F449264

General Info

Members Datasets Scaffolds Average Seq Length
464 213 928 260

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100046033|Ga0068864_1000460333
Length 271
Sequence MERRLNGAAHHHKLAIEAVGRTFAGVRGGTPTVALEPVTLRVEDHDFITILGPSGCGKSTLLRIVAGLDTPTAGRVLLDGTPVVAPGADRGMVFQSYTLFPWLTVHENICFGLREKNMPQNEQQRIAAHYIARVGLGGFEHHYPKMLSGGMQQRTAIARALANDPKILLLDEPFGALDNQTRALMQELLLGIWEAEKKTVLFVTHDIEEAIFMAGRVIVMSARPGRIKAEVAVDLPHPRHYTVKTTPEFSALKARLTEEIRSEALKVAAAA

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
155 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
156 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
157 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
158 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
160 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
162 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
174 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
213 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.29
Nodule 0
Rhizoplane 1.08
Rhizosphere 97.41
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_100046033 3300005618 Bacteria 3743
2 Ga0065715_10111531 3300005293 Bacteria 2570
3 Ga0065707_10017671 3300005295 Bacteria 1738
4 Ga0070676_10330853 3300005328 Bacteria 1042
5 Ga0070690_100000701 3300005330 Bacteria 17178
6 Ga0070690_100049474 3300005330 Bacteria 2680
7 Ga0070690_100287628 3300005330 Bacteria 1175
8 Ga0070670_100014823 3300005331 Bacteria 6685
9 Ga0070670_100077764 3300005331 Bacteria 2850
10 Ga0070670_100165509 3300005331 Bacteria 1917
11 Ga0070670_100236372 3300005331 Bacteria 1590
12 Ga0068869_100000240 3300005334 Bacteria 28811
13 Ga0068869_100004298 3300005334 Bacteria 8845
14 Ga0068869_100039144 3300005334 Bacteria 3384
15 Ga0070666_10085117 3300005335 Bacteria 2165
16 Ga0070680_100002168 3300005336 Bacteria 14465
17 Ga0070680_100351406 3300005336 Bacteria 1254
18 Ga0068868_100000471 3300005338 Bacteria 26837
19 Ga0068868_100011298 3300005338 Bacteria 6501
20 Ga0070689_100000540 3300005340 Bacteria 22545
21 Ga0070689_100035324 3300005340 Bacteria 3819
22 Ga0070689_100300577 3300005340 Bacteria 1336
23 Ga0070691_10001174 3300005341 Bacteria 10949
24 Ga0070687_100000416 3300005343 Bacteria 14397
25 Ga0070661_100421558 3300005344 Bacteria 1058
26 Ga0070668_100001341 3300005347 Bacteria 17586
27 Ga0070668_100013667 3300005347 Bacteria 6061
28 Ga0070668_100362326 3300005347 Bacteria 1230
29 Ga0070669_100000668 3300005353 Bacteria 25208
30 Ga0070669_100046538 3300005353 Bacteria 3164
31 Ga0070669_100198613 3300005353 Bacteria 1577
32 Ga0070669_100279268 3300005353 Bacteria 1338
33 Ga0070669_100281900 3300005353 Bacteria 1332
34 Ga0070675_100001258 3300005354 Bacteria 18530
35 Ga0070675_100051570 3300005354 Bacteria 3381
36 Ga0070675_100580603 3300005354 Bacteria 1016
37 Ga0070671_100010289 3300005355 Bacteria 7504
38 Ga0070671_100092362 3300005355 Bacteria 2536
39 Ga0070674_100163424 3300005356 Bacteria 1691
40 Ga0070673_100015219 3300005364 Bacteria 5395
41 Ga0070673_100092350 3300005364 Bacteria 2476
42 Ga0070673_100307305 3300005364 Bacteria 1398
43 Ga0070688_100038958 3300005365 Bacteria 2906
44 Ga0070667_100004919 3300005367 Bacteria 11200
45 Ga0070667_100005264 3300005367 Bacteria 10819
46 Ga0070667_100037796 3300005367 Bacteria 4047
47 Ga0070667_100095033 3300005367 Bacteria 2569
48 Ga0070701_10001283 3300005438 Bacteria 9233
49 Ga0070705_100001316 3300005440 Bacteria 13312
50 Ga0070700_100005090 3300005441 Bacteria 6935
51 Ga0070700_100496299 3300005441 Bacteria 938
52 Ga0070694_100000418 3300005444 Bacteria 23163
53 Ga0070694_100022197 3300005444 Bacteria 4064
54 Ga0070694_100229579 3300005444 Bacteria 1396
55 Ga0070708_100000538 3300005445 Bacteria 28503
56 Ga0070708_100003225 3300005445 Bacteria 12725
57 Ga0070708_100477347 3300005445 Bacteria 1176
58 Ga0070663_100058005 3300005455 Bacteria 2779
59 Ga0070678_100003201 3300005456 Bacteria 9087
60 Ga0070678_100024961 3300005456 Bacteria 4012
61 Ga0070678_100042104 3300005456 Bacteria 3243
62 Ga0070678_100266690 3300005456 Bacteria 1442
63 Ga0070681_10137436 3300005458 Bacteria 2374
64 Ga0068867_100000442 3300005459 Bacteria 27552
65 Ga0068867_100000975 3300005459 Bacteria 19545
66 Ga0068867_100061803 3300005459 Bacteria 2782
67 Ga0068867_100241645 3300005459 Bacteria 1465
68 Ga0068867_100387442 3300005459 Bacteria 1175
69 Ga0068867_100429930 3300005459 Bacteria 1120
70 Ga0070706_100314631 3300005467 Bacteria 1460
71 Ga0070707_100740903 3300005468 Bacteria 946
72 Ga0070699_100456665 3300005518 Bacteria 1158
73 Ga0070697_100018516 3300005536 Bacteria 5490
74 Ga0070697_100091416 3300005536 Bacteria 2516
75 Ga0068853_100110480 3300005539 Bacteria 2442
76 Ga0068853_100283465 3300005539 Bacteria 1528
77 Ga0070672_100000287 3300005543 Bacteria 28567
78 Ga0070672_100005272 3300005543 Bacteria 8552
79 Ga0070672_100013687 3300005543 Bacteria 5736
80 Ga0070672_100014087 3300005543 Bacteria 5659
81 Ga0070686_100082250 3300005544 Bacteria 2135
82 Ga0070695_100002769 3300005545 Bacteria 10170
83 Ga0070696_100084812 3300005546 Bacteria 2248
84 Ga0070693_100001954 3300005547 Bacteria 9438
85 Ga0070665_100008986 3300005548 Bacteria 10122
86 Ga0070665_100013659 3300005548 Bacteria 8169
87 Ga0070704_100002922 3300005549 Bacteria 9706
88 Ga0068855_100083397 3300005563 Bacteria 3702
89 Ga0070664_100062389 3300005564 Bacteria 3177
90 Ga0070664_100173075 3300005564 Bacteria 1916
91 Ga0068857_100046789 3300005577 Bacteria 3839
92 Ga0068854_100033950 3300005578 Bacteria 3560
93 Ga0068854_100098147 3300005578 Bacteria 2192
94 Ga0068856_100021812 3300005614 Bacteria 6224
95 Ga0068856_100408970 3300005614 Bacteria 1376
96 Ga0070702_100000090 3300005615 Bacteria 26645
97 Ga0070702_100128753 3300005615 Bacteria 1596
98 Ga0068852_100151372 3300005616 Bacteria 2158
99 Ga0068852_100516969 3300005616 Bacteria 1191
100 Ga0068859_100001633 3300005617 Bacteria 22912
101 Ga0068859_100050936 3300005617 Bacteria 4161
102 Ga0068859_100063117 3300005617 Bacteria 3735
103 Ga0068859_100083674 3300005617 Bacteria 3234
104 Ga0068859_100216526 3300005617 Bacteria 2002
105 Ga0068859_100486400 3300005617 Bacteria 1329
106 Ga0068864_100003577 3300005618 Bacteria 12845
107 Ga0068864_100005258 3300005618 Bacteria 10611
108 Ga0068864_100365432 3300005618 Bacteria 1364
109 Ga0068864_100550979 3300005618 Bacteria 1114
110 Ga0068864_100839833 3300005618 Bacteria 904
111 Ga0068866_10000485 3300005718 Bacteria 18232
112 Ga0068861_100000853 3300005719 Bacteria 18466
113 Ga0068861_100027365 3300005719 Bacteria 4152
114 Ga0068861_100240065 3300005719 Bacteria 1541
115 Ga0068870_10040353 3300005840 Bacteria 2420
116 Ga0068863_100001368 3300005841 Bacteria 24235
117 Ga0068863_100428358 3300005841 Bacteria 1297
118 Ga0068863_100738773 3300005841 Bacteria 979
119 Ga0068858_100006176 3300005842 Bacteria 11684
120 Ga0068858_100016320 3300005842 Bacteria 6976
121 Ga0068858_100031100 3300005842 Bacteria 4957
122 Ga0068858_100153373 3300005842 Bacteria 2167
123 Ga0068860_100004808 3300005843 Bacteria 13752
124 Ga0068860_100011979 3300005843 Bacteria 8543
125 Ga0068860_100091904 3300005843 Bacteria 2891
126 Ga0068860_100138622 3300005843 Bacteria 2337
127 Ga0068860_100352962 3300005843 Bacteria 1447
128 Ga0068860_100536019 3300005843 Bacteria 1171
129 Ga0068860_100832521 3300005843 Bacteria 937
130 Ga0068862_100027133 3300005844 Bacteria 4819
131 Ga0068862_100034244 3300005844 Bacteria 4296
132 Ga0068862_100050180 3300005844 Bacteria 3565
133 Ga0068862_100118197 3300005844 Bacteria 2334
134 Ga0068862_100245188 3300005844 Bacteria 1631
135 Ga0068862_100272594 3300005844 Bacteria 1548
136 Ga0081539_10127382 3300005985 Bacteria 1256
137 Ga0075368_10003446 3300006042 Bacteria 5281
138 Ga0075367_10035836 3300006178 Bacteria 2874
139 Ga0075369_10069329 3300006186 Bacteria 1550
140 Ga0097621_100008005 3300006237 Bacteria 7587
141 Ga0097621_100055936 3300006237 Bacteria 3222
142 Ga0097621_100066231 3300006237 Bacteria 2975
143 Ga0097621_100450904 3300006237 Bacteria 1159
144 Ga0075370_10018238 3300006353 Bacteria 3806
145 Ga0068871_100000834 3300006358 Bacteria 20645
146 Ga0068871_100007397 3300006358 Bacteria 7841
147 Ga0068871_100216817 3300006358 Bacteria 1657
148 Ga0068871_100223182 3300006358 Bacteria 1633
149 Ga0075428_100000602 3300006844 Bacteria 36732
150 Ga0075428_100157357 3300006844 Bacteria 2467
151 Ga0075428_100530836 3300006844 Bacteria 1258
152 Ga0075430_100018438 3300006846 Bacteria 5938
153 Ga0075431_100008190 3300006847 Bacteria 10445
154 Ga0075431_100065119 3300006847 Bacteria 3763
155 Ga0075433_10005230 3300006852 Bacteria 10170
156 Ga0075433_10005479 3300006852 Bacteria 9971
157 Ga0075433_10540591 3300006852 Bacteria 1025
158 Ga0075434_100010081 3300006871 Bacteria 8848
159 Ga0075434_100035645 3300006871 Bacteria 4919
160 Ga0075434_100085157 3300006871 Bacteria 3160
161 Ga0075434_100087823 3300006871 Bacteria 3111
162 Ga0075434_100244727 3300006871 Bacteria 1813
163 Ga0075434_100247992 3300006871 Bacteria 1800
164 Ga0075434_100648714 3300006871 Bacteria 1074
165 Ga0075429_100002384 3300006880 Bacteria 15832
166 Ga0075429_100175665 3300006880 Bacteria 1876
167 Ga0068865_100051778 3300006881 Bacteria 2843
168 Ga0068865_100245756 3300006881 Bacteria 1410
169 Ga0075436_100000364 3300006914 Bacteria 28914
170 Ga0075436_100002227 3300006914 Bacteria 13395
171 Ga0075436_100022540 3300006914 Bacteria 4325
172 Ga0075436_100066204 3300006914 Bacteria 2497
173 Ga0097620_100001633 3300006931 Bacteria 22912
174 Ga0097620_100050936 3300006931 Bacteria 4161
175 Ga0097620_100063116 3300006931 Bacteria 3735
176 Ga0097620_100083685 3300006931 Bacteria 3234
177 Ga0097620_100216535 3300006931 Bacteria 2002
178 Ga0097620_100486419 3300006931 Bacteria 1329
179 Ga0075435_100000438 3300007076 Bacteria 25453
180 Ga0075435_100018242 3300007076 Bacteria 5330
181 Ga0075435_100504794 3300007076 Bacteria 1046
182 Ga0105251_10086280 3300009011 Bacteria 1446
183 Ga0105240_10146257 3300009093 Bacteria 2820
184 Ga0105240_10693701 3300009093 Bacteria 1112
185 Ga0111539_10003451 3300009094 Bacteria 20821
186 Ga0111539_10054814 3300009094 Bacteria 4742
187 Ga0111539_10182697 3300009094 Bacteria 2449
188 Ga0105245_10000944 3300009098 Bacteria 26426
189 Ga0105245_10402157 3300009098 Bacteria 1369
190 Ga0114129_10001652 3300009147 Bacteria 30334
191 Ga0114129_10036182 3300009147 Bacteria 6972
192 Ga0114129_10239171 3300009147 Bacteria 2441
193 Ga0114129_10526922 3300009147 Bacteria 1540
194 Ga0114129_10762918 3300009147 Bacteria 1237
195 Ga0105243_10000576 3300009148 Bacteria 36922
196 Ga0105243_10019715 3300009148 Bacteria 5114
197 Ga0105243_10311362 3300009148 Bacteria 1431
198 Ga0105243_10335026 3300009148 Bacteria 1384
199 Ga0105243_10736124 3300009148 Bacteria 965
200 Ga0105242_10101892 3300009176 Bacteria 2434
201 Ga0105242_10145836 3300009176 Bacteria 2059
202 Ga0105248_10017795 3300009177 Bacteria 7842
203 Ga0105248_10056706 3300009177 Bacteria 4395
204 Ga0105248_10070234 3300009177 Bacteria 3933
205 Ga0105248_10337262 3300009177 Bacteria 1697
206 Ga0105248_10555250 3300009177 Bacteria 1296
207 Ga0105249_10108380 3300009553 Bacteria 2622
208 Ga0105249_10421148 3300009553 Bacteria 1369
209 Ga0105239_10027181 3300010375 Bacteria 6298
210 Ga0157374_10003813 3300013296 Bacteria 12661
211 Ga0157374_10153023 3300013296 Bacteria 2243
212 Ga0157378_10007092 3300013297 Bacteria 9785
213 Ga0157378_10073830 3300013297 Bacteria 3067
214 Ga0157378_10110726 3300013297 Bacteria 2517
215 Ga0163162_10003831 3300013306 Bacteria 14422
216 Ga0163162_10018668 3300013306 Bacteria 6794
217 Ga0163162_10158115 3300013306 Bacteria 2387
218 Ga0163162_10173898 3300013306 Bacteria 2278
219 Ga0157372_10338025 3300013307 Bacteria 1754
220 Ga0157375_10003753 3300013308 Bacteria 13176
221 Ga0157375_10005930 3300013308 Bacteria 10648
222 Ga0157375_10135518 3300013308 Bacteria 2586
223 Ga0157375_10257872 3300013308 Bacteria 1905
224 Ga0157375_10352924 3300013308 Bacteria 1636
225 Ga0163163_10014074 3300014325 Bacteria 7345
226 Ga0163163_10038318 3300014325 Bacteria 4671
227 Ga0163163_10484347 3300014325 Bacteria 1298
228 Ga0157380_10098924 3300014326 Bacteria 2424
229 Ga0157380_10132403 3300014326 Bacteria 2129
230 Ga0157380_10167084 3300014326 Bacteria 1918
231 Ga0157377_10058515 3300014745 Bacteria 2195
232 Ga0157379_10000858 3300014968 Bacteria 24649
233 Ga0157379_10028643 3300014968 Bacteria 4954
234 Ga0157379_10040595 3300014968 Bacteria 4154
235 Ga0157379_10104870 3300014968 Bacteria 2537
236 Ga0157376_10000797 3300014969 Bacteria 20664
237 Ga0157376_10000986 3300014969 Bacteria 18545
238 Ga0157376_10046493 3300014969 Bacteria 3579
239 Ga0157376_10136174 3300014969 Bacteria 2198
240 Ga0163161_10022856 3300017792 Bacteria 4406
241 Ga0163161_10050915 3300017792 Bacteria 2998
242 Ga0163161_10298116 3300017792 Bacteria 1269
243 Ga0207697_10051367 3300025315 Bacteria 1704
244 Ga0207642_10013333 3300025899 Bacteria 2997
245 Ga0207642_10045055 3300025899 Bacteria 1956
246 Ga0207645_10000157 3300025907 Bacteria 53374
247 Ga0207643_10064236 3300025908 Bacteria 2101
248 Ga0207684_10013485 3300025910 Bacteria 7070
249 Ga0207695_10338316 3300025913 Bacteria 1393
250 Ga0207671_10202282 3300025914 Bacteria 1551
251 Ga0207660_10004806 3300025917 Bacteria 8789
252 Ga0207662_10056537 3300025918 Bacteria 2343
253 Ga0207662_10169022 3300025918 Bacteria 1401
254 Ga0207662_10318559 3300025918 Bacteria 1038
255 Ga0207649_10334165 3300025920 Bacteria 1117
256 Ga0207652_10064194 3300025921 Bacteria 3177
257 Ga0207646_10030223 3300025922 Bacteria 4914
258 Ga0207681_10034153 3300025923 Bacteria 3341
259 Ga0207681_10051406 3300025923 Bacteria 2792
260 Ga0207681_10062517 3300025923 Bacteria 2564
261 Ga0207681_10086435 3300025923 Bacteria 2228
262 Ga0207681_10098674 3300025923 Bacteria 2102
263 Ga0207681_10517196 3300025923 Bacteria 979
264 Ga0207650_10005693 3300025925 Bacteria 8503
265 Ga0207650_10023375 3300025925 Bacteria 4382
266 Ga0207650_10082918 3300025925 Bacteria 2435
267 Ga0207650_10115176 3300025925 Bacteria 2086
268 Ga0207650_10274734 3300025925 Bacteria 1370
269 Ga0207659_10006435 3300025926 Bacteria 7196
270 Ga0207659_10014554 3300025926 Bacteria 5078
271 Ga0207687_10028966 3300025927 Bacteria 3722
272 Ga0207644_10012783 3300025931 Bacteria 5582
273 Ga0207644_10019823 3300025931 Bacteria 4566
274 Ga0207706_10046268 3300025933 Bacteria 3853
275 Ga0207706_10184281 3300025933 Bacteria 1833
276 Ga0207706_10196785 3300025933 Bacteria 1768
277 Ga0207686_10029754 3300025934 Bacteria 3226
278 Ga0207686_10100126 3300025934 Bacteria 1933
279 Ga0207709_10000515 3300025935 Bacteria 33987
280 Ga0207709_10011114 3300025935 Bacteria 4964
281 Ga0207670_10041021 3300025936 Bacteria 3041
282 Ga0207669_10047016 3300025937 Bacteria 2553
283 Ga0207669_10421061 3300025937 Bacteria 1051
284 Ga0207669_10453032 3300025937 Bacteria 1017
285 Ga0207704_10022926 3300025938 Bacteria 3355
286 Ga0207704_10102093 3300025938 Bacteria 1915
287 Ga0207704_10147208 3300025938 Bacteria 1656
288 Ga0207704_10304627 3300025938 Bacteria 1222
289 Ga0207665_10434923 3300025939 Bacteria 1004
290 Ga0207691_10000249 3300025940 Bacteria 53276
291 Ga0207691_10006443 3300025940 Bacteria 11337
292 Ga0207691_10017092 3300025940 Bacteria 6882
293 Ga0207691_10023580 3300025940 Bacteria 5794
294 Ga0207711_10026251 3300025941 Bacteria 4887
295 Ga0207711_10058461 3300025941 Bacteria 3318
296 Ga0207711_10286932 3300025941 Bacteria 1516
297 Ga0207689_10001166 3300025942 Bacteria 25290
298 Ga0207689_10009790 3300025942 Bacteria 8258
299 Ga0207689_10069117 3300025942 Bacteria 2902
300 Ga0207679_10032761 3300025945 Bacteria 3652
301 Ga0207679_10546825 3300025945 Bacteria 1038
302 Ga0207667_10498472 3300025949 Bacteria 1235
303 Ga0207651_10018887 3300025960 Bacteria 4116
304 Ga0207651_10074685 3300025960 Bacteria 2415
305 Ga0207651_10393557 3300025960 Bacteria 1177
306 Ga0207712_10022600 3300025961 Unclassified 4143
307 Ga0207668_10004378 3300025972 Bacteria 8295
308 Ga0207668_10024536 3300025972 Bacteria 3893
309 Ga0207668_10091756 3300025972 Bacteria 2233
310 Ga0207668_10094552 3300025972 Bacteria 2204
311 Ga0207668_10248535 3300025972 Bacteria 1443
312 Ga0207640_10053609 3300025981 Bacteria 2633
313 Ga0207640_10197883 3300025981 Bacteria 1520
314 Ga0207658_10093160 3300025986 Bacteria 2342
315 Ga0207677_10058613 3300026023 Bacteria 2652
316 Ga0207677_10201663 3300026023 Bacteria 1582
317 Ga0207703_10002253 3300026035 Bacteria 16857
318 Ga0207703_10002446 3300026035 Bacteria 16111
319 Ga0207703_10021879 3300026035 Bacteria 5007
320 Ga0207703_10023868 3300026035 Bacteria 4809
321 Ga0207703_10120015 3300026035 Bacteria 2256
322 Ga0207703_10288732 3300026035 Bacteria 1492
323 Ga0207703_10369916 3300026035 Bacteria 1324
324 Ga0207639_10041011 3300026041 Bacteria 3460
325 Ga0207678_10123279 3300026067 Bacteria 2211
326 Ga0207708_10012396 3300026075 Bacteria 6354
327 Ga0207708_10064825 3300026075 Bacteria 2792
328 Ga0207708_10425440 3300026075 Bacteria 1102
329 Ga0207702_10066725 3300026078 Bacteria 3085
330 Ga0207641_10000374 3300026088 Bacteria 53088
331 Ga0207641_10033047 3300026088 Bacteria 4298
332 Ga0207641_10203479 3300026088 Bacteria 1827
333 Ga0207641_10407038 3300026088 Bacteria 1307
334 Ga0207641_10490734 3300026088 Bacteria 1191
335 Ga0207648_10000523 3300026089 Bacteria 42961
336 Ga0207648_10013639 3300026089 Bacteria 7544
337 Ga0207648_10021215 3300026089 Bacteria 5839
338 Ga0207648_10121188 3300026089 Bacteria 2300
339 Ga0207648_10229450 3300026089 Bacteria 1651
340 Ga0207648_10432299 3300026089 Bacteria 1197
341 Ga0207676_10001665 3300026095 Bacteria 16379
342 Ga0207676_10008789 3300026095 Bacteria 7187
343 Ga0207676_10016930 3300026095 Bacteria 5279
344 Ga0207676_10161167 3300026095 Bacteria 1943
345 Ga0207675_100000564 3300026118 Bacteria 36294
346 Ga0207675_100024242 3300026118 Bacteria 5642
347 Ga0207675_100040177 3300026118 Bacteria 4367
348 Ga0207675_100108631 3300026118 Bacteria 2616
349 Ga0207675_100615189 3300026118 Bacteria 1090
350 Ga0207683_10000476 3300026121 Bacteria 37318
351 Ga0207683_10038039 3300026121 Bacteria 4191
352 Ga0207683_10040510 3300026121 Bacteria 4065
353 Ga0207683_10044604 3300026121 Bacteria 3876
354 Ga0207683_10372961 3300026121 Bacteria 1311
355 Ga0207698_10171437 3300026142 Bacteria 1911
356 Ga0207698_10479790 3300026142 Bacteria 1206
357 Ga0209982_1009593 3300027552 Bacteria 1432
358 Ga0209983_1004525 3300027665 Bacteria 2918
359 Ga0209971_1024395 3300027682 Bacteria 1444
360 Ga0209974_10000388 3300027876 Bacteria 14607
361 Ga0209974_10009103 3300027876 Bacteria 3374
362 Ga0207428_10002128 3300027907 Bacteria 19921
363 Ga0268266_10004526 3300028379 Bacteria 13283
364 Ga0268266_10313817 3300028379 Bacteria 1465
365 Ga0268266_10338513 3300028379 Bacteria 1412
366 Ga0268265_10004995 3300028380 Bacteria 9105
367 Ga0268265_10024395 3300028380 Unclassified 4277
368 Ga0268265_10072810 3300028380 Bacteria 2681
369 Ga0268265_10084594 3300028380 Bacteria 2515
370 Ga0268265_10623173 3300028380 Bacteria 1034
371 Ga0268264_10007867 3300028381 Bacteria 8871
372 Ga0268264_10008187 3300028381 Bacteria 8681
373 Ga0268264_10034214 3300028381 Bacteria 4178
374 Ga0268264_10111092 3300028381 Bacteria 2401
375 Ga0268264_10311816 3300028381 Bacteria 1485
376 Ga0268264_10505696 3300028381 Bacteria 1179
377 Ga0265327_10028220 3300031251 Bacteria 3214
378 Ga0307408_100605125 3300031548 Bacteria 974
379 Ga0307413_10066343 3300031824 Bacteria 2252
380 Ga0373950_0023477 3300034818 Bacteria 1103
381 Ga0373958_0006595 3300034819 Bacteria 1815
382 Ga0373928_0003811 3300035084 Bacteria 2876
383 Ga0373929_0015039 3300035085 Bacteria 1502
384 Ga0373923_0038221 3300035111 Bacteria 1966
385 Ga0373932_0013232 3300035112 Bacteria 2047
386 Ga0373936_0010494 3300035113 Bacteria 3495
387 Ga0373939_0035897 3300035114 Bacteria 1463
388 Ga0373945_0001129 3300035116 Bacteria 8075
389 Ga0373943_0195502 3300035170 Bacteria 1117
390 Ga0373931_0009521 3300035691 Bacteria 4645
391 Ga0373931_0032500 3300035691 Bacteria 2700
392 Ga0373931_0056573 3300035691 Bacteria 2102
393 Ga0373935_0020681 3300035692 Bacteria 4023
394 Ga0373935_0148764 3300035692 Bacteria 1587
395 Ga0373927_0336980 3300035695 Bacteria 993
396 Ga0373947_0006859 3300035725 Bacteria 6604
397 Ga0373937_0158684 3300036401 Bacteria 2120
398 Ga0373925_0223018 3300037068 Bacteria 1505
399 Ga0451577_0145267 3300042876 Bacteria 2132
400 Ga0451577_0389925 3300042876 Bacteria 1264
401 Ga0451576_0296510 3300045051 Bacteria 1690
402 Ga0495580_0002018 3300046472 Bacteria 17865
403 Ga0495666_0008870 3300046526 Bacteria 5037
404 Ga0495665_0012134 3300046531 Bacteria 4666
405 Ga0495621_0059346 3300046539 Bacteria 1386
406 Ga0495647_0002247 3300046681 Bacteria 6056
407 Ga0495676_0117597 3300047321 Bacteria 1939
408 Ga0496102_0470292 3300048905 Bacteria 1178
409 Ga0496104_0398469 3300048907 Bacteria 1289
410 Ga0496106_0085071 3300048909 Bacteria 2434
411 Ga0496112_0012289 3300048915 Bacteria 7863
412 Ga0496113_0169277 3300048916 Bacteria 1730
413 Ga0501036_0704522 3300049572 Bacteria 834
414 Ga0501038_0251364 3300049574 Bacteria 1400
415 Ga0501039_0292174 3300049575 Bacteria 1281
416 Ga0501040_0003556 3300049576 Bacteria 10074
417 Ga0501042_0027494 3300049578 Bacteria 4000
418 Ga0501047_0534844 3300049581 Bacteria 997
419 Ga0501048_0020006 3300049582 Bacteria 4910
420 Ga0501071_0031121 3300049587 Bacteria 3780
421 Ga0501072_0261436 3300049588 Bacteria 1377
422 Ga0501073_0174509 3300049589 Bacteria 1488
423 Ga0501074_0302068 3300049590 Bacteria 1137
424 Ga0501075_0000740 3300049591 Bacteria 20286
425 Ga0501076_0226369 3300049592 Bacteria 1528
426 Ga0501080_0048109 3300049742 Bacteria 3970
427 Ga0501080_0497501 3300049742 Bacteria 1090
428 Ga0501081_0118012 3300049743 Bacteria 1887
429 Ga0501081_0120592 3300049743 Bacteria 1867
430 Ga0501083_0036465 3300049744 Bacteria 3354
431 Ga0501035_0094929 3300049822 Bacteria 2622
432 Ga0501045_0011981 3300049824 Bacteria 6095
433 Ga0501045_0188883 3300049824 Bacteria 1535
434 nmdc:mga07m45_11542_c1 3300050496 Bacteria 4646
435 nmdc:mga05p37_198820_c1 3300050507 Bacteria 2429
436 nmdc:mga05p37_2170_c1 3300050507 Bacteria 22883
437 nmdc:mga05p37_302821_c1 3300050507 Bacteria 1898
438 nmdc:mga09592_193_c1 3300050508 Bacteria 43770
439 nmdc:mga09592_37120_c1 3300050508 Bacteria 4086
440 nmdc:mga08y16_23077_c1 3300050511 Bacteria 6569
441 nmdc:mga08y16_262_c1 3300050511 Bacteria 47546
442 nmdc:mga08y16_514191_c1 3300050511 Bacteria 1215
443 nmdc:mga0n895_124289_c1 3300050512 Bacteria 2603
444 nmdc:mga0n895_232177_c1 3300050512 Bacteria 1872
445 nmdc:mga0n895_39828_c1 3300050512 Bacteria 4563
446 nmdc:mga0n895_53927_c1 3300050512 Bacteria 3953
447 nmdc:mga0n895_696720_c1 3300050512 Bacteria 1012
448 nmdc:mga0rr50_209962_c1 3300050513 Bacteria 1604
449 nmdc:mga0rr50_262647_c1 3300050513 Bacteria 1437
450 nmdc:mga08x19_14376_c1 3300050514 Bacteria 4800
451 nmdc:mga08x19_1508_c1 3300050514 Bacteria 14424
452 nmdc:mga08x19_27911_c1 3300050514 Bacteria 3532
453 nmdc:mga08x19_55025_c1 3300050514 Bacteria 2563
454 nmdc:mga0a205_111208_c1 3300050515 Bacteria 2638
455 nmdc:mga0a205_1117_c1 3300050515 Bacteria 22221
456 nmdc:mga0a205_207545_c1 3300050515 Bacteria 1848
457 nmdc:mga0a205_22451_c1 3300050515 Bacteria 5978
458 nmdc:mga0a205_341336_c1 3300050515 Bacteria 1366
459 Ga0500616_0081761 3300053153 Bacteria 1622
460 Ga0501084_0037861 3300054114 Bacteria 4031
461 Ga0501082_0006109 3300060353 Bacteria 10454
462 Ga0530510_0004686 3300061734 Bacteria 9460
463 Ga0530510_0222571 3300061734 Bacteria 1403
464 2821448462 2821443989 Bacteria 7658172
465 Ga0068864_100046033
466 Ga0065715_10111531
467 Ga0065707_10017671
468 Ga0070676_10330853
469 Ga0070690_100000701
470 Ga0070690_100049474
471 Ga0070690_100287628
472 Ga0070670_100014823
473 Ga0070670_100077764
474 Ga0070670_100165509
475 Ga0070670_100236372
476 Ga0068869_100000240
477 Ga0068869_100004298
478 Ga0068869_100039144
479 Ga0070666_10085117
480 Ga0070680_100002168
481 Ga0070680_100351406
482 Ga0068868_100000471
483 Ga0068868_100011298
484 Ga0070689_100000540
485 Ga0070689_100035324
486 Ga0070689_100300577
487 Ga0070691_10001174
488 Ga0070687_100000416
489 Ga0070661_100421558
490 Ga0070668_100001341
491 Ga0070668_100013667
492 Ga0070668_100362326
493 Ga0070669_100000668
494 Ga0070669_100046538
495 Ga0070669_100198613
496 Ga0070669_100279268
497 Ga0070669_100281900
498 Ga0070675_100001258
499 Ga0070675_100051570
500 Ga0070675_100580603
501 Ga0070671_100010289
502 Ga0070671_100092362
503 Ga0070674_100163424
504 Ga0070673_100015219
505 Ga0070673_100092350
506 Ga0070673_100307305
507 Ga0070688_100038958
508 Ga0070667_100004919
509 Ga0070667_100005264
510 Ga0070667_100037796
511 Ga0070667_100095033
512 Ga0070701_10001283
513 Ga0070705_100001316
514 Ga0070700_100005090
515 Ga0070700_100496299
516 Ga0070694_100000418
517 Ga0070694_100022197
518 Ga0070694_100229579
519 Ga0070708_100000538
520 Ga0070708_100003225
521 Ga0070708_100477347
522 Ga0070663_100058005
523 Ga0070678_100003201
524 Ga0070678_100024961
525 Ga0070678_100042104
526 Ga0070678_100266690
527 Ga0070681_10137436
528 Ga0068867_100000442
529 Ga0068867_100000975
530 Ga0068867_100061803
531 Ga0068867_100241645
532 Ga0068867_100387442
533 Ga0068867_100429930
534 Ga0070706_100314631
535 Ga0070707_100740903
536 Ga0070699_100456665
537 Ga0070697_100018516
538 Ga0070697_100091416
539 Ga0068853_100110480
540 Ga0068853_100283465
541 Ga0070672_100000287
542 Ga0070672_100005272
543 Ga0070672_100013687
544 Ga0070672_100014087
545 Ga0070686_100082250
546 Ga0070695_100002769
547 Ga0070696_100084812
548 Ga0070693_100001954
549 Ga0070665_100008986
550 Ga0070665_100013659
551 Ga0070704_100002922
552 Ga0068855_100083397
553 Ga0070664_100062389
554 Ga0070664_100173075
555 Ga0068857_100046789
556 Ga0068854_100033950
557 Ga0068854_100098147
558 Ga0068856_100021812
559 Ga0068856_100408970
560 Ga0070702_100000090
561 Ga0070702_100128753
562 Ga0068852_100151372
563 Ga0068852_100516969
564 Ga0068859_100001633
565 Ga0068859_100050936
566 Ga0068859_100063117
567 Ga0068859_100083674
568 Ga0068859_100216526
569 Ga0068859_100486400
570 Ga0068864_100003577
571 Ga0068864_100005258
572 Ga0068864_100365432
573 Ga0068864_100550979
574 Ga0068864_100839833
575 Ga0068866_10000485
576 Ga0068861_100000853
577 Ga0068861_100027365
578 Ga0068861_100240065
579 Ga0068870_10040353
580 Ga0068863_100001368
581 Ga0068863_100428358
582 Ga0068863_100738773
583 Ga0068858_100006176
584 Ga0068858_100016320
585 Ga0068858_100031100
586 Ga0068858_100153373
587 Ga0068860_100004808
588 Ga0068860_100011979
589 Ga0068860_100091904
590 Ga0068860_100138622
591 Ga0068860_100352962
592 Ga0068860_100536019
593 Ga0068860_100832521
594 Ga0068862_100027133
595 Ga0068862_100034244
596 Ga0068862_100050180
597 Ga0068862_100118197
598 Ga0068862_100245188
599 Ga0068862_100272594
600 Ga0081539_10127382
601 Ga0075368_10003446
602 Ga0075367_10035836
603 Ga0075369_10069329
604 Ga0097621_100008005
605 Ga0097621_100055936
606 Ga0097621_100066231
607 Ga0097621_100450904
608 Ga0075370_10018238
609 Ga0068871_100000834
610 Ga0068871_100007397
611 Ga0068871_100216817
612 Ga0068871_100223182
613 Ga0075428_100000602
614 Ga0075428_100157357
615 Ga0075428_100530836
616 Ga0075430_100018438
617 Ga0075431_100008190
618 Ga0075431_100065119
619 Ga0075433_10005230
620 Ga0075433_10005479
621 Ga0075433_10540591
622 Ga0075434_100010081
623 Ga0075434_100035645
624 Ga0075434_100085157
625 Ga0075434_100087823
626 Ga0075434_100244727
627 Ga0075434_100247992
628 Ga0075434_100648714
629 Ga0075429_100002384
630 Ga0075429_100175665
631 Ga0068865_100051778
632 Ga0068865_100245756
633 Ga0075436_100000364
634 Ga0075436_100002227
635 Ga0075436_100022540
636 Ga0075436_100066204
637 Ga0097620_100001633
638 Ga0097620_100050936
639 Ga0097620_100063116
640 Ga0097620_100083685
641 Ga0097620_100216535
642 Ga0097620_100486419
643 Ga0075435_100000438
644 Ga0075435_100018242
645 Ga0075435_100504794
646 Ga0105251_10086280
647 Ga0105240_10146257
648 Ga0105240_10693701
649 Ga0111539_10003451
650 Ga0111539_10054814
651 Ga0111539_10182697
652 Ga0105245_10000944
653 Ga0105245_10402157
654 Ga0114129_10001652
655 Ga0114129_10036182
656 Ga0114129_10239171
657 Ga0114129_10526922
658 Ga0114129_10762918
659 Ga0105243_10000576
660 Ga0105243_10019715
661 Ga0105243_10311362
662 Ga0105243_10335026
663 Ga0105243_10736124
664 Ga0105242_10101892
665 Ga0105242_10145836
666 Ga0105248_10017795
667 Ga0105248_10056706
668 Ga0105248_10070234
669 Ga0105248_10337262
670 Ga0105248_10555250
671 Ga0105249_10108380
672 Ga0105249_10421148
673 Ga0105239_10027181
674 Ga0157374_10003813
675 Ga0157374_10153023
676 Ga0157378_10007092
677 Ga0157378_10073830
678 Ga0157378_10110726
679 Ga0163162_10003831
680 Ga0163162_10018668
681 Ga0163162_10158115
682 Ga0163162_10173898
683 Ga0157372_10338025
684 Ga0157375_10003753
685 Ga0157375_10005930
686 Ga0157375_10135518
687 Ga0157375_10257872
688 Ga0157375_10352924
689 Ga0163163_10014074
690 Ga0163163_10038318
691 Ga0163163_10484347
692 Ga0157380_10098924
693 Ga0157380_10132403
694 Ga0157380_10167084
695 Ga0157377_10058515
696 Ga0157379_10000858
697 Ga0157379_10028643
698 Ga0157379_10040595
699 Ga0157379_10104870
700 Ga0157376_10000797
701 Ga0157376_10000986
702 Ga0157376_10046493
703 Ga0157376_10136174
704 Ga0163161_10022856
705 Ga0163161_10050915
706 Ga0163161_10298116
707 Ga0207697_10051367
708 Ga0207642_10013333
709 Ga0207642_10045055
710 Ga0207645_10000157
711 Ga0207643_10064236
712 Ga0207684_10013485
713 Ga0207695_10338316
714 Ga0207671_10202282
715 Ga0207660_10004806
716 Ga0207662_10056537
717 Ga0207662_10169022
718 Ga0207662_10318559
719 Ga0207649_10334165
720 Ga0207652_10064194
721 Ga0207646_10030223
722 Ga0207681_10034153
723 Ga0207681_10051406
724 Ga0207681_10062517
725 Ga0207681_10086435
726 Ga0207681_10098674
727 Ga0207681_10517196
728 Ga0207650_10005693
729 Ga0207650_10023375
730 Ga0207650_10082918
731 Ga0207650_10115176
732 Ga0207650_10274734
733 Ga0207659_10006435
734 Ga0207659_10014554
735 Ga0207687_10028966
736 Ga0207644_10012783
737 Ga0207644_10019823
738 Ga0207706_10046268
739 Ga0207706_10184281
740 Ga0207706_10196785
741 Ga0207686_10029754
742 Ga0207686_10100126
743 Ga0207709_10000515
744 Ga0207709_10011114
745 Ga0207670_10041021
746 Ga0207669_10047016
747 Ga0207669_10421061
748 Ga0207669_10453032
749 Ga0207704_10022926
750 Ga0207704_10102093
751 Ga0207704_10147208
752 Ga0207704_10304627
753 Ga0207665_10434923
754 Ga0207691_10000249
755 Ga0207691_10006443
756 Ga0207691_10017092
757 Ga0207691_10023580
758 Ga0207711_10026251
759 Ga0207711_10058461
760 Ga0207711_10286932
761 Ga0207689_10001166
762 Ga0207689_10009790
763 Ga0207689_10069117
764 Ga0207679_10032761
765 Ga0207679_10546825
766 Ga0207667_10498472
767 Ga0207651_10018887
768 Ga0207651_10074685
769 Ga0207651_10393557
770 Ga0207712_10022600
771 Ga0207668_10004378
772 Ga0207668_10024536
773 Ga0207668_10091756
774 Ga0207668_10094552
775 Ga0207668_10248535
776 Ga0207640_10053609
777 Ga0207640_10197883
778 Ga0207658_10093160
779 Ga0207677_10058613
780 Ga0207677_10201663
781 Ga0207703_10002253
782 Ga0207703_10002446
783 Ga0207703_10021879
784 Ga0207703_10023868
785 Ga0207703_10120015
786 Ga0207703_10288732
787 Ga0207703_10369916
788 Ga0207639_10041011
789 Ga0207678_10123279
790 Ga0207708_10012396
791 Ga0207708_10064825
792 Ga0207708_10425440
793 Ga0207702_10066725
794 Ga0207641_10000374
795 Ga0207641_10033047
796 Ga0207641_10203479
797 Ga0207641_10407038
798 Ga0207641_10490734
799 Ga0207648_10000523
800 Ga0207648_10013639
801 Ga0207648_10021215
802 Ga0207648_10121188
803 Ga0207648_10229450
804 Ga0207648_10432299
805 Ga0207676_10001665
806 Ga0207676_10008789
807 Ga0207676_10016930
808 Ga0207676_10161167
809 Ga0207675_100000564
810 Ga0207675_100024242
811 Ga0207675_100040177
812 Ga0207675_100108631
813 Ga0207675_100615189
814 Ga0207683_10000476
815 Ga0207683_10038039
816 Ga0207683_10040510
817 Ga0207683_10044604
818 Ga0207683_10372961
819 Ga0207698_10171437
820 Ga0207698_10479790
821 Ga0209982_1009593
822 Ga0209983_1004525
823 Ga0209971_1024395
824 Ga0209974_10000388
825 Ga0209974_10009103
826 Ga0207428_10002128
827 Ga0268266_10004526
828 Ga0268266_10313817
829 Ga0268266_10338513
830 Ga0268265_10004995
831 Ga0268265_10024395
832 Ga0268265_10072810
833 Ga0268265_10084594
834 Ga0268265_10623173
835 Ga0268264_10007867
836 Ga0268264_10008187
837 Ga0268264_10034214
838 Ga0268264_10111092
839 Ga0268264_10311816
840 Ga0268264_10505696
841 Ga0265327_10028220
842 Ga0307408_100605125
843 Ga0307413_10066343
844 Ga0373950_0023477
845 Ga0373958_0006595
846 Ga0373928_0003811
847 Ga0373929_0015039
848 Ga0373923_0038221
849 Ga0373932_0013232
850 Ga0373936_0010494
851 Ga0373939_0035897
852 Ga0373945_0001129
853 Ga0373943_0195502
854 Ga0373931_0009521
855 Ga0373931_0032500
856 Ga0373931_0056573
857 Ga0373935_0020681
858 Ga0373935_0148764
859 Ga0373927_0336980
860 Ga0373947_0006859
861 Ga0373937_0158684
862 Ga0373925_0223018
863 Ga0451577_0145267
864 Ga0451577_0389925
865 Ga0451576_0296510
866 Ga0495580_0002018
867 Ga0495666_0008870
868 Ga0495665_0012134
869 Ga0495621_0059346
870 Ga0495647_0002247
871 Ga0495676_0117597
872 Ga0496102_0470292
873 Ga0496104_0398469
874 Ga0496106_0085071
875 Ga0496112_0012289
876 Ga0496113_0169277
877 Ga0501036_0704522
878 Ga0501038_0251364
879 Ga0501039_0292174
880 Ga0501040_0003556
881 Ga0501042_0027494
882 Ga0501047_0534844
883 Ga0501048_0020006
884 Ga0501071_0031121
885 Ga0501072_0261436
886 Ga0501073_0174509
887 Ga0501074_0302068
888 Ga0501075_0000740
889 Ga0501076_0226369
890 Ga0501080_0048109
891 Ga0501080_0497501
892 Ga0501081_0118012
893 Ga0501081_0120592
894 Ga0501083_0036465
895 Ga0501035_0094929
896 Ga0501045_0011981
897 Ga0501045_0188883
898 nmdc:mga07m45_11542_c1
899 nmdc:mga05p37_198820_c1
900 nmdc:mga05p37_2170_c1
901 nmdc:mga05p37_302821_c1
902 nmdc:mga09592_193_c1
903 nmdc:mga09592_37120_c1
904 nmdc:mga08y16_23077_c1
905 nmdc:mga08y16_262_c1
906 nmdc:mga08y16_514191_c1
907 nmdc:mga0n895_124289_c1
908 nmdc:mga0n895_232177_c1
909 nmdc:mga0n895_39828_c1
910 nmdc:mga0n895_53927_c1
911 nmdc:mga0n895_696720_c1
912 nmdc:mga0rr50_209962_c1
913 nmdc:mga0rr50_262647_c1
914 nmdc:mga08x19_14376_c1
915 nmdc:mga08x19_1508_c1
916 nmdc:mga08x19_27911_c1
917 nmdc:mga08x19_55025_c1
918 nmdc:mga0a205_111208_c1
919 nmdc:mga0a205_1117_c1
920 nmdc:mga0a205_207545_c1
921 nmdc:mga0a205_22451_c1
922 nmdc:mga0a205_341336_c1
923 Ga0500616_0081761
924 Ga0501084_0037861
925 Ga0501082_0006109
926 Ga0530510_0004686
927 Ga0530510_0222571
928 2821448462

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

35

175

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9459 3 222
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.9417 3 222
7cad-assembly1.cif.gz_D mycobacterium smegmatis sugabc complex 0.9413 3 222
4jbw-assembly1.cif.gz_A crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.9381 3 222
8ja7-assembly1.cif.gz_D cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.9369 1 222
ID Description Score Start End Superfamily
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.988 4 247 3.40.50.300
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9718 4 247 3.40.50.300
af_Q47538_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9362 4 239 3.40.50.300
af_Q8T665_1_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9354 1 226 3.40.50.300
af_P77737_9_333_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9327 1 211 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A858WY56-F1-model_v4 ABC transporter ATP-binding protein 0.9909 4 257 GO:0005524
GO:0016887
AF-Q9AKT5-F1-model_v4 Putative ABC-transporter 0.9812 36 254 GO:0005524
GO:0016887
AF-A0A1Z8P518-F1-model_v4 ABC transporter ATP-binding protein 0.9789 2 251 GO:0005524
GO:0016887
AF-A0A1Q6DVK8-F1-model_v4 ABC-type nitrate/sulfonate/bicarbonate transport system ATPase component 0.9777 1 251 GO:0005524
GO:0016887
AF-A0A536PA20-F1-model_v4 ABC transporter ATP-binding protein 0.9776 1 253 GO:0005524
GO:0016887

Map