F449260

General Info

Members Datasets Scaffolds Average Seq Length
464 273 461 177

Family's Representative Sequence

Representative Sequence 3300005547|Ga0070693_100154450|Ga0070693_1001544502
Length 208
Sequence MSRVMPRSGNMSYAEFLARREFGRDELIALSQGNLVADPPPEFVRLPAPPMLMLDRVVHIERHGTRGRIVGEQDIDVAAWFFHCHFRGDPVQPGCLGVDAVWQLLGLYCGVAGAAGSGRALGCGEVKFDGQIRPHNRRVRYEVTVRRFSSLPMSGAAVAIGDADVLVDDERIYRISAAKVGTFTRIAYPDYPLLSDNARGGVLDRKEG

Samples

Sample ID Description Type Environment
1 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
2 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
3 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
136 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
137 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
142 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
143 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
144 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
157 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
174 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
181 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
185 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
188 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
189 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
190 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
191 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
202 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
203 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
231 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
232 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
233 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
244 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
245 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
246 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
247 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
248 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
249 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
250 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
251 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
252 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
253 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
254 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
255 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
256 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
257 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
258 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
259 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
260 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
261 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
262 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
263 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
264 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
265 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
266 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
267 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
268 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
269 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
270 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
271 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
272 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.56
Nodule 0
Rhizoplane 3.66
Rhizosphere 83.41
Stem 0
Stem Tuber 0
Unclassified 2.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10009406 3300005327 Bacteria 7851
2 Ga0070658_10137760 3300005327 Bacteria 2037
3 Ga0070658_10155492 3300005327 Bacteria 1917
4 Ga0070676_10450575 3300005328 Bacteria 905
5 Ga0070683_100313037 3300005329 Bacteria 1494
6 Ga0070670_100000004 3300005331 Bacteria 392110
7 Ga0070670_100711119 3300005331 Bacteria 904
8 Ga0068869_100580116 3300005334 Bacteria 945
9 Ga0070666_10064468 3300005335 Bacteria 2485
10 Ga0070666_10211508 3300005335 Bacteria 1366
11 Ga0070666_11103589 3300005335 Bacteria 590
12 Ga0070680_100011984 3300005336 Bacteria 6728
13 Ga0070680_100150959 3300005336 Bacteria 1950
14 Ga0070660_100039719 3300005339 Bacteria 3577
15 Ga0070660_100070594 3300005339 Bacteria 2726
16 Ga0070660_100141488 3300005339 Bacteria 1930
17 Ga0070661_100459760 3300005344 Bacteria 1014
18 Ga0070668_100001026 3300005347 Bacteria 19578
19 Ga0070668_100002884 3300005347 Bacteria 12687
20 Ga0070668_100171831 3300005347 Bacteria 1765
21 Ga0070669_100016959 3300005353 Bacteria 5201
22 Ga0070675_100547460 3300005354 Bacteria 1046
23 Ga0070671_100057924 3300005355 Bacteria 3225
24 Ga0070671_100111226 3300005355 Unclassified 2301
25 Ga0070671_100203751 3300005355 Bacteria 1678
26 Ga0070673_100086573 3300005364 Bacteria 2553
27 Ga0070659_100001009 3300005366 Bacteria 20680
28 Ga0070659_100028943 3300005366 Bacteria 4279
29 Ga0070667_100000105 3300005367 Bacteria 106633
30 Ga0070667_100010822 3300005367 Bacteria 7542
31 Ga0070667_100033350 3300005367 Bacteria 4303
32 Ga0070708_101309200 3300005445 Unclassified 677
33 Ga0070678_100225760 3300005456 Bacteria 1559
34 Ga0070678_100383096 3300005456 Bacteria 1217
35 Ga0070662_100015459 3300005457 Bacteria 5113
36 Ga0070681_10008308 3300005458 Bacteria 10166
37 Ga0070681_10046273 3300005458 Bacteria 4350
38 Ga0070681_10511124 3300005458 Bacteria 1114
39 Ga0070681_10933015 3300005458 Bacteria 787
40 Ga0068867_101417560 3300005459 Bacteria 645
41 Ga0070706_100666402 3300005467 Bacteria 965
42 Ga0070698_100075541 3300005471 Bacteria 3374
43 Ga0070698_100646242 3300005471 Unclassified 999
44 Ga0070699_100001747 3300005518 Bacteria 19853
45 Ga0070699_100064607 3300005518 Unclassified 3174
46 Ga0070679_100015873 3300005530 Bacteria 7248
47 Ga0070679_100198726 3300005530 Unclassified 1972
48 Ga0070679_100573683 3300005530 Bacteria 1072
49 Ga0070679_100575611 3300005530 Bacteria 1070
50 Ga0068853_100090492 3300005539 Bacteria 2689
51 Ga0068853_100135039 3300005539 Bacteria 2211
52 Ga0068853_100438727 3300005539 Bacteria 1227
53 Ga0070672_100019179 3300005543 Unclassified 4961
54 Ga0070672_101411893 3300005543 Bacteria 623
55 Ga0070686_100585249 3300005544 Bacteria 877
56 Ga0070693_100154450 3300005547 Bacteria 1456
57 Ga0070665_100000667 3300005548 Bacteria 46192
58 Ga0070665_100000721 3300005548 Bacteria 44003
59 Ga0070665_100000784 3300005548 Bacteria 41804
60 Ga0070665_100009966 3300005548 Bacteria 9611
61 Ga0070665_100284873 3300005548 Unclassified 1654
62 Ga0070704_100084290 3300005549 Bacteria 2349
63 Ga0068855_100017453 3300005563 Bacteria 8633
64 Ga0068855_100092076 3300005563 Bacteria 3496
65 Ga0068855_100688627 3300005563 Bacteria 1095
66 Ga0068854_100208898 3300005578 Bacteria 1539
67 Ga0068856_100461822 3300005614 Bacteria 1290
68 Ga0068852_100621735 3300005616 Bacteria 1086
69 Ga0068859_100030995 3300005617 Bacteria 5366
70 Ga0068859_100198131 3300005617 Bacteria 2093
71 Ga0068864_100000058 3300005618 Bacteria 125688
72 Ga0068864_100000164 3300005618 Bacteria 61477
73 Ga0068864_100011174 3300005618 Bacteria 7419
74 Ga0068864_100074313 3300005618 Bacteria 2966
75 Ga0068861_100538283 3300005719 Bacteria 1062
76 Ga0068863_100000290 3300005841 Bacteria 52019
77 Ga0068863_100032357 3300005841 Bacteria 4985
78 Ga0068858_100000006 3300005842 Bacteria 256011
79 Ga0068858_100137523 3300005842 Bacteria 2293
80 Ga0068858_101038031 3300005842 Bacteria 804
81 Ga0068860_100000077 3300005843 Bacteria 171297
82 Ga0068860_100003889 3300005843 Bacteria 15347
83 Ga0068862_100000363 3300005844 Bacteria 49226
84 Ga0068862_100007824 3300005844 Bacteria 8842
85 Ga0068862_100623372 3300005844 Unclassified 1038
86 Ga0068862_101253089 3300005844 Bacteria 741
87 Ga0075363_100004495 3300006048 Bacteria 6113
88 Ga0070716_100114333 3300006173 Bacteria 1678
89 Ga0070716_100158131 3300006173 Unclassified 1465
90 Ga0075362_10026450 3300006177 Bacteria 2478
91 Ga0075366_10075340 3300006195 Bacteria 2013
92 Ga0075366_10109048 3300006195 Bacteria 1665
93 Ga0097621_100289025 3300006237 Bacteria 1445
94 Ga0075370_10156562 3300006353 Bacteria 1336
95 Ga0075370_10449741 3300006353 Bacteria 775
96 Ga0068871_100133185 3300006358 Bacteria 2109
97 Ga0075428_100041958 3300006844 Bacteria 5031
98 Ga0075428_100286394 3300006844 Bacteria 1773
99 Ga0075430_100196276 3300006846 Bacteria 1677
100 Ga0075431_100108561 3300006847 Bacteria 2864
101 Ga0075433_10222405 3300006852 Bacteria 1677
102 Ga0075434_100026875 3300006871 Bacteria 5645
103 Ga0075434_100149941 3300006871 Bacteria 2352
104 Ga0075429_100916117 3300006880 Unclassified 767
105 Ga0075436_100045709 3300006914 Bacteria 3020
106 Ga0097620_100030996 3300006931 Bacteria 5366
107 Ga0097620_100198116 3300006931 Bacteria 2093
108 Ga0097620_100245348 3300006931 Bacteria 1881
109 Ga0075435_100155340 3300007076 Bacteria 1925
110 Ga0105251_10067762 3300009011 Bacteria 1666
111 Ga0105250_10222910 3300009092 Bacteria 800
112 Ga0105240_10003768 3300009093 Bacteria 23424
113 Ga0105240_10010647 3300009093 Bacteria 12915
114 Ga0105240_10098344 3300009093 Bacteria 3564
115 Ga0105240_10194131 3300009093 Bacteria 2385
116 Ga0105240_10610867 3300009093 Bacteria 1199
117 Ga0111539_10028683 3300009094 Bacteria 6788
118 Ga0111539_10104901 3300009094 Bacteria 3316
119 Ga0111539_10747052 3300009094 Bacteria 1139
120 Ga0105247_10048989 3300009101 Bacteria 2597
121 Ga0114129_10454998 3300009147 Bacteria 1678
122 Ga0114129_10528931 3300009147 Bacteria 1536
123 Ga0114129_11239274 3300009147 Bacteria 927
124 Ga0105243_11054343 3300009148 Bacteria 819
125 Ga0105243_11601518 3300009148 Bacteria 678
126 Ga0105241_10313878 3300009174 Bacteria 1349
127 Ga0105241_10508569 3300009174 Bacteria 1075
128 Ga0105248_10000650 3300009177 Bacteria 39474
129 Ga0105248_10048693 3300009177 Bacteria 4753
130 Ga0105248_10059769 3300009177 Bacteria 4282
131 Ga0105248_10083714 3300009177 Bacteria 3588
132 Ga0105248_10294698 3300009177 Bacteria 1827
133 Ga0105238_10097386 3300009551 Bacteria 2927
134 Ga0105238_10284412 3300009551 Bacteria 1635
135 Ga0105238_10558754 3300009551 Bacteria 1149
136 Ga0105238_10637899 3300009551 Bacteria 1075
137 Ga0105249_10003268 3300009553 Bacteria 14047
138 Ga0105249_10176482 3300009553 Bacteria 2075
139 Ga0105249_10427278 3300009553 Bacteria 1360
140 Ga0105249_10517308 3300009553 Bacteria 1240
141 Ga0105249_10793679 3300009553 Bacteria 1011
142 Ga0105249_11939603 3300009553 Bacteria 662
143 Ga0105239_10235322 3300010375 Bacteria 2056
144 Ga0105239_10351020 3300010375 Bacteria 1665
145 Ga0105239_10863297 3300010375 Bacteria 1038
146 Ga0105246_10244328 3300011119 Bacteria 1421
147 Ga0157373_10234927 3300013100 Bacteria 1295
148 Ga0157370_10002443 3300013104 Bacteria 22408
149 Ga0157370_10090463 3300013104 Bacteria 2874
150 Ga0157370_10247981 3300013104 Bacteria 1647
151 Ga0157369_10062271 3300013105 Bacteria 4021
152 Ga0157369_10429771 3300013105 Bacteria 1369
153 Ga0157374_10371467 3300013296 Bacteria 1423
154 Ga0157378_10696943 3300013297 Bacteria 1035
155 Ga0163162_10088212 3300013306 Bacteria 3181
156 Ga0163162_10122947 3300013306 Bacteria 2700
157 Ga0163162_10430724 3300013306 Bacteria 1451
158 Ga0157372_10243780 3300013307 Bacteria 2085
159 Ga0157375_10113030 3300013308 Bacteria 2816
160 Ga0157375_10138830 3300013308 Bacteria 2556
161 Ga0163163_10028231 3300014325 Bacteria 5386
162 Ga0163163_10128620 3300014325 Bacteria 2572
163 Ga0163163_10462559 3300014325 Bacteria 1329
164 Ga0163163_12454332 3300014325 Bacteria 579
165 Ga0157380_10124861 3300014326 Bacteria 2186
166 Ga0157379_10106880 3300014968 Bacteria 2512
167 Ga0157379_10133329 3300014968 Bacteria 2237
168 Ga0157379_11804549 3300014968 Bacteria 601
169 Ga0157376_10025859 3300014969 Unclassified 4629
170 Ga0182007_10023609 3300015262 Bacteria 2161
171 Ga0209148_1026935 3300025254 Bacteria 888
172 Ga0209455_1038083 3300025272 Bacteria 752
173 Ga0207710_10158365 3300025900 Bacteria 1101
174 Ga0207688_10440379 3300025901 Bacteria 811
175 Ga0207680_10044228 3300025903 Bacteria 2617
176 Ga0207680_10076221 3300025903 Bacteria 2094
177 Ga0207645_10426406 3300025907 Bacteria 894
178 Ga0207705_10003462 3300025909 Bacteria 12004
179 Ga0207705_10058837 3300025909 Bacteria 2772
180 Ga0207705_10347921 3300025909 Bacteria 1141
181 Ga0207705_10464192 3300025909 Bacteria 982
182 Ga0207707_10100235 3300025912 Bacteria 2531
183 Ga0207707_10217655 3300025912 Unclassified 1663
184 Ga0207707_10230482 3300025912 Bacteria 1611
185 Ga0207695_10001168 3300025913 Bacteria 45314
186 Ga0207695_10002758 3300025913 Bacteria 25593
187 Ga0207695_10010089 3300025913 Bacteria 11599
188 Ga0207695_10211277 3300025913 Bacteria 1851
189 Ga0207660_10001115 3300025917 Bacteria 17946
190 Ga0207660_10666999 3300025917 Bacteria 848
191 Ga0207657_10000235 3300025919 Bacteria 58394
192 Ga0207657_10085098 3300025919 Bacteria 2649
193 Ga0207649_10266223 3300025920 Bacteria 1240
194 Ga0207652_10005742 3300025921 Bacteria 10071
195 Ga0207652_10540162 3300025921 Unclassified 1048
196 Ga0207646_10710202 3300025922 Unclassified 899
197 Ga0207681_10090832 3300025923 Bacteria 2180
198 Ga0207694_10233729 3300025924 Bacteria 1502
199 Ga0207650_10000033 3300025925 Bacteria 226809
200 Ga0207650_10505679 3300025925 Bacteria 1010
201 Ga0207659_10475024 3300025926 Bacteria 1056
202 Ga0207644_10012290 3300025931 Bacteria 5683
203 Ga0207644_10284147 3300025931 Bacteria 1329
204 Ga0207690_10000031 3300025932 Bacteria 154724
205 Ga0207690_10033538 3300025932 Bacteria 3301
206 Ga0207706_10013371 3300025933 Bacteria 7467
207 Ga0207711_10000368 3300025941 Bacteria 47898
208 Ga0207711_10031559 3300025941 Bacteria 4473
209 Ga0207711_10031569 3300025941 Bacteria 4473
210 Ga0207711_10055550 3300025941 Bacteria 3399
211 Ga0207689_10357492 3300025942 Bacteria 1214
212 Ga0207689_10451564 3300025942 Bacteria 1074
213 Ga0207667_10015583 3300025949 Bacteria 8625
214 Ga0207667_10018763 3300025949 Bacteria 7746
215 Ga0207667_10352611 3300025949 Bacteria 1500
216 Ga0207667_10656756 3300025949 Bacteria 1054
217 Ga0207651_10051202 3300025960 Bacteria 2808
218 Ga0207712_10016645 3300025961 Bacteria 4766
219 Ga0207712_10230971 3300025961 Bacteria 1485
220 Ga0207712_10330698 3300025961 Bacteria 1260
221 Ga0207668_10000004 3300025972 Bacteria 201204
222 Ga0207668_10000255 3300025972 Bacteria 35541
223 Ga0207668_10003169 3300025972 Bacteria 9632
224 Ga0207640_10233048 3300025981 Bacteria 1418
225 Ga0207658_10000607 3300025986 Bacteria 31806
226 Ga0207658_10017899 3300025986 Bacteria 4884
227 Ga0207658_10031877 3300025986 Bacteria 3747
228 Ga0207677_10530436 3300026023 Bacteria 1023
229 Ga0207703_10000027 3300026035 Bacteria 209608
230 Ga0207703_10132794 3300026035 Bacteria 2152
231 Ga0207703_10508567 3300026035 Bacteria 1131
232 Ga0207703_10845758 3300026035 Bacteria 875
233 Ga0207639_10018797 3300026041 Bacteria 4916
234 Ga0207639_10036909 3300026041 Bacteria 3626
235 Ga0207639_11044134 3300026041 Bacteria 766
236 Ga0207708_10290019 3300026075 Bacteria 1328
237 Ga0207702_10346762 3300026078 Bacteria 1420
238 Ga0207641_10000003 3300026088 Bacteria 496984
239 Ga0207641_10003861 3300026088 Bacteria 13121
240 Ga0207641_10016362 3300026088 Bacteria 6072
241 Ga0207641_10259179 3300026088 Bacteria 1627
242 Ga0207648_11377898 3300026089 Bacteria 663
243 Ga0207676_10000175 3300026095 Bacteria 56138
244 Ga0207676_10003810 3300026095 Bacteria 10658
245 Ga0207676_10125325 3300026095 Bacteria 2174
246 Ga0207676_10588330 3300026095 Bacteria 1068
247 Ga0207675_100056257 3300026118 Bacteria 3669
248 Ga0207683_10171761 3300026121 Bacteria 1963
249 Ga0209981_1000576 3300027378 Bacteria 4652
250 Ga0209999_1002255 3300027543 Bacteria 3387
251 Ga0209970_1052688 3300027614 Bacteria 738
252 Ga0209983_1007739 3300027665 Bacteria 2200
253 Ga0207428_10028124 3300027907 Bacteria 4674
254 Ga0268266_10000003 3300028379 Bacteria 1701703
255 Ga0268266_10000970 3300028379 Bacteria 36427
256 Ga0268266_10004426 3300028379 Bacteria 13452
257 Ga0268266_10241506 3300028379 Bacteria 1667
258 Ga0268266_10345618 3300028379 Unclassified 1397
259 Ga0268265_10001232 3300028380 Bacteria 22143
260 Ga0268265_10027978 3300028380 Bacteria 4032
261 Ga0268265_10110199 3300028380 Bacteria 2246
262 Ga0268264_10000032 3300028381 Bacteria 408337
263 Ga0268264_10000113 3300028381 Bacteria 203262
264 Ga0268264_10043196 3300028381 Bacteria 3735
265 Ga0268264_10872785 3300028381 Bacteria 902
266 Ga0268264_11606037 3300028381 Bacteria 661
267 Ga0265326_10060326 3300028558 Bacteria 1073
268 Ga0265319_1059280 3300028563 Bacteria 1245
269 Ga0265334_10052567 3300028573 Bacteria 1558
270 Ga0307517_10005788 3300028786 Bacteria 18484
271 Ga0307515_10621196 3300028794 Bacteria 692
272 Ga0265338_10008516 3300028800 Bacteria 12432
273 Ga0265338_10073046 3300028800 Bacteria 2925
274 Ga0307511_10042169 3300030521 Bacteria 3838
275 Ga0265320_10026730 3300031240 Unclassified 3017
276 Ga0265340_10196564 3300031247 Bacteria 908
277 Ga0265327_10006777 3300031251 Bacteria 9039
278 Ga0265327_10086784 3300031251 Bacteria 1534
279 Ga0265316_10044329 3300031344 Bacteria 3538
280 Ga0307513_10003286 3300031456 Bacteria 22017
281 Ga0307408_101326127 3300031548 Bacteria 675
282 Ga0265314_10007536 3300031711 Bacteria 9430
283 Ga0265314_10025272 3300031711 Bacteria 4485
284 Ga0307516_10001321 3300031730 Bacteria 34374
285 Ga0307413_10094720 3300031824 Bacteria 1955
286 Ga0307410_10771757 3300031852 Bacteria 815
287 Ga0307406_11091263 3300031901 Bacteria 689
288 Ga0307416_100771468 3300032002 Bacteria 1055
289 Ga0307415_101078764 3300032126 Bacteria 751
290 Ga0307510_10017145 3300033180 Bacteria 8544
291 Ga0373926_0009585 3300035083 Bacteria 3235
292 Ga0373936_0038657 3300035113 Bacteria 1908
293 Ga0373945_0027123 3300035116 Bacteria 2000
294 Ga0373946_0035802 3300035171 Bacteria 2010
295 Ga0373946_0075500 3300035171 Bacteria 1465
296 Ga0373931_0055827 3300035691 Bacteria 2115
297 Ga0373931_0095478 3300035691 Bacteria 1664
298 Ga0373935_0007263 3300035692 Bacteria 6621
299 Ga0373927_0000111 3300035695 Bacteria 62031
300 Ga0373927_0019235 3300035695 Bacteria 4479
301 Ga0373947_0141090 3300035725 Bacteria 1545
302 Ga0373937_0411847 3300036401 Bacteria 1283
303 Ga0373925_0000209 3300037068 Bacteria 64086
304 Ga0373925_0030238 3300037068 Bacteria 3975
305 Ga0373925_0338328 3300037068 Bacteria 1220
306 Ga0395899_0001215 3300037312 Bacteria 22577
307 Ga0395899_0051636 3300037312 Bacteria 3050
308 Ga0395899_0101470 3300037312 Bacteria 2077
309 Ga0395900_0000002 3300037418 Bacteria 671103
310 Ga0395900_0612325 3300037418 Bacteria 1028
311 Ga0395900_0634229 3300037418 Bacteria 1006
312 Ga0395898_0015320 3300037466 Bacteria 7864
313 Ga0395898_0224100 3300037466 Bacteria 1793
314 Ga0395905_0002451 3300037471 Bacteria 20546
315 Ga0395905_0344265 3300037471 Bacteria 1382
316 Ga0395901_0001134 3300038443 Bacteria 28242
317 Ga0395901_0006909 3300038443 Bacteria 11467
318 Ga0395901_0161308 3300038443 Bacteria 2355
319 Ga0395901_0931761 3300038443 Bacteria 848
320 Ga0436365_0925532 3300039437 Bacteria 4943
321 Ga0436361_0857448 3300039447 Bacteria 2592
322 Ga0451807_1592394 3300041486 Unclassified 2157
323 Ga0451843_0810845 3300041509 Bacteria 755
324 Ga0451853_1663901 3300041512 Bacteria 804
325 Ga0451853_2313284 3300041512 Bacteria 895
326 Ga0451577_0012500 3300042876 Bacteria 7970
327 Ga0451577_0165073 3300042876 Bacteria 1995
328 Ga0451577_0175807 3300042876 Bacteria 1930
329 Ga0453683_0191677 3300044673 Unclassified 1297
330 Ga0466965_0201456 3300044683 Bacteria 1056
331 Ga0453684_0000750 3300044712 Bacteria 113028
332 Ga0453684_0051264 3300044712 Bacteria 5414
333 Ga0453684_0258794 3300044712 Bacteria 1995
334 Ga0453684_0282550 3300044712 Bacteria 1892
335 Ga0453684_0466128 3300044712 Bacteria 1404
336 Ga0453684_0542639 3300044712 Bacteria 1282
337 Ga0466970_0331265 3300044765 Bacteria 862
338 Ga0466957_0211144 3300044842 Bacteria 1278
339 Ga0451576_0000042 3300045051 Bacteria 342102
340 Ga0451576_0099062 3300045051 Bacteria 3032
341 Ga0451576_0703189 3300045051 Bacteria 1062
342 Ga0451576_0856111 3300045051 Bacteria 954
343 Ga0495629_0718440 3300046459 Bacteria 663
344 Ga0495610_0046601 3300046512 Bacteria 2138
345 Ga0495620_0077486 3300046515 Bacteria 1349
346 Ga0495628_0113285 3300046516 Bacteria 2084
347 Ga0495643_0013249 3300046522 Bacteria 4942
348 Ga0495654_0021402 3300046530 Bacteria 3364
349 Ga0495609_0018958 3300046538 Bacteria 3186
350 Ga0495621_0024718 3300046539 Bacteria 2010
351 Ga0495597_0039422 3300046542 Bacteria 2115
352 Ga0495597_0242717 3300046542 Bacteria 710
353 Ga0495645_0077313 3300046543 Bacteria 2393
354 Ga0495622_0017085 3300046557 Bacteria 3378
355 Ga0495668_0034407 3300046616 Bacteria 2842
356 Ga0495668_0071076 3300046616 Bacteria 1913
357 Ga0495611_0025607 3300046648 Bacteria 2572
358 Ga0495625_0427900 3300046660 Bacteria 822
359 Ga0495625_0438452 3300046660 Bacteria 809
360 Ga0495588_0140623 3300046674 Bacteria 1275
361 Ga0495669_0000007 3300046684 Bacteria 180797
362 Ga0495669_0000731 3300046684 Bacteria 14261
363 Ga0495671_0271401 3300046692 Bacteria 818
364 Ga0495674_0202756 3300047319 Bacteria 1645
365 Ga0495672_0062534 3300047320 Bacteria 2141
366 Ga0495687_014048 3300047443 Bacteria 4143
367 Ga0495677_0107437 3300047445 Bacteria 1059
368 Ga0495686_0205444 3300047472 Bacteria 1128
369 Ga0495593_0040484 3300047673 Bacteria 2509
370 Ga0496101_0026252 3300048904 Bacteria 4049
371 Ga0496102_0026068 3300048905 Bacteria 5210
372 Ga0496102_0885622 3300048905 Bacteria 814
373 Ga0496103_0114109 3300048906 Bacteria 1718
374 Ga0496104_0552029 3300048907 Bacteria 1063
375 Ga0496106_0190006 3300048909 Bacteria 1633
376 Ga0496106_0421357 3300048909 Bacteria 1073
377 Ga0496107_0181655 3300048910 Bacteria 1562
378 Ga0496108_0261091 3300048911 Bacteria 1507
379 Ga0496109_0003588 3300048912 Bacteria 12956
380 Ga0496110_0266704 3300048913 Bacteria 1559
381 Ga0496112_0113265 3300048915 Bacteria 2683
382 Ga0496112_0218871 3300048915 Bacteria 1860
383 Ga0496113_0034462 3300048916 Bacteria 3694
384 Ga0496115_0000467 3300048918 Bacteria 32205
385 Ga0496115_0188100 3300048918 Bacteria 1706
386 Ga0501032_0662999 3300049569 Bacteria 662
387 Ga0501032_0740402 3300049569 Bacteria 622
388 Ga0501034_0802456 3300049571 Bacteria 834
389 Ga0501047_0006395 3300049581 Bacteria 11080
390 Ga0501047_0282629 3300049581 Bacteria 1504
391 Ga0501047_0447145 3300049581 Bacteria 1122
392 Ga0501048_0179019 3300049582 Bacteria 1503
393 Ga0501070_0479650 3300049586 Bacteria 1000
394 Ga0501075_0089096 3300049591 Bacteria 2340
395 Ga0501076_0527604 3300049592 Bacteria 973
396 Ga0501080_0432936 3300049742 Bacteria 1181
397 Ga0501080_0492687 3300049742 Bacteria 1096
398 Ga0501081_0919216 3300049743 Bacteria 660
399 Ga0501035_0506565 3300049822 Bacteria 993
400 Ga0501044_0047950 3300049823 Bacteria 4417
401 Ga0501044_0375793 3300049823 Bacteria 1337
402 Ga0501044_0439868 3300049823 Bacteria 1212
403 Ga0501044_0664202 3300049823 Bacteria 930
404 Ga0501045_0223394 3300049824 Bacteria 1402
405 nmdc:mga03683_300618_c1 3300050489 Bacteria 753
406 nmdc:mga03n38_301262_c1 3300050490 Bacteria 861
407 nmdc:mga0yw44_161715_c1 3300050492 Bacteria 1466
408 nmdc:mga0k408_254657_c1 3300050493 Bacteria 1048
409 nmdc:mga07m45_50773_c1 3300050496 Bacteria 2338
410 nmdc:mga05p37_429483_c1 3300050507 Bacteria 1535
411 nmdc:mga05p37_494016_c1 3300050507 Bacteria 1406
412 nmdc:mga09592_174653_c1 3300050508 Bacteria 1858
413 nmdc:mga0qj67_166882_c1 3300050509 Bacteria 1787
414 nmdc:mga0qj67_169679_c1 3300050509 Bacteria 1771
415 nmdc:mga06r32_30093_c1 3300050510 Bacteria 5094
416 nmdc:mga08y16_15907_c1 3300050511 Bacteria 7906
417 nmdc:mga08y16_190726_c1 3300050511 Bacteria 2126
418 nmdc:mga08y16_39383_c1 3300050511 Bacteria 4960
419 nmdc:mga08y16_643693_c1 3300050511 Bacteria 1065
420 nmdc:mga0n895_174980_c1 3300050512 Bacteria 2177
421 nmdc:mga0n895_97144_c1 3300050512 Bacteria 2951
422 nmdc:mga0rr50_116920_c1 3300050513 Bacteria 2117
423 nmdc:mga0rr50_145415_c1 3300050513 Bacteria 1911
424 nmdc:mga08x19_192580_c1 3300050514 Bacteria 1395
425 Ga0500635_0000399 3300053080 Bacteria 13188
426 Ga0500578_0077831 3300053086 Bacteria 2111
427 Ga0500643_008459 3300053087 Bacteria 4041
428 Ga0500643_054291 3300053087 Bacteria 1137
429 Ga0500647_0025032 3300053091 Bacteria 2811
430 Ga0500583_0009227 3300053092 Bacteria 3593
431 Ga0500651_0245643 3300053093 Bacteria 1042
432 Ga0500555_004577 3300053103 Bacteria 3929
433 Ga0500556_0021051 3300053104 Bacteria 2096
434 Ga0500562_001663 3300053108 Bacteria 5529
435 Ga0500569_017206 3300053109 Bacteria 1844
436 Ga0500595_005136 3300053119 Bacteria 5745
437 Ga0500595_029226 3300053119 Bacteria 1872
438 Ga0500595_070239 3300053119 Bacteria 1040
439 Ga0500607_130688 3300053121 Bacteria 1198
440 Ga0500608_000782 3300053122 Bacteria 11599
441 Ga0500614_015211 3300053123 Bacteria 1714
442 Ga0500642_0061467 3300053130 Bacteria 1688
443 Ga0500642_0272882 3300053130 Bacteria 771
444 Ga0500655_012872 3300053133 Bacteria 1523
445 Ga0500559_0020343 3300053136 Bacteria 2806
446 Ga0500559_0189619 3300053136 Bacteria 969
447 Ga0500564_036332 3300053138 Bacteria 2273
448 Ga0500577_0156007 3300053142 Bacteria 970
449 Ga0500590_004049 3300053148 Bacteria 6863
450 Ga0500619_017220 3300053154 Bacteria 2006
451 Ga0500638_100102 3300053162 Bacteria 1353
452 Ga0500639_177119 3300053163 Bacteria 948
453 Ga0500636_0016608 3300053177 Bacteria 4341
454 Ga0500637_0012246 3300053178 Bacteria 4463
455 Ga0500637_0070586 3300053178 Bacteria 2008
456 Ga0500576_126572 3300053725 Bacteria 997
457 Ga0500657_134233 3300053728 Bacteria 953
458 Ga0500645_004269 3300053730 Bacteria 5536
459 Ga0500596_002247 3300053735 Bacteria 3832
460 Ga0500601_002717 3300053737 Bacteria 1905
461 Ga0501084_0194280 3300054114 Bacteria 1712

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005328 Ga0070676_10450575 Ga0070676_104505752 148
2 3300005334 Ga0068869_100580116 Ga0068869_1005801161 148
3 3300005354 Ga0070675_100547460 Ga0070675_1005474601 148
4 3300005844 Ga0068862_101253089 Ga0068862_1012530892 148
5 3300025907 Ga0207645_10426406 Ga0207645_104264062 148
6 3300025926 Ga0207659_10475024 Ga0207659_104750242 148
7 3300025942 Ga0207689_10451564 Ga0207689_104515642 148
8 3300026095 Ga0207676_10588330 Ga0207676_105883302 148
9 3300028380 Ga0268265_10110199 Ga0268265_101101994 148
10 3300025942 Ga0207689_10357492 Ga0207689_103574922 155
11 3300014969 Ga0157376_10025859 Ga0157376_100258595 158
12 3300041509 Ga0451843_0810845 Ga0451843_0810845_25_588 159
13 iso_pu_bacteria 2648501241 2649121815 164
14 iso_pu_bacteria 2651869818 2652976294 164
15 3300005347 Ga0070668_100171831 Ga0070668_1001718312 165
16 3300005355 Ga0070671_100111226 Ga0070671_1001112261 165
17 3300005471 Ga0070698_100646242 Ga0070698_1006462422 165
18 3300005518 Ga0070699_100064607 Ga0070699_1000646072 165
19 3300005548 Ga0070665_100284873 Ga0070665_1002848732 165
20 3300005549 Ga0070704_100084290 Ga0070704_1000842902 165
21 3300006173 Ga0070716_100158131 Ga0070716_1001581312 165
22 3300006844 Ga0075428_100286394 Ga0075428_1002863942 165
23 3300006871 Ga0075434_100149941 Ga0075434_1001499412 165
24 3300009094 Ga0111539_10028683 Ga0111539_100286838 165
25 3300009147 Ga0114129_10454998 Ga0114129_104549982 165
26 3300009553 Ga0105249_10176482 Ga0105249_101764823 165
27 3300013297 Ga0157378_10696943 Ga0157378_106969432 165
28 3300013306 Ga0163162_10430724 Ga0163162_104307242 165
29 3300013308 Ga0157375_10138830 Ga0157375_101388303 165
30 3300027907 Ga0207428_10028124 Ga0207428_100281243 165
31 3300028379 Ga0268266_10345618 Ga0268266_103456182 165
32 3300028381 Ga0268264_10872785 Ga0268264_108727852 165
33 3300035691 Ga0373931_0095478 Ga0373931_0095478_808_1359 165
34 3300048905 Ga0496102_0885622 Ga0496102_0885622_48_599 165
35 3300050507 nmdc:mga05p37_494016_c1 nmdc:mga05p37_494016_c1_580_1149 165
36 3300050511 nmdc:mga08y16_15907_c1 nmdc:mga08y16_15907_c1_1450_2034 165
37 3300050511 nmdc:mga08y16_190726_c1 nmdc:mga08y16_190726_c1_748_1317 165
38 3300050512 nmdc:mga0n895_97144_c1 nmdc:mga0n895_97144_c1_2113_2697 165
39 3300050513 nmdc:mga0rr50_145415_c1 nmdc:mga0rr50_145415_c1_673_1257 165
40 3300005445 Ga0070708_101309200 Ga0070708_1013092001 166
41 3300005456 Ga0070678_100383096 Ga0070678_1003830962 166
42 3300005518 Ga0070699_100001747 Ga0070699_10000174714 166
43 3300026075 Ga0207708_10290019 Ga0207708_102900192 166
44 3300044673 Ga0453683_0191677 Ga0453683_0191677_151_738 166
45 3300044712 Ga0453684_0466128 Ga0453684_0466128_120_707 166
46 3300044712 Ga0453684_0542639 Ga0453684_0542639_468_1055 166
47 3300050514 nmdc:mga08x19_192580_c1 nmdc:mga08x19_192580_c1_436_1023 166
48 3300053087 Ga0500643_008459 Ga0500643_008459_261_770 166
49 3300005458 Ga0070681_10046273 Ga0070681_100462733 167
50 3300005467 Ga0070706_100666402 Ga0070706_1006664022 167
51 3300005471 Ga0070698_100075541 Ga0070698_1000755412 167
52 3300005530 Ga0070679_100198726 Ga0070679_1001987263 167
53 3300005844 Ga0068862_100623372 Ga0068862_1006233722 167
54 3300006844 Ga0075428_100041958 Ga0075428_1000419586 167
55 3300006846 Ga0075430_100196276 Ga0075430_1001962761 167
56 3300006847 Ga0075431_100108561 Ga0075431_1001085613 167
57 3300009147 Ga0114129_11239274 Ga0114129_112392742 167
58 3300013104 Ga0157370_10002443 Ga0157370_1000244317 167
59 3300025912 Ga0207707_10217655 Ga0207707_102176552 167
60 3300025921 Ga0207652_10540162 Ga0207652_105401622 167
61 3300025922 Ga0207646_10710202 Ga0207646_107102021 167
62 3300028558 Ga0265326_10060326 Ga0265326_100603262 167
63 3300028563 Ga0265319_1059280 Ga0265319_10592802 167
64 3300031240 Ga0265320_10026730 Ga0265320_100267303 167
65 3300031344 Ga0265316_10044329 Ga0265316_100443294 167
66 3300031711 Ga0265314_10007536 Ga0265314_100075368 167
67 3300035083 Ga0373926_0009585 Ga0373926_0009585_393_968 167
68 3300035116 Ga0373945_0027123 Ga0373945_0027123_1025_1600 167
69 3300035171 Ga0373946_0035802 Ga0373946_0035802_1063_1638 167
70 3300035692 Ga0373935_0007263 Ga0373935_0007263_5139_5714 167
71 3300035695 Ga0373927_0019235 Ga0373927_0019235_674_1249 167
72 3300035725 Ga0373947_0141090 Ga0373947_0141090_880_1455 167
73 3300036401 Ga0373937_0411847 Ga0373937_0411847_295_798 167
74 3300037068 Ga0373925_0030238 Ga0373925_0030238_450_1025 167
75 3300041486 Ga0451807_1592394 Ga0451807_1592394_407_1000 167
76 3300042876 Ga0451577_0012500 Ga0451577_0012500_4007_4603 167
77 3300042876 Ga0451577_0175807 Ga0451577_0175807_1167_1748 167
78 3300044712 Ga0453684_0000750 Ga0453684_0000750_75066_75647 167
79 3300044712 Ga0453684_0258794 Ga0453684_0258794_973_1563 167
80 3300045051 Ga0451576_0000042 Ga0451576_0000042_128097_128678 167
81 3300045051 Ga0451576_0703189 Ga0451576_0703189_247_828 167
82 3300045051 Ga0451576_0856111 Ga0451576_0856111_160_750 167
83 3300048918 Ga0496115_0188100 Ga0496115_0188100_257_775 167
84 3300049586 Ga0501070_0479650 Ga0501070_0479650_67_657 167
85 3300049591 Ga0501075_0089096 Ga0501075_0089096_1447_2037 167
86 3300049592 Ga0501076_0527604 Ga0501076_0527604_227_817 167
87 3300049742 Ga0501080_0492687 Ga0501080_0492687_446_1036 167
88 3300049743 Ga0501081_0919216 Ga0501081_0919216_22_612 167
89 3300049824 Ga0501045_0223394 Ga0501045_0223394_710_1300 167
90 3300050508 nmdc:mga09592_174653_c1 nmdc:mga09592_174653_c1_177_767 167
91 3300050509 nmdc:mga0qj67_166882_c1 nmdc:mga0qj67_166882_c1_891_1481 167
92 3300050509 nmdc:mga0qj67_169679_c1 nmdc:mga0qj67_169679_c1_114_704 167
93 3300050510 nmdc:mga06r32_30093_c1 nmdc:mga06r32_30093_c1_1151_1741 167
94 3300054114 Ga0501084_0194280 Ga0501084_0194280_69_659 167
95 iso_pu_bacteria 2643221598 2643999598 167
96 3300005543 Ga0070672_100019179 Ga0070672_1000191793 168
97 3300005544 Ga0070686_100585249 Ga0070686_1005852492 168
98 3300005547 Ga0070693_100154450 Ga0070693_1001544502 168
99 3300006173 Ga0070716_100114333 Ga0070716_1001143332 168
100 3300006852 Ga0075433_10222405 Ga0075433_102224052 168
101 3300006871 Ga0075434_100026875 Ga0075434_1000268754 168
102 3300006880 Ga0075429_100916117 Ga0075429_1009161172 168
103 3300006914 Ga0075436_100045709 Ga0075436_1000457092 168
104 3300006931 Ga0097620_100245348 Ga0097620_1002453482 168
105 3300007076 Ga0075435_100155340 Ga0075435_1001553402 168
106 3300009094 Ga0111539_10104901 Ga0111539_101049012 168
107 3300009094 Ga0111539_10747052 Ga0111539_107470522 168
108 3300009147 Ga0114129_10528931 Ga0114129_105289312 168
109 3300041512 Ga0451853_2313284 Ga0451853_2313284_187_783 168
110 3300042876 Ga0451577_0165073 Ga0451577_0165073_1022_1618 168
111 3300044712 Ga0453684_0051264 Ga0453684_0051264_3713_4309 168
112 3300044712 Ga0453684_0282550 Ga0453684_0282550_245_856 168
113 3300045051 Ga0451576_0099062 Ga0451576_0099062_420_1016 168
114 3300050507 nmdc:mga05p37_429483_c1 nmdc:mga05p37_429483_c1_157_750 168
115 3300050511 nmdc:mga08y16_39383_c1 nmdc:mga08y16_39383_c1_297_899 168
116 3300050511 nmdc:mga08y16_643693_c1 nmdc:mga08y16_643693_c1_311_913 168
117 3300050512 nmdc:mga0n895_174980_c1 nmdc:mga0n895_174980_c1_521_1132 168
118 3300050513 nmdc:mga0rr50_116920_c1 nmdc:mga0rr50_116920_c1_1344_1955 168
119 3300005331 Ga0070670_100000004 Ga0070670_10000000459 169
120 3300005335 Ga0070666_10064468 Ga0070666_100644682 169
121 3300005347 Ga0070668_100001026 Ga0070668_10000102611 169
122 3300005347 Ga0070668_100002884 Ga0070668_10000288410 169
123 3300005367 Ga0070667_100000105 Ga0070667_10000010580 169
124 3300005367 Ga0070667_100010822 Ga0070667_1000108227 169
125 3300005548 Ga0070665_100000667 Ga0070665_10000066728 169
126 3300005548 Ga0070665_100000784 Ga0070665_10000078441 169
127 3300005617 Ga0068859_100198131 Ga0068859_1001981312 169
128 3300005618 Ga0068864_100000164 Ga0068864_10000016421 169
129 3300005719 Ga0068861_100538283 Ga0068861_1005382831 169
130 3300005841 Ga0068863_100032357 Ga0068863_1000323575 169
131 3300005843 Ga0068860_100000077 Ga0068860_10000007759 169
132 3300005844 Ga0068862_100000363 Ga0068862_10000036363 169
133 3300006931 Ga0097620_100198116 Ga0097620_1001981162 169
134 3300009092 Ga0105250_10222910 Ga0105250_102229101 169
135 3300009101 Ga0105247_10048989 Ga0105247_100489892 169
136 3300009177 Ga0105248_10048693 Ga0105248_100486932 169
137 3300009177 Ga0105248_10083714 Ga0105248_100837143 169
138 3300009553 Ga0105249_10003268 Ga0105249_1000326816 169
139 3300009553 Ga0105249_10517308 Ga0105249_105173082 169
140 3300014325 Ga0163163_10462559 Ga0163163_104625592 169
141 3300014968 Ga0157379_10133329 Ga0157379_101333292 169
142 3300025900 Ga0207710_10158365 Ga0207710_101583652 169
143 3300025903 Ga0207680_10044228 Ga0207680_100442283 169
144 3300025925 Ga0207650_10000033 Ga0207650_10000033153 169
145 3300025941 Ga0207711_10031559 Ga0207711_100315594 169
146 3300025941 Ga0207711_10031569 Ga0207711_100315692 169
147 3300025961 Ga0207712_10016645 Ga0207712_100166454 169
148 3300025961 Ga0207712_10330698 Ga0207712_103306982 169
149 3300025972 Ga0207668_10000004 Ga0207668_10000004173 169
150 3300025972 Ga0207668_10000255 Ga0207668_1000025520 169
151 3300025986 Ga0207658_10000607 Ga0207658_100006071 169
152 3300025986 Ga0207658_10031877 Ga0207658_100318773 169
153 3300026088 Ga0207641_10003861 Ga0207641_100038617 169
154 3300026095 Ga0207676_10000175 Ga0207676_1000017553 169
155 3300026118 Ga0207675_100056257 Ga0207675_1000562572 169
156 3300028379 Ga0268266_10000970 Ga0268266_1000097036 169
157 3300028379 Ga0268266_10004426 Ga0268266_1000442615 169
158 3300028380 Ga0268265_10001232 Ga0268265_1000123225 169
159 3300028381 Ga0268264_10000032 Ga0268264_10000032357 169
160 3300028381 Ga0268264_11606037 Ga0268264_116060371 169
161 3300028800 Ga0265338_10008516 Ga0265338_100085165 169
162 3300037068 Ga0373925_0338328 Ga0373925_0338328_285_794 169
163 3300048905 Ga0496102_0026068 Ga0496102_0026068_3335_3847 169
164 3300049571 Ga0501034_0802456 Ga0501034_0802456_253_771 169
165 3300049823 Ga0501044_0375793 Ga0501044_0375793_786_1304 169
166 3300053087 Ga0500643_054291 Ga0500643_054291_529_1041 169
167 3300005335 Ga0070666_10211508 Ga0070666_102115082 170
168 3300005353 Ga0070669_100016959 Ga0070669_1000169593 170
169 3300005355 Ga0070671_100203751 Ga0070671_1002037512 170
170 3300005367 Ga0070667_100033350 Ga0070667_1000333505 170
171 3300005617 Ga0068859_100030995 Ga0068859_1000309955 170
172 3300005618 Ga0068864_100000058 Ga0068864_10000005878 170
173 3300005841 Ga0068863_100000290 Ga0068863_10000029040 170
174 3300005842 Ga0068858_100000006 Ga0068858_100000006215 170
175 3300005842 Ga0068858_100137523 Ga0068858_1001375233 170
176 3300005843 Ga0068860_100003889 Ga0068860_1000038896 170
177 3300005844 Ga0068862_100007824 Ga0068862_1000078246 170
178 3300006931 Ga0097620_100030996 Ga0097620_1000309963 170
179 3300009011 Ga0105251_10067762 Ga0105251_100677621 170
180 3300009174 Ga0105241_10313878 Ga0105241_103138782 170
181 3300009177 Ga0105248_10059769 Ga0105248_100597692 170
182 3300009553 Ga0105249_10793679 Ga0105249_107936792 170
183 3300010375 Ga0105239_10235322 Ga0105239_102353223 170
184 3300014326 Ga0157380_10124861 Ga0157380_101248612 170
185 3300014968 Ga0157379_10106880 Ga0157379_101068803 170
186 3300015262 Ga0182007_10023609 Ga0182007_100236092 170
187 3300025923 Ga0207681_10090832 Ga0207681_100908323 170
188 3300025931 Ga0207644_10284147 Ga0207644_102841472 170
189 3300025941 Ga0207711_10055550 Ga0207711_100555502 170
190 3300025972 Ga0207668_10003169 Ga0207668_100031697 170
191 3300025986 Ga0207658_10017899 Ga0207658_100178993 170
192 3300026035 Ga0207703_10000027 Ga0207703_10000027140 170
193 3300026035 Ga0207703_10132794 Ga0207703_101327943 170
194 3300026088 Ga0207641_10000003 Ga0207641_10000003234 170
195 3300026095 Ga0207676_10003810 Ga0207676_100038103 170
196 3300028380 Ga0268265_10027978 Ga0268265_100279783 170
197 3300028381 Ga0268264_10000113 Ga0268264_10000113145 170
198 3300028381 Ga0268264_10043196 Ga0268264_100431963 170
199 3300028786 Ga0307517_10005788 Ga0307517_1000578818 170
200 3300031548 Ga0307408_101326127 Ga0307408_1013261271 170
201 3300031730 Ga0307516_10001321 Ga0307516_1000132136 170
202 3300031824 Ga0307413_10094720 Ga0307413_100947203 170
203 3300035691 Ga0373931_0055827 Ga0373931_0055827_1576_2091 170
204 3300039437 Ga0436365_0925532 Ga0436365_0925532_1774_2298 170
205 3300041512 Ga0451853_1663901 Ga0451853_1663901_144_656 170
206 3300046512 Ga0495610_0046601 Ga0495610_0046601_1429_1953 170
207 3300046515 Ga0495620_0077486 Ga0495620_0077486_300_824 170
208 3300046522 Ga0495643_0013249 Ga0495643_0013249_1817_2341 170
209 3300046530 Ga0495654_0021402 Ga0495654_0021402_1719_2243 170
210 3300046538 Ga0495609_0018958 Ga0495609_0018958_1103_1627 170
211 3300046542 Ga0495597_0039422 Ga0495597_0039422_566_1090 170
212 3300046557 Ga0495622_0017085 Ga0495622_0017085_1515_2039 170
213 3300046616 Ga0495668_0034407 Ga0495668_0034407_1467_1991 170
214 3300047443 Ga0495687_014048 Ga0495687_014048_1234_1758 170
215 3300047472 Ga0495686_0205444 Ga0495686_0205444_459_983 170
216 3300047673 Ga0495593_0040484 Ga0495593_0040484_850_1374 170
217 3300048909 Ga0496106_0190006 Ga0496106_0190006_167_691 170
218 3300049581 Ga0501047_0282629 Ga0501047_0282629_557_1075 170
219 3300049823 Ga0501044_0439868 Ga0501044_0439868_564_1079 170
220 3300049823 Ga0501044_0664202 Ga0501044_0664202_323_841 170
221 3300053080 Ga0500635_0000399 Ga0500635_0000399_2905_3429 170
222 3300053086 Ga0500578_0077831 Ga0500578_0077831_250_774 170
223 3300053091 Ga0500647_0025032 Ga0500647_0025032_1985_2509 170
224 3300053092 Ga0500583_0009227 Ga0500583_0009227_2651_3175 170
225 3300053093 Ga0500651_0245643 Ga0500651_0245643_217_741 170
226 3300053103 Ga0500555_004577 Ga0500555_004577_1720_2244 170
227 3300053104 Ga0500556_0021051 Ga0500556_0021051_1222_1746 170
228 3300053109 Ga0500569_017206 Ga0500569_017206_1155_1679 170
229 3300053119 Ga0500595_005136 Ga0500595_005136_3932_4456 170
230 3300053121 Ga0500607_130688 Ga0500607_130688_247_771 170
231 3300053122 Ga0500608_000782 Ga0500608_000782_9770_10294 170
232 3300053123 Ga0500614_015211 Ga0500614_015211_397_921 170
233 3300053130 Ga0500642_0061467 Ga0500642_0061467_657_1181 170
234 3300053130 Ga0500642_0272882 Ga0500642_0272882_31_555 170
235 3300053133 Ga0500655_012872 Ga0500655_012872_606_1130 170
236 3300053136 Ga0500559_0020343 Ga0500559_0020343_1301_1825 170
237 3300053138 Ga0500564_036332 Ga0500564_036332_661_1185 170
238 3300053142 Ga0500577_0156007 Ga0500577_0156007_70_594 170
239 3300053148 Ga0500590_004049 Ga0500590_004049_1442_1966 170
240 3300053154 Ga0500619_017220 Ga0500619_017220_1212_1736 170
241 3300053162 Ga0500638_100102 Ga0500638_100102_223_747 170
242 3300053163 Ga0500639_177119 Ga0500639_177119_243_767 170
243 3300053177 Ga0500636_0016608 Ga0500636_0016608_773_1297 170
244 3300053178 Ga0500637_0012246 Ga0500637_0012246_2675_3199 170
245 3300053178 Ga0500637_0070586 Ga0500637_0070586_39_563 170
246 3300053725 Ga0500576_126572 Ga0500576_126572_412_936 170
247 3300053728 Ga0500657_134233 Ga0500657_134233_185_709 170
248 3300053735 Ga0500596_002247 Ga0500596_002247_1319_1843 170
249 3300053737 Ga0500601_002717 Ga0500601_002717_751_1275 170
250 3300005327 Ga0070658_10009406 Ga0070658_100094066 171
251 3300005327 Ga0070658_10137760 Ga0070658_101377602 171
252 3300005327 Ga0070658_10155492 Ga0070658_101554923 171
253 3300005329 Ga0070683_100313037 Ga0070683_1003130372 171
254 3300005331 Ga0070670_100711119 Ga0070670_1007111192 171
255 3300005335 Ga0070666_11103589 Ga0070666_111035891 171
256 3300005336 Ga0070680_100011984 Ga0070680_1000119842 171
257 3300005336 Ga0070680_100150959 Ga0070680_1001509592 171
258 3300005339 Ga0070660_100039719 Ga0070660_1000397193 171
259 3300005339 Ga0070660_100070594 Ga0070660_1000705943 171
260 3300005339 Ga0070660_100141488 Ga0070660_1001414882 171
261 3300005344 Ga0070661_100459760 Ga0070661_1004597601 171
262 3300005355 Ga0070671_100057924 Ga0070671_1000579244 171
263 3300005364 Ga0070673_100086573 Ga0070673_1000865733 171
264 3300005366 Ga0070659_100001009 Ga0070659_10000100910 171
265 3300005366 Ga0070659_100028943 Ga0070659_1000289432 171
266 3300005456 Ga0070678_100225760 Ga0070678_1002257601 171
267 3300005457 Ga0070662_100015459 Ga0070662_1000154591 171
268 3300005458 Ga0070681_10008308 Ga0070681_100083086 171
269 3300005458 Ga0070681_10511124 Ga0070681_105111242 171
270 3300005458 Ga0070681_10933015 Ga0070681_109330152 171
271 3300005459 Ga0068867_101417560 Ga0068867_1014175601 171
272 3300005530 Ga0070679_100015873 Ga0070679_1000158738 171
273 3300005530 Ga0070679_100573683 Ga0070679_1005736832 171
274 3300005530 Ga0070679_100575611 Ga0070679_1005756112 171
275 3300005539 Ga0068853_100090492 Ga0068853_1000904923 171
276 3300005539 Ga0068853_100135039 Ga0068853_1001350392 171
277 3300005539 Ga0068853_100438727 Ga0068853_1004387272 171
278 3300005543 Ga0070672_101411893 Ga0070672_1014118931 171
279 3300005548 Ga0070665_100000721 Ga0070665_10000072136 171
280 3300005548 Ga0070665_100009966 Ga0070665_1000099662 171
281 3300005563 Ga0068855_100017453 Ga0068855_1000174538 171
282 3300005563 Ga0068855_100092076 Ga0068855_1000920764 171
283 3300005563 Ga0068855_100688627 Ga0068855_1006886272 171
284 3300005578 Ga0068854_100208898 Ga0068854_1002088982 171
285 3300005614 Ga0068856_100461822 Ga0068856_1004618222 171
286 3300005616 Ga0068852_100621735 Ga0068852_1006217352 171
287 3300005618 Ga0068864_100011174 Ga0068864_1000111746 171
288 3300005618 Ga0068864_100074313 Ga0068864_1000743132 171
289 3300005842 Ga0068858_101038031 Ga0068858_1010380312 171
290 3300006048 Ga0075363_100004495 Ga0075363_1000044952 171
291 3300006177 Ga0075362_10026450 Ga0075362_100264502 171
292 3300006195 Ga0075366_10075340 Ga0075366_100753403 171
293 3300006195 Ga0075366_10109048 Ga0075366_101090482 171
294 3300006237 Ga0097621_100289025 Ga0097621_1002890252 171
295 3300006353 Ga0075370_10156562 Ga0075370_101565622 171
296 3300006353 Ga0075370_10449741 Ga0075370_104497412 171
297 3300006358 Ga0068871_100133185 Ga0068871_1001331852 171
298 3300009093 Ga0105240_10003768 Ga0105240_1000376827 171
299 3300009093 Ga0105240_10010647 Ga0105240_100106479 171
300 3300009093 Ga0105240_10098344 Ga0105240_100983442 171
301 3300009093 Ga0105240_10194131 Ga0105240_101941312 171
302 3300009093 Ga0105240_10610867 Ga0105240_106108672 171
303 3300009148 Ga0105243_11054343 Ga0105243_110543431 171
304 3300009148 Ga0105243_11601518 Ga0105243_116015181 171
305 3300009174 Ga0105241_10508569 Ga0105241_105085692 171
306 3300009177 Ga0105248_10000650 Ga0105248_1000065031 171
307 3300009177 Ga0105248_10294698 Ga0105248_102946981 171
308 3300009551 Ga0105238_10097386 Ga0105238_100973863 171
309 3300009551 Ga0105238_10284412 Ga0105238_102844122 171
310 3300009551 Ga0105238_10558754 Ga0105238_105587542 171
311 3300009551 Ga0105238_10637899 Ga0105238_106378992 171
312 3300009553 Ga0105249_10427278 Ga0105249_104272782 171
313 3300009553 Ga0105249_11939603 Ga0105249_119396031 171
314 3300010375 Ga0105239_10351020 Ga0105239_103510203 171
315 3300010375 Ga0105239_10863297 Ga0105239_108632972 171
316 3300011119 Ga0105246_10244328 Ga0105246_102443282 171
317 3300013100 Ga0157373_10234927 Ga0157373_102349272 171
318 3300013104 Ga0157370_10090463 Ga0157370_100904632 171
319 3300013104 Ga0157370_10247981 Ga0157370_102479812 171
320 3300013105 Ga0157369_10062271 Ga0157369_100622712 171
321 3300013105 Ga0157369_10429771 Ga0157369_104297712 171
322 3300013296 Ga0157374_10371467 Ga0157374_103714672 171
323 3300013306 Ga0163162_10088212 Ga0163162_100882122 171
324 3300013306 Ga0163162_10122947 Ga0163162_101229473 171
325 3300013307 Ga0157372_10243780 Ga0157372_102437803 171
326 3300013308 Ga0157375_10113030 Ga0157375_101130304 171
327 3300014325 Ga0163163_10028231 Ga0163163_100282312 171
328 3300014325 Ga0163163_10128620 Ga0163163_101286202 171
329 3300014325 Ga0163163_12454332 Ga0163163_124543321 171
330 3300014968 Ga0157379_11804549 Ga0157379_118045491 171
331 3300025254 Ga0209148_1026935 Ga0209148_10269351 171
332 3300025272 Ga0209455_1038083 Ga0209455_10380831 171
333 3300025901 Ga0207688_10440379 Ga0207688_104403792 171
334 3300025903 Ga0207680_10076221 Ga0207680_100762211 171
335 3300025909 Ga0207705_10003462 Ga0207705_100034626 171
336 3300025909 Ga0207705_10058837 Ga0207705_100588372 171
337 3300025909 Ga0207705_10347921 Ga0207705_103479212 171
338 3300025909 Ga0207705_10464192 Ga0207705_104641922 171
339 3300025912 Ga0207707_10100235 Ga0207707_101002352 171
340 3300025912 Ga0207707_10230482 Ga0207707_102304822 171
341 3300025913 Ga0207695_10001168 Ga0207695_1000116827 171
342 3300025913 Ga0207695_10002758 Ga0207695_100027588 171
343 3300025913 Ga0207695_10010089 Ga0207695_100100896 171
344 3300025913 Ga0207695_10211277 Ga0207695_102112772 171
345 3300025917 Ga0207660_10001115 Ga0207660_100011152 171
346 3300025917 Ga0207660_10666999 Ga0207660_106669992 171
347 3300025919 Ga0207657_10000235 Ga0207657_1000023559 171
348 3300025919 Ga0207657_10085098 Ga0207657_100850982 171
349 3300025920 Ga0207649_10266223 Ga0207649_102662232 171
350 3300025921 Ga0207652_10005742 Ga0207652_100057426 171
351 3300025924 Ga0207694_10233729 Ga0207694_102337292 171
352 3300025925 Ga0207650_10505679 Ga0207650_105056792 171
353 3300025931 Ga0207644_10012290 Ga0207644_100122902 171
354 3300025932 Ga0207690_10000031 Ga0207690_10000031122 171
355 3300025932 Ga0207690_10033538 Ga0207690_100335382 171
356 3300025933 Ga0207706_10013371 Ga0207706_100133717 171
357 3300025941 Ga0207711_10000368 Ga0207711_1000036849 171
358 3300025949 Ga0207667_10015583 Ga0207667_100155835 171
359 3300025949 Ga0207667_10018763 Ga0207667_100187638 171
360 3300025949 Ga0207667_10352611 Ga0207667_103526112 171
361 3300025949 Ga0207667_10656756 Ga0207667_106567562 171
362 3300025960 Ga0207651_10051202 Ga0207651_100512023 171
363 3300025961 Ga0207712_10230971 Ga0207712_102309712 171
364 3300025981 Ga0207640_10233048 Ga0207640_102330482 171
365 3300026023 Ga0207677_10530436 Ga0207677_105304362 171
366 3300026035 Ga0207703_10508567 Ga0207703_105085672 171
367 3300026035 Ga0207703_10845758 Ga0207703_108457582 171
368 3300026041 Ga0207639_10018797 Ga0207639_100187976 171
369 3300026041 Ga0207639_10036909 Ga0207639_100369093 171
370 3300026041 Ga0207639_11044134 Ga0207639_110441341 171
371 3300026078 Ga0207702_10346762 Ga0207702_103467622 171
372 3300026088 Ga0207641_10016362 Ga0207641_100163623 171
373 3300026088 Ga0207641_10259179 Ga0207641_102591791 171
374 3300026089 Ga0207648_11377898 Ga0207648_113778981 171
375 3300026095 Ga0207676_10125325 Ga0207676_101253252 171
376 3300026121 Ga0207683_10171761 Ga0207683_101717612 171
377 3300027378 Ga0209981_1000576 Ga0209981_10005764 171
378 3300027543 Ga0209999_1002255 Ga0209999_10022553 171
379 3300027614 Ga0209970_1052688 Ga0209970_10526881 171
380 3300027665 Ga0209983_1007739 Ga0209983_10077392 171
381 3300028379 Ga0268266_10000003 Ga0268266_100000031416 171
382 3300028379 Ga0268266_10241506 Ga0268266_102415062 171
383 3300028573 Ga0265334_10052567 Ga0265334_100525672 171
384 3300028794 Ga0307515_10621196 Ga0307515_106211961 171
385 3300028800 Ga0265338_10073046 Ga0265338_100730463 171
386 3300030521 Ga0307511_10042169 Ga0307511_100421693 171
387 3300031247 Ga0265340_10196564 Ga0265340_101965642 171
388 3300031251 Ga0265327_10006777 Ga0265327_100067776 171
389 3300031251 Ga0265327_10086784 Ga0265327_100867843 171
390 3300031456 Ga0307513_10003286 Ga0307513_1000328615 171
391 3300031711 Ga0265314_10025272 Ga0265314_100252724 171
392 3300031852 Ga0307410_10771757 Ga0307410_107717572 171
393 3300031901 Ga0307406_11091263 Ga0307406_110912631 171
394 3300032002 Ga0307416_100771468 Ga0307416_1007714682 171
395 3300032126 Ga0307415_101078764 Ga0307415_1010787642 171
396 3300033180 Ga0307510_10017145 Ga0307510_100171458 171
397 3300035113 Ga0373936_0038657 Ga0373936_0038657_383_898 171
398 3300035171 Ga0373946_0075500 Ga0373946_0075500_210_725 171
399 3300035695 Ga0373927_0000111 Ga0373927_0000111_40472_40987 171
400 3300037068 Ga0373925_0000209 Ga0373925_0000209_23113_23628 171
401 3300037312 Ga0395899_0001215 Ga0395899_0001215_13447_13962 171
402 3300037312 Ga0395899_0051636 Ga0395899_0051636_1073_1600 171
403 3300037312 Ga0395899_0101470 Ga0395899_0101470_884_1420 171
404 3300037418 Ga0395900_0000002 Ga0395900_0000002_305652_306167 171
405 3300037418 Ga0395900_0612325 Ga0395900_0612325_407_934 171
406 3300037418 Ga0395900_0634229 Ga0395900_0634229_269_799 171
407 3300037466 Ga0395898_0015320 Ga0395898_0015320_2551_3066 171
408 3300037466 Ga0395898_0224100 Ga0395898_0224100_806_1333 171
409 3300037471 Ga0395905_0002451 Ga0395905_0002451_6585_7100 171
410 3300037471 Ga0395905_0344265 Ga0395905_0344265_663_1178 171
411 3300038443 Ga0395901_0001134 Ga0395901_0001134_5716_6231 171
412 3300038443 Ga0395901_0006909 Ga0395901_0006909_10569_11099 171
413 3300038443 Ga0395901_0161308 Ga0395901_0161308_199_729 171
414 3300038443 Ga0395901_0931761 Ga0395901_0931761_280_807 171
415 3300039447 Ga0436361_0857448 Ga0436361_0857448_287_817 171
416 3300044683 Ga0466965_0201456 Ga0466965_0201456_395_922 171
417 3300044765 Ga0466970_0331265 Ga0466970_0331265_276_803 171
418 3300044842 Ga0466957_0211144 Ga0466957_0211144_177_692 171
419 3300046459 Ga0495629_0718440 Ga0495629_0718440_133_648 171
420 3300046516 Ga0495628_0113285 Ga0495628_0113285_361_876 171
421 3300046539 Ga0495621_0024718 Ga0495621_0024718_210_728 171
422 3300046542 Ga0495597_0242717 Ga0495597_0242717_119_643 171
423 3300046543 Ga0495645_0077313 Ga0495645_0077313_577_1092 171
424 3300046616 Ga0495668_0071076 Ga0495668_0071076_130_648 171
425 3300046648 Ga0495611_0025607 Ga0495611_0025607_324_839 171
426 3300046660 Ga0495625_0427900 Ga0495625_0427900_294_809 171
427 3300046660 Ga0495625_0438452 Ga0495625_0438452_46_573 171
428 3300046674 Ga0495588_0140623 Ga0495588_0140623_537_1061 171
429 3300046684 Ga0495669_0000007 Ga0495669_0000007_174630_175157 171
430 3300046684 Ga0495669_0000731 Ga0495669_0000731_3408_3932 171
431 3300046692 Ga0495671_0271401 Ga0495671_0271401_291_806 171
432 3300047319 Ga0495674_0202756 Ga0495674_0202756_19_534 171
433 3300047320 Ga0495672_0062534 Ga0495672_0062534_1381_1896 171
434 3300047445 Ga0495677_0107437 Ga0495677_0107437_398_925 171
435 3300048904 Ga0496101_0026252 Ga0496101_0026252_2466_2981 171
436 3300048906 Ga0496103_0114109 Ga0496103_0114109_1044_1559 171
437 3300048907 Ga0496104_0552029 Ga0496104_0552029_506_1021 171
438 3300048909 Ga0496106_0421357 Ga0496106_0421357_164_679 171
439 3300048910 Ga0496107_0181655 Ga0496107_0181655_184_699 171
440 3300048911 Ga0496108_0261091 Ga0496108_0261091_678_1193 171
441 3300048912 Ga0496109_0003588 Ga0496109_0003588_1004_1519 171
442 3300048913 Ga0496110_0266704 Ga0496110_0266704_338_853 171
443 3300048915 Ga0496112_0113265 Ga0496112_0113265_1419_1934 171
444 3300048915 Ga0496112_0218871 Ga0496112_0218871_372_887 171
445 3300048916 Ga0496113_0034462 Ga0496113_0034462_1563_2078 171
446 3300048918 Ga0496115_0000467 Ga0496115_0000467_24407_24922 171
447 3300049569 Ga0501032_0662999 Ga0501032_0662999_124_642 171
448 3300049569 Ga0501032_0740402 Ga0501032_0740402_68_583 171
449 3300049581 Ga0501047_0006395 Ga0501047_0006395_7338_7853 171
450 3300049581 Ga0501047_0447145 Ga0501047_0447145_241_771 171
451 3300049582 Ga0501048_0179019 Ga0501048_0179019_797_1333 171
452 3300049742 Ga0501080_0432936 Ga0501080_0432936_617_1144 171
453 3300049822 Ga0501035_0506565 Ga0501035_0506565_446_964 171
454 3300049823 Ga0501044_0047950 Ga0501044_0047950_1732_2247 171
455 3300050489 nmdc:mga03683_300618_c1 nmdc:mga03683_300618_c1_41_559 171
456 3300050490 nmdc:mga03n38_301262_c1 nmdc:mga03n38_301262_c1_22_540 171
457 3300050492 nmdc:mga0yw44_161715_c1 nmdc:mga0yw44_161715_c1_732_1250 171
458 3300050493 nmdc:mga0k408_254657_c1 nmdc:mga0k408_254657_c1_111_626 171
459 3300050496 nmdc:mga07m45_50773_c1 nmdc:mga07m45_50773_c1_1340_1855 171
460 3300053108 Ga0500562_001663 Ga0500562_001663_4555_5070 171
461 3300053119 Ga0500595_029226 Ga0500595_029226_773_1303 171
462 3300053119 Ga0500595_070239 Ga0500595_070239_12_527 171
463 3300053136 Ga0500559_0189619 Ga0500559_0189619_131_649 171
464 3300053730 Ga0500645_004269 Ga0500645_004269_4821_5336 171

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07977

FabA

FabA-like domain

46

176

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bhj-assembly2.cif.gz_B crystal structure of 3-hydroxydecanoyl-acyl carrier protein dehydratase (faba) from pseudomonas aeruginosa in complex with ddd00084774 0.9824 7 169
4b0j-assembly4.cif.gz_G crystal structure of 3-hydroxydecanoyl-acyl carrier protein dehydratase (faba) from pseudomonas aeruginosa in complex with 5-(2- thienyl)-3-isoxazolyl methanol 0.9759 7 171
4b0i-assembly2.cif.gz_A crystal structure of 3-hydroxydecanoyl-acyl carrier protein dehydratase (faba) mutant (h70n) from pseudomonas aeruginosa in complex with 3-hydroxydecanoyl-n-acetyl cysteamine 0.9738 7 171
4b0i-assembly3.cif.gz_E-2 crystal structure of 3-hydroxydecanoyl-acyl carrier protein dehydratase (faba) mutant (h70n) from pseudomonas aeruginosa in complex with 3-hydroxydecanoyl-n-acetyl cysteamine 0.9737 6 171
4b0j-assembly6.cif.gz_N crystal structure of 3-hydroxydecanoyl-acyl carrier protein dehydratase (faba) from pseudomonas aeruginosa in complex with 5-(2- thienyl)-3-isoxazolyl methanol 0.9723 7 171
ID Description Score Start End Superfamily
3q62A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.94 2 171 3.10.129.10
3q62A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9346 2 171 3.10.129.10
5buyF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8909 9 167 3.10.129.10
4h4gA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8897 10 169 3.10.129.10
4h4gA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8834 10 169 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A3D4F3Y7-F1-model_v4 deleted 0.997 7 135
AF-A0A0Q7UD58-F1-model_v4 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase (EC 4.2.1.59) (3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA) (Beta-hydroxydecanoyl thioester dehydrase) (Trans-2-decenoyl-[acyl-carrier-protein] isomerase) (EC 5.3.3.14) 0.9942 7 168 GO:0005737
GO:0006636
GO:0019171
GO:0034017
AF-A0A348YNT2-F1-model_v4 Bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase 0.9941 7 116 GO:0006633
GO:0019171
GO:0034017
AF-A0A530QF50-F1-model_v4 Bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase (EC 4.2.1.59, EC 5.3.3.14) 0.9938 12 105 GO:0006633
GO:0019171
GO:0034017
AF-A0A432TS59-F1-model_v4 Bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase (EC 4.2.1.59, EC 5.3.3.14) 0.9895 6 132 GO:0006633
GO:0019171
GO:0034017

Feature Viewer

pLDDT pTM Quality
93.44 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map