F449285

General Info

Members Datasets Scaffolds Average Seq Length
464 215 928 327

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10014866|Ga0105249_100148661
Length 339
Sequence MSLKILKAGMLDSIQDMGRFGYQQVGINPTGAMDKYAAAIANILVGNNSHVPVIEMHFPAATIFFEHPALIALSGADFSATIDGNSIPTNHAVIVNKNTTLQFHSLKNKSRCYLAIKGGIKLSKWLNSYSTNLKAEAGGFSGRRLLKDDIIELNSQFDHTNQHDENDPIAIGFKTLPWQANEDFGIEDTAQLLVLHGAEWNWLDKNSQEKFLRNPFFISHNSDRMGYRLASEPLQLITKTELVSSAVSFGTIQLLPDGQLIILMADHQTTGGYPRLGNIISVHLPMLAQLKAGDKIQFKFTDHPTAENLILKQQQHLTQLEIACKLRLENYIHEKGHNE

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
69 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
141 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
161 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
162 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
163 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
171 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
191 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
192 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
193 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
194 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
195 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
196 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
197 2643221729 Bacillus sp. Root11 Isolate Unclassified
198 2643221730 Bacillus sp. Root131 Isolate Unclassified
199 2684622632 Bacillus cereus 905 Isolate Unclassified
200 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
201 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
202 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
203 2738541358 Bacillus sp. OV752 Isolate Unclassified
204 2738543006 Bacillus sp. OK077 Isolate Unclassified
205 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
206 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
207 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
208 2938917290 Bacillus sp. CR71 Isolate Unclassified
209 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
210 2965761152 Bacillus sp. COPE52 Isolate Unclassified
211 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
212 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
213 8022792930 Bacillus sp. Xin Isolate Rhizosphere
214 8023438354 Bacillus sp. BH2 Isolate Unclassified
215 8023444577 Bacillus sp. BH32 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.69
Metatranscriptomes 0
Isolates 4.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.03
Nodule 0
Rhizoplane 0.43
Rhizosphere 88.36
Stem 0
Stem Tuber 0
Unclassified 15.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10014866 3300009553 Bacteria 6884
2 LJQas_1000595 3300000549 Bacteria 5864
3 JGI24751J29686_10000819 3300002459 Bacteria 7231
4 JGI25151J46595_10002367 3300003187 Bacteria 11443
5 JGI25151J46595_10010816 3300003187 Bacteria 4222
6 JGI25151J46595_10050538 3300003187 Bacteria 1415
7 rootH1_10017103 3300003323 Bacteria 28716
8 JGI25160J50197_1000375 3300003354 Bacteria 29260
9 Ga0065704_10017429 3300005289 Bacteria 2067
10 Ga0065715_10292667 3300005293 Unclassified 1059
11 Ga0065707_10107729 3300005295 Unclassified 2541
12 Ga0070676_10001998 3300005328 Bacteria 10370
13 Ga0070676_10002273 3300005328 Bacteria 9809
14 Ga0070676_10157160 3300005328 Bacteria 1460
15 Ga0070676_10180166 3300005328 Bacteria 1373
16 Ga0070683_100001393 3300005329 Bacteria 18553
17 Ga0070683_100138769 3300005329 Bacteria 2303
18 Ga0070683_100192080 3300005329 Bacteria 1939
19 Ga0070690_100019989 3300005330 Bacteria 4076
20 Ga0070670_100016285 3300005331 Bacteria 6385
21 Ga0070670_100017437 3300005331 Bacteria 6159
22 Ga0070670_100314580 3300005331 Unclassified 1371
23 Ga0070677_10058933 3300005333 Bacteria 1578
24 Ga0068869_100001381 3300005334 Bacteria 14366
25 Ga0068869_100021050 3300005334 Bacteria 4483
26 Ga0068869_100030784 3300005334 Bacteria 3770
27 Ga0068869_100035572 3300005334 Bacteria 3530
28 Ga0068869_100037162 3300005334 Bacteria 3462
29 Ga0068869_100044864 3300005334 Unclassified 3180
30 Ga0068869_100097131 3300005334 Bacteria 2224
31 Ga0068869_100254069 3300005334 Unclassified 1405
32 Ga0070666_10031434 3300005335 Unclassified 3505
33 Ga0068868_100003353 3300005338 Bacteria 11144
34 Ga0068868_100004611 3300005338 Bacteria 9667
35 Ga0068868_100099700 3300005338 Bacteria 2350
36 Ga0068868_100131126 3300005338 Bacteria 2051
37 Ga0068868_100294674 3300005338 Bacteria 1376
38 Ga0070689_100015001 3300005340 Bacteria 5641
39 Ga0070689_100029334 3300005340 Bacteria 4163
40 Ga0070689_100038560 3300005340 Unclassified 3656
41 Ga0070689_100088515 3300005340 Bacteria 2437
42 Ga0070689_100158040 3300005340 Bacteria 1831
43 Ga0070687_100094320 3300005343 Bacteria 1662
44 Ga0070661_100000700 3300005344 Bacteria 24597
45 Ga0070661_100163744 3300005344 Unclassified 1685
46 Ga0070668_100008643 3300005347 Bacteria 7561
47 Ga0070668_100213752 3300005347 Bacteria 1587
48 Ga0070668_100255401 3300005347 Bacteria 1456
49 Ga0070669_100007779 3300005353 Bacteria 7656
50 Ga0070669_100040581 3300005353 Unclassified 3383
51 Ga0070669_100121804 3300005353 Bacteria 1991
52 Ga0070669_100153537 3300005353 Bacteria 1784
53 Ga0070675_100018008 3300005354 Bacteria 5622
54 Ga0070675_100145629 3300005354 Bacteria 2028
55 Ga0070675_100182146 3300005354 Bacteria 1817
56 Ga0070671_100142856 3300005355 Bacteria 2020
57 Ga0070671_100190488 3300005355 Bacteria 1738
58 Ga0070671_100368031 3300005355 Bacteria 1227
59 Ga0070674_100009129 3300005356 Bacteria 5931
60 Ga0070673_100074409 3300005364 Bacteria 2737
61 Ga0070688_100066159 3300005365 Bacteria 2299
62 Ga0070688_100104359 3300005365 Bacteria 1874
63 Ga0070659_100009106 3300005366 Bacteria 7281
64 Ga0070659_100097735 3300005366 Unclassified 2360
65 Ga0070678_100008731 3300005456 Bacteria 6087
66 Ga0070678_100068455 3300005456 Bacteria 2646
67 Ga0070662_100030379 3300005457 Bacteria 3780
68 Ga0070662_100039869 3300005457 Bacteria 3343
69 Ga0068867_100027376 3300005459 Bacteria 4096
70 Ga0068867_100065990 3300005459 Unclassified 2695
71 Ga0068867_100268707 3300005459 Bacteria 1393
72 Ga0070685_10023144 3300005466 Bacteria 3398
73 Ga0070685_10060660 3300005466 Bacteria 2212
74 Ga0070685_10163804 3300005466 Bacteria 1419
75 Ga0070698_100000850 3300005471 Bacteria 33482
76 Ga0070698_100018681 3300005471 Bacteria 7298
77 Ga0070684_100001259 3300005535 Bacteria 18156
78 Ga0070684_100142796 3300005535 Bacteria 2166
79 Ga0068853_100000395 3300005539 Bacteria 29784
80 Ga0068853_100009713 3300005539 Bacteria 7759
81 Ga0068853_100044279 3300005539 Unclassified 3810
82 Ga0068853_100212184 3300005539 Unclassified 1765
83 Ga0068853_100445188 3300005539 Unclassified 1218
84 Ga0070672_100042845 3300005543 Bacteria 3486
85 Ga0070672_100068671 3300005543 Bacteria 2811
86 Ga0070672_100073303 3300005543 Bacteria 2729
87 Ga0070672_100453453 3300005543 Bacteria 1105
88 Ga0070686_100030901 3300005544 Unclassified 3271
89 Ga0070696_100336304 3300005546 Bacteria 1166
90 Ga0070665_100084739 3300005548 Unclassified 3174
91 Ga0070665_100460902 3300005548 Bacteria 1281
92 Ga0070704_100282955 3300005549 Unclassified 1375
93 Ga0068855_100007582 3300005563 Bacteria 13129
94 Ga0068855_100192462 3300005563 Bacteria 2300
95 Ga0070664_100005564 3300005564 Bacteria 10120
96 Ga0070664_100017550 3300005564 Bacteria 5878
97 Ga0070664_100040027 3300005564 Unclassified 3951
98 Ga0070664_100074704 3300005564 Bacteria 2909
99 Ga0070664_100082492 3300005564 Bacteria 2773
100 Ga0068857_100003941 3300005577 Bacteria 12494
101 Ga0068857_100017630 3300005577 Bacteria 6261
102 Ga0068857_100047104 3300005577 Bacteria 3827
103 Ga0068857_100049009 3300005577 Bacteria 3748
104 Ga0068857_100065232 3300005577 Unclassified 3237
105 Ga0068857_100182275 3300005577 Bacteria 1911
106 Ga0068854_100038467 3300005578 Unclassified 3365
107 Ga0068854_100102151 3300005578 Bacteria 2151
108 Ga0068854_100110514 3300005578 Bacteria 2073
109 Ga0068854_100474517 3300005578 Unclassified 1049
110 Ga0070702_100022014 3300005615 Bacteria 3363
111 Ga0068852_100004088 3300005616 Bacteria 10268
112 Ga0068852_100534874 3300005616 Bacteria 1171
113 Ga0068859_100013961 3300005617 Bacteria 8056
114 Ga0068859_100016987 3300005617 Bacteria 7305
115 Ga0068859_100024704 3300005617 Bacteria 6030
116 Ga0068859_100038428 3300005617 Bacteria 4803
117 Ga0068859_100225128 3300005617 Bacteria 1964
118 Ga0068859_100519560 3300005617 Bacteria 1286
119 Ga0068864_100026128 3300005618 Bacteria 4922
120 Ga0068864_100042196 3300005618 Bacteria 3903
121 Ga0068864_100064184 3300005618 Unclassified 3184
122 Ga0068864_100506287 3300005618 Bacteria 1162
123 Ga0068864_100510614 3300005618 Bacteria 1157
124 Ga0068866_10088978 3300005718 Bacteria 1677
125 Ga0068861_100002332 3300005719 Bacteria 12331
126 Ga0068861_100003327 3300005719 Bacteria 10636
127 Ga0068861_100052469 3300005719 Bacteria 3099
128 Ga0068861_100056023 3300005719 Unclassified 3008
129 Ga0068870_10005159 3300005840 Bacteria 5685
130 Ga0068870_10006965 3300005840 Bacteria 5014
131 Ga0068870_10090773 3300005840 Bacteria 1707
132 Ga0068863_100024490 3300005841 Bacteria 5756
133 Ga0068863_100046824 3300005841 Unclassified 4105
134 Ga0068863_100324782 3300005841 Unclassified 1495
135 Ga0068858_100185784 3300005842 Bacteria 1963
136 Ga0068858_100227727 3300005842 Bacteria 1767
137 Ga0068860_100053218 3300005843 Bacteria 3850
138 Ga0068860_100053482 3300005843 Unclassified 3839
139 Ga0068860_100072941 3300005843 Bacteria 3263
140 Ga0068860_100354019 3300005843 Unclassified 1445
141 Ga0068862_100153106 3300005844 Bacteria 2053
142 Ga0068862_100187025 3300005844 Bacteria 1862
143 Ga0068862_100203701 3300005844 Bacteria 1785
144 Ga0070715_10106724 3300006163 Bacteria 1315
145 Ga0075366_10006034 3300006195 Bacteria 6602
146 Ga0075366_10022580 3300006195 Unclassified 3661
147 Ga0075366_10041904 3300006195 Bacteria 2711
148 Ga0097621_100008757 3300006237 Bacteria 7310
149 Ga0097621_100115982 3300006237 Bacteria 2267
150 Ga0097621_100335710 3300006237 Bacteria 1341
151 Ga0068871_100007800 3300006358 Bacteria 7664
152 Ga0068871_100026146 3300006358 Bacteria 4551
153 Ga0068871_100107366 3300006358 Bacteria 2345
154 Ga0068871_100286494 3300006358 Bacteria 1442
155 Ga0075428_100341128 3300006844 Bacteria 1609
156 Ga0075428_100469192 3300006844 Bacteria 1348
157 Ga0075428_100550785 3300006844 Unclassified 1233
158 Ga0075430_100003052 3300006846 Bacteria 14002
159 Ga0075430_100038623 3300006846 Bacteria 4043
160 Ga0075431_100006268 3300006847 Bacteria 11815
161 Ga0075434_100004332 3300006871 Bacteria 12765
162 Ga0075429_100022294 3300006880 Bacteria 5493
163 Ga0075429_100266392 3300006880 Unclassified 1500
164 Ga0068865_100016453 3300006881 Unclassified 4733
165 Ga0097620_100013961 3300006931 Bacteria 8056
166 Ga0097620_100016985 3300006931 Bacteria 7305
167 Ga0097620_100024706 3300006931 Bacteria 6030
168 Ga0097620_100038428 3300006931 Bacteria 4803
169 Ga0097620_100225139 3300006931 Bacteria 1964
170 Ga0097620_100519559 3300006931 Bacteria 1286
171 Ga0105251_10009303 3300009011 Bacteria 5814
172 Ga0105251_10061904 3300009011 Bacteria 1759
173 Ga0105244_10000740 3300009036 Bacteria 27926
174 Ga0105250_10004788 3300009092 Bacteria 6170
175 Ga0105250_10004885 3300009092 Bacteria 6095
176 Ga0105250_10040358 3300009092 Bacteria 1872
177 Ga0105240_10123321 3300009093 Bacteria 3118
178 Ga0111539_10014976 3300009094 Bacteria 9667
179 Ga0111539_10547244 3300009094 Bacteria 1348
180 Ga0111539_10829735 3300009094 Bacteria 1076
181 Ga0105247_10000408 3300009101 Bacteria 36396
182 Ga0105247_10056073 3300009101 Unclassified 2433
183 Ga0114129_10043242 3300009147 Bacteria 6338
184 Ga0114129_10114584 3300009147 Bacteria 3717
185 Ga0114129_10650798 3300009147 Bacteria 1360
186 Ga0105241_10052115 3300009174 Unclassified 3123
187 Ga0105242_10018955 3300009176 Bacteria 5389
188 Ga0105242_10036758 3300009176 Bacteria 3930
189 Ga0105242_10125704 3300009176 Bacteria 2207
190 Ga0105242_10129466 3300009176 Bacteria 2176
191 Ga0105249_10004239 3300009553 Bacteria 12401
192 Ga0105249_10004712 3300009553 Bacteria 11773
193 Ga0105249_10052693 3300009553 Bacteria 3716
194 Ga0105249_10312189 3300009553 Bacteria 1581
195 Ga0105239_10047696 3300010375 Bacteria 4694
196 Ga0105239_10135830 3300010375 Bacteria 2738
197 Ga0105246_10192145 3300011119 Bacteria 1581
198 Ga0157373_10032564 3300013100 Bacteria 3752
199 Ga0157371_10106169 3300013102 Bacteria 1993
200 Ga0157374_10001463 3300013296 Bacteria 19961
201 Ga0157374_10059289 3300013296 Bacteria 3578
202 Ga0157374_10219893 3300013296 Bacteria 1864
203 Ga0157378_10044156 3300013297 Bacteria 3957
204 Ga0157378_10230621 3300013297 Bacteria 1764
205 Ga0163162_10009462 3300013306 Bacteria 9474
206 Ga0163162_10042818 3300013306 Unclassified 4533
207 Ga0163162_10114845 3300013306 Unclassified 2792
208 Ga0163162_10128471 3300013306 Bacteria 2642
209 Ga0157372_10333463 3300013307 Bacteria 1767
210 Ga0157372_10442655 3300013307 Bacteria 1515
211 Ga0157375_10016593 3300013308 Bacteria 6622
212 Ga0157375_10096531 3300013308 Unclassified 3029
213 Ga0157375_10132746 3300013308 Bacteria 2611
214 Ga0157375_10244191 3300013308 Bacteria 1955
215 Ga0157375_10447920 3300013308 Bacteria 1457
216 Ga0163163_10000343 3300014325 Bacteria 44866
217 Ga0163163_10092101 3300014325 Unclassified 3046
218 Ga0163163_10111839 3300014325 Bacteria 2760
219 Ga0163163_10259565 3300014325 Bacteria 1788
220 Ga0163163_10346427 3300014325 Bacteria 1541
221 Ga0157380_10483634 3300014326 Unclassified 1198
222 Ga0157377_10001764 3300014745 Bacteria 9426
223 Ga0157377_10003672 3300014745 Bacteria 6963
224 Ga0157379_10038921 3300014968 Unclassified 4242
225 Ga0157379_10173957 3300014968 Bacteria 1944
226 Ga0157376_10340494 3300014969 Bacteria 1432
227 Ga0157376_10571117 3300014969 Bacteria 1122
228 Ga0163161_10052098 3300017792 Bacteria 2967
229 Ga0163161_10206474 3300017792 Bacteria 1516
230 Ga0163161_10225143 3300017792 Bacteria 1454
231 Ga0213876_10000389 3300021384 Bacteria 36929
232 Ga0213876_10020307 3300021384 Unclassified 3511
233 Ga0209130_1000192 3300025284 Bacteria 85073
234 Ga0209130_1001290 3300025284 Bacteria 17317
235 Ga0209130_1002569 3300025284 Bacteria 8844
236 Ga0209025_1000915 3300025294 Bacteria 45383
237 Ga0209025_1001333 3300025294 Bacteria 33361
238 Ga0209025_1001933 3300025294 Bacteria 23996
239 Ga0209025_1003383 3300025294 Bacteria 15215
240 Ga0209025_1006511 3300025294 Bacteria 9033
241 Ga0209025_1008222 3300025294 Bacteria 7545
242 Ga0209025_1008660 3300025294 Bacteria 7275
243 Ga0209025_1013771 3300025294 Bacteria 5049
244 Ga0209025_1038108 3300025294 Bacteria 2120
245 Ga0207426_1000026 3300025302 Bacteria 515228
246 Ga0207656_10025952 3300025321 Bacteria 2384
247 Ga0207696_1009280 3300025711 Bacteria 3677
248 Ga0207655_1003331 3300025728 Bacteria 12030
249 Ga0207642_10016844 3300025899 Bacteria 2765
250 Ga0207680_10090460 3300025903 Bacteria 1945
251 Ga0207645_10000748 3300025907 Bacteria 27039
252 Ga0207645_10018693 3300025907 Bacteria 4551
253 Ga0207643_10003520 3300025908 Bacteria 8423
254 Ga0207643_10007286 3300025908 Bacteria 5935
255 Ga0207643_10016684 3300025908 Bacteria 4005
256 Ga0207662_10044009 3300025918 Bacteria 2635
257 Ga0207649_10001123 3300025920 Bacteria 16235
258 Ga0207649_10029432 3300025920 Unclassified 3243
259 Ga0207681_10003075 3300025923 Bacteria 10485
260 Ga0207681_10015202 3300025923 Bacteria 4799
261 Ga0207681_10042217 3300025923 Unclassified 3045
262 Ga0207681_10044196 3300025923 Bacteria 2985
263 Ga0207681_10057984 3300025923 Bacteria 2649
264 Ga0207650_10089645 3300025925 Bacteria 2348
265 Ga0207650_10154792 3300025925 Unclassified 1812
266 Ga0207659_10009012 3300025926 Bacteria 6222
267 Ga0207659_10151559 3300025926 Bacteria 1811
268 Ga0207690_10003439 3300025932 Bacteria 9449
269 Ga0207706_10016620 3300025933 Bacteria 6641
270 Ga0207706_10023769 3300025933 Bacteria 5499
271 Ga0207706_10041996 3300025933 Unclassified 4052
272 Ga0207706_10047636 3300025933 Bacteria 3792
273 Ga0207686_10008363 3300025934 Bacteria 5586
274 Ga0207686_10074316 3300025934 Bacteria 2196
275 Ga0207686_10156791 3300025934 Bacteria 1591
276 Ga0207670_10013585 3300025936 Bacteria 4806
277 Ga0207670_10037891 3300025936 Unclassified 3145
278 Ga0207670_10260082 3300025936 Bacteria 1345
279 Ga0207669_10105515 3300025937 Bacteria 1875
280 Ga0207669_10225658 3300025937 Unclassified 1378
281 Ga0207704_10258772 3300025938 Bacteria 1311
282 Ga0207691_10002072 3300025940 Bacteria 19564
283 Ga0207691_10023350 3300025940 Bacteria 5821
284 Ga0207691_10055044 3300025940 Unclassified 3627
285 Ga0207691_10084065 3300025940 Bacteria 2857
286 Ga0207689_10000628 3300025942 Bacteria 33617
287 Ga0207689_10001062 3300025942 Bacteria 26443
288 Ga0207689_10001418 3300025942 Bacteria 22893
289 Ga0207689_10011584 3300025942 Bacteria 7555
290 Ga0207689_10012010 3300025942 Bacteria 7422
291 Ga0207689_10051348 3300025942 Bacteria 3399
292 Ga0207689_10114740 3300025942 Bacteria 2214
293 Ga0207689_10172239 3300025942 Unclassified 1785
294 Ga0207661_10001802 3300025944 Bacteria 14637
295 Ga0207661_10103006 3300025944 Unclassified 2401
296 Ga0207661_10198269 3300025944 Unclassified 1764
297 Ga0207679_10000768 3300025945 Bacteria 21047
298 Ga0207679_10038248 3300025945 Bacteria 3417
299 Ga0207679_10163867 3300025945 Bacteria 1823
300 Ga0207667_10008843 3300025949 Bacteria 11920
301 Ga0207651_10137371 3300025960 Bacteria 1882
302 Ga0207651_10237253 3300025960 Unclassified 1484
303 Ga0207712_10001226 3300025961 Bacteria 17716
304 Ga0207712_10006083 3300025961 Bacteria 7617
305 Ga0207668_10336009 3300025972 Bacteria 1258
306 Ga0207668_10429814 3300025972 Bacteria 1123
307 Ga0207640_10058074 3300025981 Unclassified 2548
308 Ga0207640_10185392 3300025981 Bacteria 1564
309 Ga0207658_10181390 3300025986 Bacteria 1743
310 Ga0207658_10364004 3300025986 Bacteria 1262
311 Ga0207677_10016754 3300026023 Bacteria 4350
312 Ga0207677_10067814 3300026023 Bacteria 2501
313 Ga0207677_10357342 3300026023 Bacteria 1226
314 Ga0207703_10033475 3300026035 Bacteria 4074
315 Ga0207703_10050397 3300026035 Unclassified 3370
316 Ga0207703_10138458 3300026035 Bacteria 2110
317 Ga0207703_10298241 3300026035 Bacteria 1469
318 Ga0207639_10000365 3300026041 Bacteria 31332
319 Ga0207639_10139389 3300026041 Unclassified 2019
320 Ga0207639_10168179 3300026041 Bacteria 1854
321 Ga0207639_10230928 3300026041 Bacteria 1603
322 Ga0207639_10247274 3300026041 Bacteria 1554
323 Ga0207678_10081581 3300026067 Bacteria 2769
324 Ga0207708_10248516 3300026075 Bacteria 1432
325 Ga0207641_10011229 3300026088 Bacteria 7347
326 Ga0207641_10027154 3300026088 Unclassified 4727
327 Ga0207641_10090357 3300026088 Bacteria 2678
328 Ga0207641_10115974 3300026088 Bacteria 2382
329 Ga0207648_10000372 3300026089 Bacteria 49262
330 Ga0207648_10002066 3300026089 Bacteria 21890
331 Ga0207648_10009587 3300026089 Bacteria 9263
332 Ga0207648_10015759 3300026089 Bacteria 6934
333 Ga0207648_10025791 3300026089 Bacteria 5231
334 Ga0207648_10092895 3300026089 Bacteria 2639
335 Ga0207648_10093426 3300026089 Unclassified 2630
336 Ga0207648_10359075 3300026089 Bacteria 1314
337 Ga0207676_10009647 3300026095 Bacteria 6869
338 Ga0207676_10046670 3300026095 Bacteria 3353
339 Ga0207676_10051016 3300026095 Bacteria 3228
340 Ga0207674_10005900 3300026116 Bacteria 14502
341 Ga0207674_10018901 3300026116 Bacteria 7472
342 Ga0207674_10021791 3300026116 Bacteria 6896
343 Ga0207674_10039622 3300026116 Bacteria 4883
344 Ga0207674_10110778 3300026116 Unclassified 2720
345 Ga0207674_10128989 3300026116 Unclassified 2493
346 Ga0207675_100000051 3300026118 Bacteria 83288
347 Ga0207675_100019278 3300026118 Bacteria 6363
348 Ga0207675_100073698 3300026118 Bacteria 3194
349 Ga0207675_100121039 3300026118 Unclassified 2476
350 Ga0207675_100129619 3300026118 Unclassified 2391
351 Ga0207675_100131880 3300026118 Bacteria 2370
352 Ga0207675_100201491 3300026118 Bacteria 1912
353 Ga0207683_10001617 3300026121 Bacteria 20205
354 Ga0207683_10020692 3300026121 Bacteria 5629
355 Ga0207698_10134207 3300026142 Bacteria 2121
356 Ga0207698_10215145 3300026142 Bacteria 1732
357 Ga0207698_10284809 3300026142 Bacteria 1530
358 Ga0209974_10076721 3300027876 Bacteria 1145
359 Ga0207428_10190180 3300027907 Bacteria 1548
360 Ga0207428_10273842 3300027907 Bacteria 1254
361 Ga0268266_10182107 3300028379 Bacteria 1913
362 Ga0268266_10337496 3300028379 Bacteria 1414
363 Ga0268265_10007190 3300028380 Bacteria 7522
364 Ga0268265_10080013 3300028380 Bacteria 2576
365 Ga0268265_10118239 3300028380 Unclassified 2179
366 Ga0268264_10039936 3300028381 Bacteria 3877
367 Ga0268264_10059527 3300028381 Bacteria 3200
368 Ga0268264_10195116 3300028381 Bacteria 1848
369 Ga0268264_10349896 3300028381 Bacteria 1406
370 Ga0265324_10012776 3300029957 Bacteria 3155
371 Ga0237817_10067 3300030083 Bacteria 33740
372 Ga0265327_10020718 3300031251 Bacteria 3995
373 Ga0265327_10041792 3300031251 Bacteria 2467
374 Ga0307509_10202134 3300031507 Bacteria 1822
375 Ga0307408_100011004 3300031548 Bacteria 5969
376 Ga0307408_100120347 3300031548 Bacteria 2033
377 Ga0307405_10009755 3300031731 Bacteria 4937
378 Ga0307413_10027835 3300031824 Unclassified 3139
379 Ga0307410_10070501 3300031852 Bacteria 2421
380 Ga0307410_10106483 3300031852 Bacteria 2021
381 Ga0307410_10350975 3300031852 Bacteria 1179
382 Ga0307406_10005517 3300031901 Bacteria 6922
383 Ga0307406_10222282 3300031901 Bacteria 1404
384 Ga0307407_10015437 3300031903 Unclassified 3775
385 Ga0307407_10233867 3300031903 Bacteria 1250
386 Ga0307412_10008114 3300031911 Bacteria 5981
387 Ga0307412_10094675 3300031911 Unclassified 2098
388 Ga0307409_100063064 3300031995 Bacteria 2905
389 Ga0307411_10002692 3300032005 Bacteria 7974
390 Ga0307411_10274093 3300032005 Bacteria 1339
391 Ga0373943_0042816 3300035170 Bacteria 2196
392 Ga0373947_0057206 3300035725 Bacteria 2359
393 Ga0373937_0034971 3300036401 Bacteria 4570
394 Ga0395900_0046426 3300037418 Bacteria 4473
395 Ga0395900_0341127 3300037418 Unclassified 1474
396 Ga0395901_0184561 3300038443 Unclassified 2188
397 Ga0237819_00368 3300038705 Bacteria 16014
398 Ga0237819_07815 3300038705 Bacteria 1509
399 Ga0436365_0281233 3300039437 Unclassified 3739
400 Ga0436365_0312284 3300039437 Bacteria 3689
401 Ga0436365_1933142 3300039437 Bacteria 64226
402 Ga0439449_0011903 3300042007 Bacteria 3271
403 Ga0450923_006545 3300042125 Bacteria 1937
404 Ga0466969_0000033 3300044656 Bacteria 82227
405 Ga0466972_0000091 3300044658 Bacteria 81829
406 Ga0466966_0000170 3300044684 Bacteria 42809
407 Ga0453684_0461754 3300044712 Unclassified 1412
408 Ga0466957_0003977 3300044842 Bacteria 8171
409 Ga0466959_0000089 3300045049 Bacteria 57482
410 Ga0451576_0132125 3300045051 Bacteria 2602
411 Ga0466967_0000284 3300045976 Bacteria 22491
412 Ga0495638_0087723 3300046460 Bacteria 1879
413 Ga0495650_0032493 3300046471 Bacteria 2333
414 Ga0495608_0072130 3300046511 Unclassified 2253
415 Ga0495652_0214196 3300046529 Bacteria 1452
416 Ga0495645_0264309 3300046543 Bacteria 1138
417 Ga0495634_0095460 3300046642 Unclassified 1926
418 Ga0495672_0012491 3300047320 Bacteria 5924
419 Ga0495672_0045884 3300047320 Unclassified 2611
420 Ga0495686_0018229 3300047472 Bacteria 4715
421 Ga0496110_0049203 3300048913 Unclassified 3697
422 Ga0496113_0585449 3300048916 Bacteria 894
423 Ga0501034_0028055 3300049571 Bacteria 5725
424 Ga0501034_0206682 3300049571 Bacteria 1919
425 Ga0501047_0174333 3300049581 Unclassified 2019
426 Ga0501044_0013458 3300049823 Bacteria 8848
427 Ga0501044_0016574 3300049823 Bacteria 7909
428 nmdc:mga0k408_43315_c1 3300050493 Bacteria 2593
429 nmdc:mga05p37_489696_c1 3300050507 Bacteria 1414
430 nmdc:mga05p37_9961_c1 3300050507 Bacteria 11286
431 nmdc:mga09592_80226_c1 3300050508 Bacteria 2779
432 nmdc:mga0qj67_20468_c1 3300050509 Bacteria 5065
433 nmdc:mga0qj67_27147_c1 3300050509 Bacteria 4435
434 nmdc:mga06r32_181755_c1 3300050510 Bacteria 2089
435 nmdc:mga08y16_19178_c1 3300050511 Bacteria 7207
436 nmdc:mga08y16_421660_c1 3300050511 Bacteria 1364
437 Ga0495619_0079934 3300053085 Bacteria 2200
438 Ga0500578_0017678 3300053086 Bacteria 4582
439 Ga0500583_0000002 3300053092 Bacteria 232826
440 Ga0500583_0000356 3300053092 Bacteria 15053
441 Ga0500568_0000532 3300053139 Bacteria 28130
442 Ga0500577_0002134 3300053142 Bacteria 5048
443 Ga0500589_007446 3300053147 Bacteria 4476
444 Ga0500611_000038 3300053727 Bacteria 71407
445 2553395699 2551306519 Bacteria 5465154
446 2644701974 2643221729 Bacteria 6621700
447 2644710891 2643221730 Bacteria 6523787
448 2685151036 2684622632 Bacteria 5380049
449 2698322206 2695420987 Bacteria 6152737
450 2705994925 2703719227 Bacteria 5631989
451 2721506288 2718218445 Bacteria 5113413
452 2739155606 2738541358 Bacteria 5932299
453 2739208385 2738543006 Bacteria 5904091
454 2819580107 2818991443 Bacteria 6598732
455 2884791957 2884791551 Bacteria 8511252
456 2929236738 2929233124 Bacteria 5948380
457 2938920652 2938917290 Bacteria 5914775
458 2947429761 2947426588 Bacteria 5357194
459 2965764295 2965761152 Bacteria 5806513
460 2979086702 2979083700 Bacteria 5894929
461 8022623058 8022621104 Bacteria 5241040
462 8022794203 8022792930 Bacteria 5693794
463 8023441724 8023438354 Bacteria 5779374
464 8023446720 8023444577 Bacteria 5661597
465 Ga0105249_10014866
466 LJQas_1000595
467 JGI24751J29686_10000819
468 JGI25151J46595_10002367
469 JGI25151J46595_10010816
470 JGI25151J46595_10050538
471 rootH1_10017103
472 JGI25160J50197_1000375
473 Ga0065704_10017429
474 Ga0065715_10292667
475 Ga0065707_10107729
476 Ga0070676_10001998
477 Ga0070676_10002273
478 Ga0070676_10157160
479 Ga0070676_10180166
480 Ga0070683_100001393
481 Ga0070683_100138769
482 Ga0070683_100192080
483 Ga0070690_100019989
484 Ga0070670_100016285
485 Ga0070670_100017437
486 Ga0070670_100314580
487 Ga0070677_10058933
488 Ga0068869_100001381
489 Ga0068869_100021050
490 Ga0068869_100030784
491 Ga0068869_100035572
492 Ga0068869_100037162
493 Ga0068869_100044864
494 Ga0068869_100097131
495 Ga0068869_100254069
496 Ga0070666_10031434
497 Ga0068868_100003353
498 Ga0068868_100004611
499 Ga0068868_100099700
500 Ga0068868_100131126
501 Ga0068868_100294674
502 Ga0070689_100015001
503 Ga0070689_100029334
504 Ga0070689_100038560
505 Ga0070689_100088515
506 Ga0070689_100158040
507 Ga0070687_100094320
508 Ga0070661_100000700
509 Ga0070661_100163744
510 Ga0070668_100008643
511 Ga0070668_100213752
512 Ga0070668_100255401
513 Ga0070669_100007779
514 Ga0070669_100040581
515 Ga0070669_100121804
516 Ga0070669_100153537
517 Ga0070675_100018008
518 Ga0070675_100145629
519 Ga0070675_100182146
520 Ga0070671_100142856
521 Ga0070671_100190488
522 Ga0070671_100368031
523 Ga0070674_100009129
524 Ga0070673_100074409
525 Ga0070688_100066159
526 Ga0070688_100104359
527 Ga0070659_100009106
528 Ga0070659_100097735
529 Ga0070678_100008731
530 Ga0070678_100068455
531 Ga0070662_100030379
532 Ga0070662_100039869
533 Ga0068867_100027376
534 Ga0068867_100065990
535 Ga0068867_100268707
536 Ga0070685_10023144
537 Ga0070685_10060660
538 Ga0070685_10163804
539 Ga0070698_100000850
540 Ga0070698_100018681
541 Ga0070684_100001259
542 Ga0070684_100142796
543 Ga0068853_100000395
544 Ga0068853_100009713
545 Ga0068853_100044279
546 Ga0068853_100212184
547 Ga0068853_100445188
548 Ga0070672_100042845
549 Ga0070672_100068671
550 Ga0070672_100073303
551 Ga0070672_100453453
552 Ga0070686_100030901
553 Ga0070696_100336304
554 Ga0070665_100084739
555 Ga0070665_100460902
556 Ga0070704_100282955
557 Ga0068855_100007582
558 Ga0068855_100192462
559 Ga0070664_100005564
560 Ga0070664_100017550
561 Ga0070664_100040027
562 Ga0070664_100074704
563 Ga0070664_100082492
564 Ga0068857_100003941
565 Ga0068857_100017630
566 Ga0068857_100047104
567 Ga0068857_100049009
568 Ga0068857_100065232
569 Ga0068857_100182275
570 Ga0068854_100038467
571 Ga0068854_100102151
572 Ga0068854_100110514
573 Ga0068854_100474517
574 Ga0070702_100022014
575 Ga0068852_100004088
576 Ga0068852_100534874
577 Ga0068859_100013961
578 Ga0068859_100016987
579 Ga0068859_100024704
580 Ga0068859_100038428
581 Ga0068859_100225128
582 Ga0068859_100519560
583 Ga0068864_100026128
584 Ga0068864_100042196
585 Ga0068864_100064184
586 Ga0068864_100506287
587 Ga0068864_100510614
588 Ga0068866_10088978
589 Ga0068861_100002332
590 Ga0068861_100003327
591 Ga0068861_100052469
592 Ga0068861_100056023
593 Ga0068870_10005159
594 Ga0068870_10006965
595 Ga0068870_10090773
596 Ga0068863_100024490
597 Ga0068863_100046824
598 Ga0068863_100324782
599 Ga0068858_100185784
600 Ga0068858_100227727
601 Ga0068860_100053218
602 Ga0068860_100053482
603 Ga0068860_100072941
604 Ga0068860_100354019
605 Ga0068862_100153106
606 Ga0068862_100187025
607 Ga0068862_100203701
608 Ga0070715_10106724
609 Ga0075366_10006034
610 Ga0075366_10022580
611 Ga0075366_10041904
612 Ga0097621_100008757
613 Ga0097621_100115982
614 Ga0097621_100335710
615 Ga0068871_100007800
616 Ga0068871_100026146
617 Ga0068871_100107366
618 Ga0068871_100286494
619 Ga0075428_100341128
620 Ga0075428_100469192
621 Ga0075428_100550785
622 Ga0075430_100003052
623 Ga0075430_100038623
624 Ga0075431_100006268
625 Ga0075434_100004332
626 Ga0075429_100022294
627 Ga0075429_100266392
628 Ga0068865_100016453
629 Ga0097620_100013961
630 Ga0097620_100016985
631 Ga0097620_100024706
632 Ga0097620_100038428
633 Ga0097620_100225139
634 Ga0097620_100519559
635 Ga0105251_10009303
636 Ga0105251_10061904
637 Ga0105244_10000740
638 Ga0105250_10004788
639 Ga0105250_10004885
640 Ga0105250_10040358
641 Ga0105240_10123321
642 Ga0111539_10014976
643 Ga0111539_10547244
644 Ga0111539_10829735
645 Ga0105247_10000408
646 Ga0105247_10056073
647 Ga0114129_10043242
648 Ga0114129_10114584
649 Ga0114129_10650798
650 Ga0105241_10052115
651 Ga0105242_10018955
652 Ga0105242_10036758
653 Ga0105242_10125704
654 Ga0105242_10129466
655 Ga0105249_10004239
656 Ga0105249_10004712
657 Ga0105249_10052693
658 Ga0105249_10312189
659 Ga0105239_10047696
660 Ga0105239_10135830
661 Ga0105246_10192145
662 Ga0157373_10032564
663 Ga0157371_10106169
664 Ga0157374_10001463
665 Ga0157374_10059289
666 Ga0157374_10219893
667 Ga0157378_10044156
668 Ga0157378_10230621
669 Ga0163162_10009462
670 Ga0163162_10042818
671 Ga0163162_10114845
672 Ga0163162_10128471
673 Ga0157372_10333463
674 Ga0157372_10442655
675 Ga0157375_10016593
676 Ga0157375_10096531
677 Ga0157375_10132746
678 Ga0157375_10244191
679 Ga0157375_10447920
680 Ga0163163_10000343
681 Ga0163163_10092101
682 Ga0163163_10111839
683 Ga0163163_10259565
684 Ga0163163_10346427
685 Ga0157380_10483634
686 Ga0157377_10001764
687 Ga0157377_10003672
688 Ga0157379_10038921
689 Ga0157379_10173957
690 Ga0157376_10340494
691 Ga0157376_10571117
692 Ga0163161_10052098
693 Ga0163161_10206474
694 Ga0163161_10225143
695 Ga0213876_10000389
696 Ga0213876_10020307
697 Ga0209130_1000192
698 Ga0209130_1001290
699 Ga0209130_1002569
700 Ga0209025_1000915
701 Ga0209025_1001333
702 Ga0209025_1001933
703 Ga0209025_1003383
704 Ga0209025_1006511
705 Ga0209025_1008222
706 Ga0209025_1008660
707 Ga0209025_1013771
708 Ga0209025_1038108
709 Ga0207426_1000026
710 Ga0207656_10025952
711 Ga0207696_1009280
712 Ga0207655_1003331
713 Ga0207642_10016844
714 Ga0207680_10090460
715 Ga0207645_10000748
716 Ga0207645_10018693
717 Ga0207643_10003520
718 Ga0207643_10007286
719 Ga0207643_10016684
720 Ga0207662_10044009
721 Ga0207649_10001123
722 Ga0207649_10029432
723 Ga0207681_10003075
724 Ga0207681_10015202
725 Ga0207681_10042217
726 Ga0207681_10044196
727 Ga0207681_10057984
728 Ga0207650_10089645
729 Ga0207650_10154792
730 Ga0207659_10009012
731 Ga0207659_10151559
732 Ga0207690_10003439
733 Ga0207706_10016620
734 Ga0207706_10023769
735 Ga0207706_10041996
736 Ga0207706_10047636
737 Ga0207686_10008363
738 Ga0207686_10074316
739 Ga0207686_10156791
740 Ga0207670_10013585
741 Ga0207670_10037891
742 Ga0207670_10260082
743 Ga0207669_10105515
744 Ga0207669_10225658
745 Ga0207704_10258772
746 Ga0207691_10002072
747 Ga0207691_10023350
748 Ga0207691_10055044
749 Ga0207691_10084065
750 Ga0207689_10000628
751 Ga0207689_10001062
752 Ga0207689_10001418
753 Ga0207689_10011584
754 Ga0207689_10012010
755 Ga0207689_10051348
756 Ga0207689_10114740
757 Ga0207689_10172239
758 Ga0207661_10001802
759 Ga0207661_10103006
760 Ga0207661_10198269
761 Ga0207679_10000768
762 Ga0207679_10038248
763 Ga0207679_10163867
764 Ga0207667_10008843
765 Ga0207651_10137371
766 Ga0207651_10237253
767 Ga0207712_10001226
768 Ga0207712_10006083
769 Ga0207668_10336009
770 Ga0207668_10429814
771 Ga0207640_10058074
772 Ga0207640_10185392
773 Ga0207658_10181390
774 Ga0207658_10364004
775 Ga0207677_10016754
776 Ga0207677_10067814
777 Ga0207677_10357342
778 Ga0207703_10033475
779 Ga0207703_10050397
780 Ga0207703_10138458
781 Ga0207703_10298241
782 Ga0207639_10000365
783 Ga0207639_10139389
784 Ga0207639_10168179
785 Ga0207639_10230928
786 Ga0207639_10247274
787 Ga0207678_10081581
788 Ga0207708_10248516
789 Ga0207641_10011229
790 Ga0207641_10027154
791 Ga0207641_10090357
792 Ga0207641_10115974
793 Ga0207648_10000372
794 Ga0207648_10002066
795 Ga0207648_10009587
796 Ga0207648_10015759
797 Ga0207648_10025791
798 Ga0207648_10092895
799 Ga0207648_10093426
800 Ga0207648_10359075
801 Ga0207676_10009647
802 Ga0207676_10046670
803 Ga0207676_10051016
804 Ga0207674_10005900
805 Ga0207674_10018901
806 Ga0207674_10021791
807 Ga0207674_10039622
808 Ga0207674_10110778
809 Ga0207674_10128989
810 Ga0207675_100000051
811 Ga0207675_100019278
812 Ga0207675_100073698
813 Ga0207675_100121039
814 Ga0207675_100129619
815 Ga0207675_100131880
816 Ga0207675_100201491
817 Ga0207683_10001617
818 Ga0207683_10020692
819 Ga0207698_10134207
820 Ga0207698_10215145
821 Ga0207698_10284809
822 Ga0209974_10076721
823 Ga0207428_10190180
824 Ga0207428_10273842
825 Ga0268266_10182107
826 Ga0268266_10337496
827 Ga0268265_10007190
828 Ga0268265_10080013
829 Ga0268265_10118239
830 Ga0268264_10039936
831 Ga0268264_10059527
832 Ga0268264_10195116
833 Ga0268264_10349896
834 Ga0265324_10012776
835 Ga0237817_10067
836 Ga0265327_10020718
837 Ga0265327_10041792
838 Ga0307509_10202134
839 Ga0307408_100011004
840 Ga0307408_100120347
841 Ga0307405_10009755
842 Ga0307413_10027835
843 Ga0307410_10070501
844 Ga0307410_10106483
845 Ga0307410_10350975
846 Ga0307406_10005517
847 Ga0307406_10222282
848 Ga0307407_10015437
849 Ga0307407_10233867
850 Ga0307412_10008114
851 Ga0307412_10094675
852 Ga0307409_100063064
853 Ga0307411_10002692
854 Ga0307411_10274093
855 Ga0373943_0042816
856 Ga0373947_0057206
857 Ga0373937_0034971
858 Ga0395900_0046426
859 Ga0395900_0341127
860 Ga0395901_0184561
861 Ga0237819_00368
862 Ga0237819_07815
863 Ga0436365_0281233
864 Ga0436365_0312284
865 Ga0436365_1933142
866 Ga0439449_0011903
867 Ga0450923_006545
868 Ga0466969_0000033
869 Ga0466972_0000091
870 Ga0466966_0000170
871 Ga0453684_0461754
872 Ga0466957_0003977
873 Ga0466959_0000089
874 Ga0451576_0132125
875 Ga0466967_0000284
876 Ga0495638_0087723
877 Ga0495650_0032493
878 Ga0495608_0072130
879 Ga0495652_0214196
880 Ga0495645_0264309
881 Ga0495634_0095460
882 Ga0495672_0012491
883 Ga0495672_0045884
884 Ga0495686_0018229
885 Ga0496110_0049203
886 Ga0496113_0585449
887 Ga0501034_0028055
888 Ga0501034_0206682
889 Ga0501047_0174333
890 Ga0501044_0013458
891 Ga0501044_0016574
892 nmdc:mga0k408_43315_c1
893 nmdc:mga05p37_489696_c1
894 nmdc:mga05p37_9961_c1
895 nmdc:mga09592_80226_c1
896 nmdc:mga0qj67_20468_c1
897 nmdc:mga0qj67_27147_c1
898 nmdc:mga06r32_181755_c1
899 nmdc:mga08y16_19178_c1
900 nmdc:mga08y16_421660_c1
901 Ga0495619_0079934
902 Ga0500578_0017678
903 Ga0500583_0000002
904 Ga0500583_0000356
905 Ga0500568_0000532
906 Ga0500577_0002134
907 Ga0500589_007446
908 Ga0500611_000038
909 2553395699
910 2644701974
911 2644710891
912 2685151036
913 2698322206
914 2705994925
915 2721506288
916 2739155606
917 2739208385
918 2819580107
919 2884791957
920 2929236738
921 2938920652
922 2947429761
923 2965764295
924 2979086702
925 8022623058
926 8022794203
927 8023441724
928 8023446720

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02626

CT_A_B

Carboxyltransferase domain, subdomain A and B

25

300

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dud-assembly1.cif.gz_A crystal structure of e. coli ybgjk 0.9485 3 311
5dud-assembly2.cif.gz_C crystal structure of e. coli ybgjk 0.9413 3 311
5dud-assembly1.cif.gz_A crystal structure of e. coli ybgjk 0.9363 3 311
5dud-assembly2.cif.gz_C crystal structure of e. coli ybgjk 0.9228 3 311
3opf-assembly2.cif.gz_B crystal structure of ttha0988 in space group p212121 0.9122 2 289
ID Description Score Start End Superfamily
5dudA02 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9415 176 310 2.40.100.10
3mmlG02 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9243 179 290 2.40.100.10
5dudA02 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9151 176 310 2.40.100.10
af_Q2G094_189_326_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.889 177 315 2.40.100.10
af_Q2FXW9_143_281_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8838 177 318 2.40.100.10
ID Description Score Start End GO Terms
AF-A0A7V9NNV8-F1-model_v4 KipI antagonist 0.9816 1 138 GO:0005524
GO:0016787
AF-A0A7V9JVT5-F1-model_v4 Biotin-dependent carboxyltransferase family protein 0.9769 1 316 GO:0005524
GO:0016740
GO:0016787
AF-A0A7W1D9Q5-F1-model_v4 Biotin-dependent carboxyltransferase family protein 0.9755 1 316 GO:0005524
GO:0016740
GO:0016787
AF-A0A2A5M713-F1-model_v4 Allophanate hydrolase 0.9754 34 123 GO:0005524
GO:0016787
AF-A0A382YFD3-F1-model_v4 Carboxyltransferase domain-containing protein 0.9753 10 149 GO:0005524
GO:0016787

Map