 Ga0495662_0114250 Ga0495662_0114250_502_1251 249
388 3300046491 Ga0495584_0108087 Ga0495584_0108087_485_1234 249
389 3300046499 Ga0495594_0044035 Ga0495594_0044035_1078_1827 249
390 3300046675 Ga0495657_0003784 Ga0495657_0003784_10173_10922 249
391 3300046690 Ga0495624_0068025 Ga0495624_0068025_1288_2037 249
392 3300046809 Ga0495600_0112103 Ga0495600_0112103_540_1289 249
393 3300047315 Ga0495581_0106549 Ga0495581_0106549_353_1102 249
394 3300047319 Ga0495674_0408008 Ga0495674_0408008_284_1060 249
395 3300047321 Ga0495676_0043484 Ga0495676_0043484_2095_2886 249
396 3300047322 Ga0495680_0029262 Ga0495680_0029262_1155_1904 249
397 3300048913 Ga0496110_0336238 Ga0496110_0336238_496_1245 249
398 3300049569 Ga0501032_0016350 Ga0501032_0016350_593_1348 249
399 3300049569 Ga0501032_0086233 Ga0501032_0086233_200_949 249
400 3300049570 Ga0501033_0075609 Ga0501033_0075609_1585_2334 249
401 3300049572 Ga0501036_0130131 Ga0501036_0130131_1303_2061 249
402 3300049573 Ga0501037_0045287 Ga0501037_0045287_2327_3085 249
403 3300049574 Ga0501038_0002519 Ga0501038_0002519_5104_5859 249
404 3300049574 Ga0501038_0116576 Ga0501038_0116576_539_1288 249
405 3300049575 Ga0501039_0147062 Ga0501039_0147062_470_1225 249
406 3300049575 Ga0501039_0155387 Ga0501039_0155387_475_1233 249
407 3300049576 Ga0501040_0060308 Ga0501040_0060308_1788_2543 249
408 3300049576 Ga0501040_0131209 Ga0501040_0131209_975_1733 249
409 3300049577 Ga0501041_0007026 Ga0501041_0007026_4414_5169 249
410 3300049578 Ga0501042_0005863 Ga0501042_0005863_5653_6408 249
411 3300049579 Ga0501043_0202306 Ga0501043_0202306_46_795 249
412 3300049580 Ga0501046_0013923 Ga0501046_0013923_1603_2352 249
413 3300049580 Ga0501046_0017452 Ga0501046_0017452_4731_5486 249
414 3300049581 Ga0501047_0112209 Ga0501047_0112209_191_994 249
415 3300049582 Ga0501048_0201899 Ga0501048_0201899_439_1197 249
416 3300049585 Ga0501069_0053996 Ga0501069_0053996_387_1136 249
417 3300049587 Ga0501071_0020859 Ga0501071_0020859_1758_2507 249
418 3300049588 Ga0501072_0044375 Ga0501072_0044375_1967_2716 249
419 3300049591 Ga0501075_0022983 Ga0501075_0022983_3132_3887 249
420 3300049591 Ga0501075_0173693 Ga0501075_0173693_762_1511 249
421 3300049592 Ga0501076_0021046 Ga0501076_0021046_2052_2801 249
422 3300049592 Ga0501076_0162505 Ga0501076_0162505_163_918 249
423 3300049704 Ga0501221_008057 Ga0501221_008057_615_1379 249
424 3300049741 Ga0501079_0081357 Ga0501079_0081357_1561_2310 249
425 3300049741 Ga0501079_0437783 Ga0501079_0437783_80_835 249
426 3300049742 Ga0501080_0090233 Ga0501080_0090233_1981_2757 249
427 3300049743 Ga0501081_0211390 Ga0501081_0211390_538_1317 249
428 3300049822 Ga0501035_0012778 Ga0501035_0012778_5418_6173 249
429 3300049822 Ga0501035_0408060 Ga0501035_0408060_151_900 249
430 3300049824 Ga0501045_0095074 Ga0501045_0095074_140_889 249
431 3300049851 Ga0501212_001657 Ga0501212_001657_1425_2189 249
432 3300050507 nmdc:mga05p37_150384_c1 nmdc:mga05p37_150384_c1_1757_2506 249
433 3300050507 nmdc:mga05p37_16103_c1 nmdc:mga05p37_16103_c1_146_895 249
434 3300050508 nmdc:mga09592_285521_c1 nmdc:mga09592_285521_c1_509_1258 249
435 3300050509 nmdc:mga0qj67_14052_c1 nmdc:mga0qj67_14052_c1_2842_3636 249
436 3300050509 nmdc:mga0qj67_2019_c1 nmdc:mga0qj67_2019_c1_5974_6723 249
437 3300050509 nmdc:mga0qj67_25295_c1 nmdc:mga0qj67_25295_c1_1282_2031 249
438 3300050509 nmdc:mga0qj67_46834_c1 nmdc:mga0qj67_46834_c1_2498_3247 249
439 3300050510 nmdc:mga06r32_27115_c1 nmdc:mga06r32_27115_c1_4141_4890 249
440 3300050510 nmdc:mga06r32_3627_c1 nmdc:mga06r32_3627_c1_3761_4510 249
441 3300050510 nmdc:mga06r32_37753_c1 nmdc:mga06r32_37753_c1_817_1611 249
442 3300050511 nmdc:mga08y16_238397_c1 nmdc:mga08y16_238397_c1_789_1538 249
443 3300050512 nmdc:mga0n895_375668_c1 nmdc:mga0n895_375668_c1_251_1045 249
444 3300050512 nmdc:mga0n895_478423_c1 nmdc:mga0n895_478423_c1_237_992 249
445 3300050512 nmdc:mga0n895_77732_c1 nmdc:mga0n895_77732_c1_927_1682 249
446 3300050513 nmdc:mga0rr50_546936_c1 nmdc:mga0rr50_546936_c1_221_970 249
447 3300050513 nmdc:mga0rr50_88436_c1 nmdc:mga0rr50_88436_c1_361_1116 249
448 3300050514 nmdc:mga08x19_164304_c1 nmdc:mga08x19_164304_c1_225_974 249
449 3300050514 nmdc:mga08x19_375111_c1 nmdc:mga08x19_375111_c1_11_778 249
450 3300050514 nmdc:mga08x19_55626_c1 nmdc:mga08x19_55626_c1_448_1197 249
451 3300050514 nmdc:mga08x19_63277_c1 nmdc:mga08x19_63277_c1_194_943 249
452 3300050515 nmdc:mga0a205_186553_c1 nmdc:mga0a205_186553_c1_425_1219 249
453 3300050515 nmdc:mga0a205_23315_c1 nmdc:mga0a205_23315_c1_954_1703 249
454 3300050515 nmdc:mga0a205_8227_c1 nmdc:mga0a205_8227_c1_4326_5081 249
455 3300050515 nmdc:mga0a205_97995_c1 nmdc:mga0a205_97995_c1_1113_1862 249
456 3300053085 Ga0495619_0031129 Ga0495619_0031129_1590_2339 249
457 3300053085 Ga0495619_0031481 Ga0495619_0031481_2566_3315 249
458 3300054114 Ga0501084_0269216 Ga0501084_0269216_140_889 249
459 3300059424 Ga0590075_005913 Ga0590075_005913_76_825 249
460 3300059424 Ga0590075_033582 Ga0590075_033582_385_1149 249
461 3300060353 Ga0501082_0052100 Ga0501082_0052100_639_1388 249
462 3300060353 Ga0501082_0253440 Ga0501082_0253440_260_1015 249
463 3300061734 Ga0530510_0198298 Ga0530510_0198298_294_1043 249
464 3300061734 Ga0530510_0278578 Ga0530510_0278578_192_947 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

11

239

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4juq-assembly1.cif.gz_A pseudomonas aeruginosa metap t2n mutant, in mn form 0.9867 1 248
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9854 1 248
1o0x-assembly1.cif.gz_A crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution 0.985 1 249
3tb5-assembly2.cif.gz_B crystal structure of the enterococcus faecalis methionine aminopeptidase apo form 0.9849 1 248
5yxf-assembly1.cif.gz_A mycobacterium tuberculosis methionine aminopeptidase type 1c (c105l mutant) in complex with methionine 0.9833 4 249
ID Description Score Start End Superfamily
af_Q6Z3V9_1_121_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9914 16 124 3.90.230.10
4juqD00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9867 1 248 3.90.230.10
1o0xA00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.985 1 249 3.90.230.10
af_Q9VKV9_33_317_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9849 1 248 3.90.230.10
af_P9WK19_6_284_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9848 4 248 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A7C3XA93-F1-model_v4 Methionine aminopeptidase (EC 3.4.11.18) 0.9981 1 196 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A356ZCU1-F1-model_v4 Type I methionyl aminopeptidase 0.9975 83 188 GO:0005829
GO:0006508
GO:0070006
AF-I3VU54-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9971 1 249 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A3D0E855-F1-model_v4 deleted 0.997 1 249
AF-A0A7C7DIY6-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9968 1 249 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006

Feature Viewer

pLDDT pTM Quality
97.87 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map