F449293

General Info

Members Datasets Scaffolds Average Seq Length
464 205 460 221

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10033097|Ga0157375_100330973
Length 252
Sequence LRHRHEAACPAVANRTLDPKRQRRAQRGVALVSEGRLRDELCRIGRSLHARGYVHGTTGNLSARLHDGLLITATDACLGDLEPAALVKVDAAGHASAGEPRPSKTLALHRRIYAAAAEAGGIVHTHSRALVALSLAIPAGEDRDDLVPPITPYFVMKVGHVPLLAYRRPGDPEVADRVAAAIADAERHGVPIRAVMLARLGPNVWAGTPAAAMARLEELEETARLWLAAEPRPEPLTPAQIDELRQHFGARW

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
3 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
4 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
145 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
146 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
149 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
158 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
159 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
160 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
161 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
162 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
163 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
164 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
165 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
166 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
167 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
168 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
169 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
170 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
171 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
172 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
173 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
174 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
175 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
176 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
184 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
197 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
198 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
199 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
200 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
201 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
202 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
203 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.14
Metatranscriptomes 0
Isolates 0.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 2.16
Rhizosphere 94.4
Stem 0
Stem Tuber 0
Unclassified 2.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10032265 3300003316 Bacteria 8741
2 rootL2_10265642 3300003322 Bacteria 2016
3 Ga0055526_1012252 3300003771 Bacteria 3761
4 Ga0070658_10132230 3300005327 Bacteria 2080
5 Ga0070676_10042231 3300005328 Bacteria 2647
6 Ga0070690_100007548 3300005330 Bacteria 6225
7 Ga0070670_100007455 3300005331 Bacteria 9292
8 Ga0070670_100021864 3300005331 Bacteria 5502
9 Ga0070670_100025286 3300005331 Bacteria 5109
10 Ga0070670_100041140 3300005331 Bacteria 3972
11 Ga0070670_100052768 3300005331 Bacteria 3491
12 Ga0070670_100119759 3300005331 Bacteria 2270
13 Ga0070670_100137641 3300005331 Bacteria 2110
14 Ga0070670_100493179 3300005331 Bacteria 1089
15 Ga0070677_10006985 3300005333 Bacteria 3754
16 Ga0070677_10011779 3300005333 Bacteria 3024
17 Ga0070677_10030593 3300005333 Bacteria 2051
18 Ga0070677_10182910 3300005333 Bacteria 999
19 Ga0068869_100000464 3300005334 Bacteria 22438
20 Ga0068869_100009432 3300005334 Bacteria 6333
21 Ga0070666_10022466 3300005335 Bacteria 4095
22 Ga0070666_10027084 3300005335 Bacteria 3751
23 Ga0070666_10055390 3300005335 Bacteria 2677
24 Ga0070680_100033470 3300005336 Bacteria 4143
25 Ga0068868_100011181 3300005338 Bacteria 6535
26 Ga0068868_100024545 3300005338 Bacteria 4576
27 Ga0068868_100032002 3300005338 Bacteria 4044
28 Ga0068868_100589555 3300005338 Bacteria 984
29 Ga0070660_100035264 3300005339 Bacteria 3786
30 Ga0070660_100043150 3300005339 Bacteria 3445
31 Ga0070687_100016323 3300005343 Bacteria 3384
32 Ga0070661_100070279 3300005344 Bacteria 2574
33 Ga0070661_100287211 3300005344 Bacteria 1277
34 Ga0070668_100039919 3300005347 Bacteria 3590
35 Ga0070668_100054107 3300005347 Bacteria 3095
36 Ga0070669_100002239 3300005353 Bacteria 14013
37 Ga0070669_100118282 3300005353 Bacteria 2018
38 Ga0070669_100123556 3300005353 Bacteria 1978
39 Ga0070675_100004844 3300005354 Bacteria 10268
40 Ga0070675_100007869 3300005354 Bacteria 8260
41 Ga0070675_100018789 3300005354 Bacteria 5502
42 Ga0070675_100048896 3300005354 Bacteria 3469
43 Ga0070675_100060157 3300005354 Bacteria 3136
44 Ga0070675_100066270 3300005354 Bacteria 2986
45 Ga0070675_100410149 3300005354 Bacteria 1210
46 Ga0070671_100016824 3300005355 Bacteria 5913
47 Ga0070671_100039450 3300005355 Bacteria 3920
48 Ga0070671_100093670 3300005355 Bacteria 2517
49 Ga0070671_100097856 3300005355 Bacteria 2461
50 Ga0070671_100104539 3300005355 Bacteria 2376
51 Ga0070671_100128946 3300005355 Bacteria 2130
52 Ga0070671_100164312 3300005355 Bacteria 1877
53 Ga0070671_100188831 3300005355 Bacteria 1746
54 Ga0070671_100444901 3300005355 Bacteria 1111
55 Ga0070674_100005056 3300005356 Bacteria 7582
56 Ga0070674_100131388 3300005356 Bacteria 1867
57 Ga0070674_100239980 3300005356 Bacteria 1418
58 Ga0070674_100612879 3300005356 Bacteria 921
59 Ga0070673_100002462 3300005364 Bacteria 11291
60 Ga0070673_100051599 3300005364 Bacteria 3223
61 Ga0070673_100118955 3300005364 Bacteria 2200
62 Ga0070673_100119106 3300005364 Bacteria 2199
63 Ga0070673_100306519 3300005364 Bacteria 1399
64 Ga0070659_100041489 3300005366 Bacteria 3597
65 Ga0070659_100042174 3300005366 Bacteria 3567
66 Ga0070659_100469234 3300005366 Bacteria 1070
67 Ga0070667_100006464 3300005367 Bacteria 9745
68 Ga0070667_100085199 3300005367 Bacteria 2710
69 Ga0070667_100099211 3300005367 Bacteria 2514
70 Ga0070667_100103280 3300005367 Bacteria 2464
71 Ga0070667_100123450 3300005367 Bacteria 2254
72 Ga0070667_100580870 3300005367 Bacteria 1031
73 Ga0070667_100902411 3300005367 Bacteria 823
74 Ga0070700_100089968 3300005441 Bacteria 2001
75 Ga0070663_100276522 3300005455 Bacteria 1337
76 Ga0070678_100032467 3300005456 Bacteria 3614
77 Ga0070678_100064870 3300005456 Bacteria 2709
78 Ga0070678_100124718 3300005456 Bacteria 2036
79 Ga0070678_100136213 3300005456 Bacteria 1958
80 Ga0070678_100200224 3300005456 Bacteria 1648
81 Ga0070678_100201816 3300005456 Bacteria 1642
82 Ga0070678_100236125 3300005456 Bacteria 1526
83 Ga0070678_100855017 3300005456 Bacteria 829
84 Ga0070662_100005139 3300005457 Bacteria 8345
85 Ga0070662_100022984 3300005457 Bacteria 4278
86 Ga0070662_100050816 3300005457 Bacteria 2991
87 Ga0070662_100163207 3300005457 Bacteria 1744
88 Ga0070662_100165856 3300005457 Bacteria 1731
89 Ga0070681_10106867 3300005458 Bacteria 2740
90 Ga0068867_100002576 3300005459 Bacteria 12780
91 Ga0068867_100328398 3300005459 Bacteria 1269
92 Ga0068867_100502936 3300005459 Bacteria 1042
93 Ga0070685_10023445 3300005466 Bacteria 3380
94 Ga0070679_100019960 3300005530 Bacteria 6528
95 Ga0070684_100016798 3300005535 Bacteria 5992
96 Ga0068853_100075065 3300005539 Bacteria 2950
97 Ga0070672_100000916 3300005543 Bacteria 17682
98 Ga0070672_100030282 3300005543 Bacteria 4065
99 Ga0070672_100109689 3300005543 Bacteria 2248
100 Ga0070672_100154130 3300005543 Bacteria 1902
101 Ga0070672_100291540 3300005543 Bacteria 1382
102 Ga0070672_100298989 3300005543 Bacteria 1364
103 Ga0070686_100160723 3300005544 Bacteria 1582
104 Ga0070693_100128113 3300005547 Bacteria 1583
105 Ga0070693_100137358 3300005547 Bacteria 1535
106 Ga0068855_100008017 3300005563 Bacteria 12759
107 Ga0070664_100136742 3300005564 Bacteria 2155
108 Ga0070664_100219045 3300005564 Bacteria 1702
109 Ga0070664_100262913 3300005564 Bacteria 1553
110 Ga0070702_100055234 3300005615 Bacteria 2289
111 Ga0068852_100040508 3300005616 Bacteria 3931
112 Ga0068852_100044841 3300005616 Bacteria 3759
113 Ga0068852_100116893 3300005616 Bacteria 2434
114 Ga0068852_100175400 3300005616 Bacteria 2012
115 Ga0068852_100313965 3300005616 Bacteria 1520
116 Ga0068859_100040581 3300005617 Bacteria 4671
117 Ga0068859_100123917 3300005617 Bacteria 2652
118 Ga0068859_100240143 3300005617 Bacteria 1901
119 Ga0068864_100002922 3300005618 Bacteria 14130
120 Ga0068864_100030463 3300005618 Bacteria 4573
121 Ga0068864_100030475 3300005618 Bacteria 4572
122 Ga0068864_100420985 3300005618 Bacteria 1273
123 Ga0068866_10002226 3300005718 Bacteria 8042
124 Ga0068861_100000440 3300005719 Bacteria 24159
125 Ga0068861_100004200 3300005719 Bacteria 9660
126 Ga0068861_100190139 3300005719 Bacteria 1715
127 Ga0068861_100806197 3300005719 Bacteria 882
128 Ga0068851_10028043 3300005834 Bacteria 2779
129 Ga0068870_10258648 3300005840 Bacteria 1082
130 Ga0068870_10466867 3300005840 Bacteria 835
131 Ga0068863_100003278 3300005841 Bacteria 15982
132 Ga0068863_100007276 3300005841 Bacteria 10843
133 Ga0068863_100332178 3300005841 Bacteria 1478
134 Ga0068863_100944260 3300005841 Bacteria 864
135 Ga0068858_100004599 3300005842 Bacteria 13508
136 Ga0068858_100024257 3300005842 Bacteria 5652
137 Ga0068858_100025524 3300005842 Bacteria 5498
138 Ga0068860_100012522 3300005843 Bacteria 8351
139 Ga0068860_100238385 3300005843 Bacteria 1769
140 Ga0068862_100026533 3300005844 Bacteria 4869
141 Ga0068862_100053697 3300005844 Bacteria 3449
142 Ga0068862_100693521 3300005844 Bacteria 986
143 Ga0068862_100844051 3300005844 Bacteria 897
144 Ga0070716_100193027 3300006173 Bacteria 1347
145 Ga0097621_100002381 3300006237 Bacteria 12890
146 Ga0097621_100106432 3300006237 Bacteria 2366
147 Ga0097621_100148365 3300006237 Bacteria 2010
148 Ga0097621_100492271 3300006237 Bacteria 1110
149 Ga0068871_100016363 3300006358 Bacteria 5584
150 Ga0068871_100040495 3300006358 Bacteria 3732
151 Ga0068871_100211263 3300006358 Bacteria 1678
152 Ga0068871_100363866 3300006358 Bacteria 1282
153 Ga0068871_100401448 3300006358 Bacteria 1221
154 Ga0075434_100675546 3300006871 Bacteria 1051
155 Ga0068865_100005036 3300006881 Bacteria 7995
156 Ga0068865_100339923 3300006881 Bacteria 1213
157 Ga0097620_100040580 3300006931 Bacteria 4671
158 Ga0097620_100123917 3300006931 Bacteria 2652
159 Ga0097620_100240142 3300006931 Bacteria 1901
160 Ga0111539_10401006 3300009094 Bacteria 1597
161 Ga0105245_10087650 3300009098 Bacteria 2857
162 Ga0105243_10019186 3300009148 Bacteria 5185
163 Ga0105242_10537688 3300009176 Bacteria 1118
164 Ga0105248_10022187 3300009177 Bacteria 7038
165 Ga0105248_10026657 3300009177 Bacteria 6426
166 Ga0105248_10085851 3300009177 Bacteria 3541
167 Ga0105248_10197915 3300009177 Bacteria 2264
168 Ga0105248_10422947 3300009177 Bacteria 1500
169 Ga0105248_10823580 3300009177 Bacteria 1048
170 Ga0105238_10133281 3300009551 Bacteria 2463
171 Ga0105238_10149995 3300009551 Bacteria 2307
172 Ga0105249_10050085 3300009553 Bacteria 3809
173 Ga0105249_10116842 3300009553 Bacteria 2529
174 Ga0105249_10181441 3300009553 Bacteria 2048
175 Ga0105249_10713164 3300009553 Bacteria 1064
176 Ga0157326_1007880 3300012513 Bacteria 1156
177 Ga0157371_10282269 3300013102 Bacteria 1200
178 Ga0157369_10672037 3300013105 Bacteria 1067
179 Ga0157369_10719138 3300013105 Bacteria 1028
180 Ga0157374_10025027 3300013296 Bacteria 5355
181 Ga0157374_10135356 3300013296 Bacteria 2388
182 Ga0157378_10313496 3300013297 Bacteria 1522
183 Ga0163162_10006628 3300013306 Bacteria 11223
184 Ga0163162_10090410 3300013306 Bacteria 3143
185 Ga0163162_10160787 3300013306 Bacteria 2367
186 Ga0163162_10167166 3300013306 Bacteria 2323
187 Ga0157372_10126678 3300013307 Bacteria 2936
188 Ga0157372_10155072 3300013307 Bacteria 2645
189 Ga0157372_10236538 3300013307 Bacteria 2119
190 Ga0157372_10722769 3300013307 Bacteria 1158
191 Ga0157375_10002901 3300013308 Bacteria 14859
192 Ga0157375_10003893 3300013308 Bacteria 12950
193 Ga0157375_10033097 3300013308 Bacteria 4909
194 Ga0157375_10118835 3300013308 Bacteria 2750
195 Ga0157375_10128246 3300013308 Bacteria 2654
196 Ga0157375_10323599 3300013308 Bacteria 1706
197 Ga0157375_10476039 3300013308 Bacteria 1414
198 Ga0157375_10588304 3300013308 Bacteria 1273
199 Ga0163163_10056676 3300014325 Bacteria 3873
200 Ga0163163_10134346 3300014325 Bacteria 2514
201 Ga0163163_10198758 3300014325 Bacteria 2053
202 Ga0163163_10725375 3300014325 Bacteria 1057
203 Ga0157380_10003957 3300014326 Bacteria 10229
204 Ga0157380_10260783 3300014326 Bacteria 1574
205 Ga0157377_10002982 3300014745 Bacteria 7578
206 Ga0157379_10003009 3300014968 Bacteria 14230
207 Ga0157379_10003329 3300014968 Bacteria 13618
208 Ga0157379_10004534 3300014968 Bacteria 11914
209 Ga0157379_10028360 3300014968 Bacteria 4980
210 Ga0157379_10496448 3300014968 Bacteria 1131
211 Ga0157376_10004959 3300014969 Bacteria 9281
212 Ga0157376_11100510 3300014969 Bacteria 820
213 Ga0163161_10024998 3300017792 Bacteria 4223
214 Ga0163161_10076704 3300017792 Bacteria 2454
215 Ga0163161_10084192 3300017792 Bacteria 2345
216 Ga0163161_10453992 3300017792 Bacteria 1036
217 Ga0209025_1023375 3300025294 Bacteria 3233
218 Ga0209564_1001658 3300025295 Bacteria 21401
219 Ga0207656_10136917 3300025321 Bacteria 1151
220 Ga0207656_10152166 3300025321 Bacteria 1096
221 Ga0207682_10072580 3300025893 Bacteria 1461
222 Ga0207642_10001920 3300025899 Bacteria 6411
223 Ga0207688_10010433 3300025901 Bacteria 5057
224 Ga0207688_10242500 3300025901 Bacteria 1090
225 Ga0207680_10004452 3300025903 Bacteria 6647
226 Ga0207680_10030064 3300025903 Bacteria 3059
227 Ga0207680_10099700 3300025903 Bacteria 1864
228 Ga0207680_10163789 3300025903 Bacteria 1493
229 Ga0207680_10388760 3300025903 Bacteria 985
230 Ga0207645_10022454 3300025907 Bacteria 4105
231 Ga0207645_10094471 3300025907 Bacteria 1924
232 Ga0207645_10129510 3300025907 Bacteria 1642
233 Ga0207645_10254436 3300025907 Bacteria 1162
234 Ga0207645_10360519 3300025907 Bacteria 974
235 Ga0207643_10242055 3300025908 Bacteria 1109
236 Ga0207705_10405402 3300025909 Bacteria 1055
237 Ga0207707_10232594 3300025912 Bacteria 1603
238 Ga0207660_10020382 3300025917 Bacteria 4448
239 Ga0207660_10264893 3300025917 Bacteria 1360
240 Ga0207662_10075279 3300025918 Bacteria 2051
241 Ga0207657_10118120 3300025919 Bacteria 2183
242 Ga0207657_10159330 3300025919 Bacteria 1834
243 Ga0207657_10308450 3300025919 Bacteria 1253
244 Ga0207657_10450748 3300025919 Bacteria 1009
245 Ga0207649_10002109 3300025920 Bacteria 11282
246 Ga0207649_10280902 3300025920 Bacteria 1210
247 Ga0207652_10015845 3300025921 Bacteria 6143
248 Ga0207681_10006711 3300025923 Bacteria 7061
249 Ga0207681_10030261 3300025923 Bacteria 3528
250 Ga0207681_10044288 3300025923 Bacteria 2982
251 Ga0207681_10097909 3300025923 Bacteria 2109
252 Ga0207694_10022120 3300025924 Bacteria 4821
253 Ga0207694_10127138 3300025924 Bacteria 2040
254 Ga0207650_10003058 3300025925 Bacteria 11527
255 Ga0207650_10056491 3300025925 Bacteria 2917
256 Ga0207650_10099358 3300025925 Bacteria 2237
257 Ga0207650_10195703 3300025925 Bacteria 1617
258 Ga0207650_10201841 3300025925 Bacteria 1593
259 Ga0207650_10371576 3300025925 Bacteria 1180
260 Ga0207659_10002916 3300025926 Bacteria 10188
261 Ga0207659_10022044 3300025926 Bacteria 4238
262 Ga0207659_10048115 3300025926 Bacteria 3020
263 Ga0207659_10063754 3300025926 Bacteria 2665
264 Ga0207659_10106106 3300025926 Bacteria 2127
265 Ga0207659_10223965 3300025926 Bacteria 1514
266 Ga0207687_10093565 3300025927 Bacteria 2198
267 Ga0207644_10003073 3300025931 Bacteria 10751
268 Ga0207644_10004154 3300025931 Bacteria 9392
269 Ga0207644_10025171 3300025931 Bacteria 4091
270 Ga0207644_10125410 3300025931 Bacteria 1959
271 Ga0207644_10240826 3300025931 Bacteria 1440
272 Ga0207644_10541653 3300025931 Bacteria 963
273 Ga0207690_10117599 3300025932 Bacteria 1925
274 Ga0207706_10005107 3300025933 Bacteria 12256
275 Ga0207706_10053548 3300025933 Bacteria 3562
276 Ga0207706_10142941 3300025933 Bacteria 2105
277 Ga0207706_10148678 3300025933 Bacteria 2061
278 Ga0207706_10183236 3300025933 Bacteria 1839
279 Ga0207706_10225040 3300025933 Bacteria 1642
280 Ga0207686_10006046 3300025934 Bacteria 6498
281 Ga0207686_10128196 3300025934 Bacteria 1737
282 Ga0207709_10115718 3300025935 Bacteria 1802
283 Ga0207669_10001759 3300025937 Bacteria 9193
284 Ga0207669_10083704 3300025937 Bacteria 2053
285 Ga0207669_10159235 3300025937 Bacteria 1592
286 Ga0207704_10004132 3300025938 Bacteria 6618
287 Ga0207704_10094121 3300025938 Bacteria 1977
288 Ga0207704_10304714 3300025938 Bacteria 1222
289 Ga0207704_10730316 3300025938 Bacteria 822
290 Ga0207665_10070557 3300025939 Bacteria 2384
291 Ga0207691_10000873 3300025940 Bacteria 30010
292 Ga0207691_10009179 3300025940 Bacteria 9491
293 Ga0207691_10037546 3300025940 Bacteria 4486
294 Ga0207691_10063558 3300025940 Bacteria 3347
295 Ga0207691_10065039 3300025940 Bacteria 3302
296 Ga0207691_10115673 3300025940 Bacteria 2381
297 Ga0207691_10127233 3300025940 Bacteria 2253
298 Ga0207691_10159940 3300025940 Bacteria 1976
299 Ga0207691_10209164 3300025940 Bacteria 1695
300 Ga0207691_10320948 3300025940 Bacteria 1328
301 Ga0207711_10025119 3300025941 Bacteria 4999
302 Ga0207711_10169247 3300025941 Bacteria 1982
303 Ga0207689_10000150 3300025942 Bacteria 60037
304 Ga0207689_10010223 3300025942 Bacteria 8084
305 Ga0207679_10149072 3300025945 Bacteria 1901
306 Ga0207679_10149487 3300025945 Bacteria 1899
307 Ga0207667_10050849 3300025949 Bacteria 4371
308 Ga0207651_10002504 3300025960 Bacteria 8765
309 Ga0207651_10141987 3300025960 Bacteria 1856
310 Ga0207712_10004896 3300025961 Bacteria 8467
311 Ga0207712_10113244 3300025961 Bacteria 2039
312 Ga0207668_10003068 3300025972 Bacteria 9791
313 Ga0207668_10256351 3300025972 Bacteria 1423
314 Ga0207668_10293756 3300025972 Bacteria 1338
315 Ga0207640_10074897 3300025981 Bacteria 2292
316 Ga0207640_10092438 3300025981 Bacteria 2099
317 Ga0207658_10002384 3300025986 Bacteria 13769
318 Ga0207658_10019265 3300025986 Bacteria 4718
319 Ga0207658_10250108 3300025986 Bacteria 1506
320 Ga0207677_10013608 3300026023 Bacteria 4721
321 Ga0207677_10016970 3300026023 Bacteria 4327
322 Ga0207677_10080531 3300026023 Bacteria 2333
323 Ga0207677_10371286 3300026023 Bacteria 1205
324 Ga0207703_10001756 3300026035 Bacteria 19387
325 Ga0207703_10005091 3300026035 Bacteria 10632
326 Ga0207703_10059185 3300026035 Bacteria 3129
327 Ga0207639_10016829 3300026041 Bacteria 5179
328 Ga0207678_10078826 3300026067 Bacteria 2821
329 Ga0207678_10126415 3300026067 Bacteria 2181
330 Ga0207708_10026840 3300026075 Bacteria 4359
331 Ga0207702_10020221 3300026078 Bacteria 5514
332 Ga0207641_10006917 3300026088 Bacteria 9490
333 Ga0207641_10012983 3300026088 Bacteria 6834
334 Ga0207641_10869787 3300026088 Bacteria 894
335 Ga0207648_10004626 3300026089 Bacteria 14091
336 Ga0207648_10122608 3300026089 Bacteria 2286
337 Ga0207648_10351871 3300026089 Bacteria 1328
338 Ga0207648_10396000 3300026089 Bacteria 1251
339 Ga0207648_10487677 3300026089 Bacteria 1126
340 Ga0207676_10016928 3300026095 Bacteria 5279
341 Ga0207676_10025525 3300026095 Bacteria 4384
342 Ga0207676_10039306 3300026095 Bacteria 3618
343 Ga0207676_10101921 3300026095 Bacteria 2381
344 Ga0207676_10284424 3300026095 Bacteria 1503
345 Ga0207674_10077783 3300026116 Bacteria 3323
346 Ga0207675_100001131 3300026118 Bacteria 26465
347 Ga0207675_100008626 3300026118 Bacteria 9586
348 Ga0207675_100124267 3300026118 Bacteria 2443
349 Ga0207675_100250477 3300026118 Bacteria 1714
350 Ga0207675_100489635 3300026118 Bacteria 1223
351 Ga0207683_10006338 3300026121 Bacteria 10133
352 Ga0207683_10051801 3300026121 Bacteria 3596
353 Ga0207683_10115861 3300026121 Bacteria 2402
354 Ga0207683_10151481 3300026121 Bacteria 2093
355 Ga0207683_10156051 3300026121 Bacteria 2061
356 Ga0207683_10179522 3300026121 Bacteria 1919
357 Ga0207683_10202229 3300026121 Bacteria 1806
358 Ga0207683_10341494 3300026121 Bacteria 1373
359 Ga0207683_10415770 3300026121 Bacteria 1238
360 Ga0207683_10811937 3300026121 Bacteria 868
361 Ga0207698_10011455 3300026142 Bacteria 5752
362 Ga0207698_10043817 3300026142 Bacteria 3356
363 Ga0207698_10106789 3300026142 Bacteria 2336
364 Ga0207698_10203614 3300026142 Bacteria 1774
365 Ga0207698_10754934 3300026142 Bacteria 972
366 Ga0209974_10012928 3300027876 Bacteria 2786
367 Ga0268266_10169798 3300028379 Bacteria 1979
368 Ga0268266_10303270 3300028379 Bacteria 1491
369 Ga0268265_10010223 3300028380 Bacteria 6336
370 Ga0268265_10207961 3300028380 Bacteria 1703
371 Ga0268265_10510634 3300028380 Bacteria 1134
372 Ga0268264_10006491 3300028381 Bacteria 9848
373 Ga0268264_10086507 3300028381 Bacteria 2693
374 Ga0268264_10472517 3300028381 Bacteria 1218
375 Ga0307408_100000008 3300031548 Bacteria 456355
376 Ga0307408_100036908 3300031548 Bacteria 3439
377 Ga0307410_10647422 3300031852 Bacteria 886
378 Ga0307407_10416489 3300031903 Bacteria 967
379 Ga0307409_100000230 3300031995 Bacteria 22510
380 Ga0307409_100438531 3300031995 Bacteria 1258
381 Ga0307416_100009392 3300032002 Bacteria 6398
382 Ga0307415_100001495 3300032126 Bacteria 11211
383 Ga0373928_0010600 3300035084 Bacteria 1813
384 Ga0373929_0029115 3300035085 Bacteria 1170
385 Ga0373944_0024307 3300035089 Bacteria 1775
386 Ga0373945_0057418 3300035116 Bacteria 1446
387 Ga0373957_0201610 3300035120 Bacteria 829
388 Ga0373924_0049936 3300035410 Bacteria 1732
389 Ga0395899_0116229 3300037312 Bacteria 1919
390 Ga0395900_0059792 3300037418 Bacteria 3922
391 Ga0395900_0149391 3300037418 Bacteria 2388
392 Ga0395898_0012236 3300037466 Bacteria 8870
393 Ga0395898_0297426 3300037466 Bacteria 1540
394 Ga0395898_0330124 3300037466 Bacteria 1454
395 Ga0395905_0088314 3300037471 Bacteria 2906
396 Ga0395905_0114512 3300037471 Bacteria 2533
397 Ga0395901_0014845 3300038443 Bacteria 7913
398 Ga0395901_0489644 3300038443 Bacteria 1253
399 Ga0436365_0508742 3300039437 Bacteria 8552
400 Ga0436363_0641504 3300039450 Bacteria 1942
401 Ga0439439_0001426 3300041406 Bacteria 4753
402 Ga0439447_011756 3300041407 Bacteria 2538
403 Ga0439431_0013030 3300041997 Bacteria 1916
404 Ga0439449_0002277 3300042007 Bacteria 7535
405 Ga0439450_036630 3300042008 Bacteria 1124
406 Ga0439462_0044044 3300042015 Bacteria 1193
407 Ga0450911_000114 3300042115 Bacteria 33166
408 Ga0450888_000217 3300042126 Bacteria 5174
409 Ga0450890_000962 3300042127 Bacteria 4180
410 Ga0450890_027148 3300042127 Bacteria 800
411 Ga0450891_000465 3300042129 Bacteria 4240
412 Ga0450892_000306 3300042130 Bacteria 5769
413 Ga0450902_012033 3300042137 Bacteria 1382
414 Ga0450889_006361 3300042144 Bacteria 1185
415 Ga0439446_0010342 3300042156 Bacteria 2511
416 Ga0439434_0110687 3300042435 Bacteria 889
417 Ga0439464_0002879 3300042439 Bacteria 4281
418 Ga0439464_0050617 3300042439 Bacteria 1200
419 Ga0439460_0038937 3300042461 Bacteria 1388
420 Ga0450893_0001004 3300042532 Bacteria 4230
421 Ga0466961_0099391 3300044693 Bacteria 1834
422 Ga0466971_0098303 3300044719 Bacteria 1344
423 Ga0466957_0305906 3300044842 Bacteria 1069
424 Ga0466959_0185886 3300045049 Bacteria 1452
425 Ga0466959_0242629 3300045049 Bacteria 1244
426 Ga0451576_0025071 3300045051 Bacteria 6430
427 Ga0451576_0212260 3300045051 Bacteria 2021
428 Ga0466958_0177730 3300045836 Bacteria 1350
429 Ga0495639_0189139 3300046475 Bacteria 1005
430 Ga0495652_0299469 3300046529 Bacteria 1170
431 Ga0495598_0127440 3300046537 Bacteria 869
432 Ga0495621_0001548 3300046539 Bacteria 5990
433 Ga0495621_0248136 3300046539 Bacteria 727
434 Ga0495645_0035093 3300046543 Bacteria 3657
435 Ga0495633_0001059 3300046558 Bacteria 22382
436 Ga0495658_0055262 3300046683 Bacteria 2261
437 Ga0495658_0181615 3300046683 Bacteria 1306
438 Ga0496104_0426431 3300048907 Bacteria 1238
439 Ga0496105_0509164 3300048908 Bacteria 944
440 Ga0496106_0002868 3300048909 Bacteria 12806
441 Ga0496107_0020480 3300048910 Bacteria 4672
442 Ga0496108_0424209 3300048911 Bacteria 1162
443 Ga0496108_0588308 3300048911 Bacteria 970
444 Ga0496109_0165831 3300048912 Bacteria 2070
445 Ga0496110_0041505 3300048913 Bacteria 4015
446 Ga0496114_0096098 3300048917 Bacteria 2522
447 Ga0496114_0115730 3300048917 Bacteria 2301
448 Ga0496121_0000761 3300048924 Bacteria 59223
449 Ga0496122_0108806 3300048925 Bacteria 1827
450 Ga0496124_0164856 3300048927 Bacteria 1723
451 Ga0496125_0046754 3300048928 Bacteria 3627
452 Ga0496125_0241204 3300048928 Bacteria 1147
453 Ga0496125_0266476 3300048928 Bacteria 1070
454 Ga0496125_0282407 3300048928 Bacteria 1027
455 Ga0501298_009113 3300049521 Bacteria 1682
456 Ga0501222_007735 3300049662 Bacteria 1434
457 Ga0501265_002521 3300049762 Bacteria 2080
458 Ga0501281_00645 3300049777 Bacteria 3071
459 nmdc:mga0n895_456152_c1 3300050512 Bacteria 1290
460 Ga0495601_0302860 3300053077 Bacteria 1041

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005355 Ga0070671_100128946 Ga0070671_1001289462 190
2 3300013105 Ga0157369_10672037 Ga0157369_106720371 205
3 3300026121 Ga0207683_10811937 Ga0207683_108119371 206
4 3300025901 Ga0207688_10242500 Ga0207688_102425001 209
5 3300039437 Ga0436365_0508742 Ga0436365_0508742_885_1547 209
6 3300031548 Ga0307408_100000008 Ga0307408_100000008411 214
7 3300005333 Ga0070677_10006985 Ga0070677_100069854 215
8 3300005353 Ga0070669_100123556 Ga0070669_1001235562 215
9 3300005356 Ga0070674_100612879 Ga0070674_1006128792 215
10 3300005364 Ga0070673_100051599 Ga0070673_1000515994 215
11 3300005367 Ga0070667_100099211 Ga0070667_1000992112 215
12 3300005456 Ga0070678_100855017 Ga0070678_1008550171 215
13 3300005543 Ga0070672_100109689 Ga0070672_1001096892 215
14 3300005844 Ga0068862_100844051 Ga0068862_1008440511 215
15 3300009553 Ga0105249_10181441 Ga0105249_101814412 215
16 3300025923 Ga0207681_10030261 Ga0207681_100302613 215
17 3300025937 Ga0207669_10083704 Ga0207669_100837042 215
18 3300025940 Ga0207691_10065039 Ga0207691_100650392 215
19 3300046537 Ga0495598_0127440 Ga0495598_0127440_72_767 215
20 3300046539 Ga0495621_0001548 Ga0495621_0001548_3865_4560 215
21 iso_pu_bacteria 2511231002 2511246937 216
22 3300037312 Ga0395899_0116229 Ga0395899_0116229_923_1579 218
23 3300037418 Ga0395900_0059792 Ga0395900_0059792_2583_3239 218
24 3300037418 Ga0395900_0149391 Ga0395900_0149391_1110_1766 218
25 3300037466 Ga0395898_0012236 Ga0395898_0012236_635_1291 218
26 3300037466 Ga0395898_0330124 Ga0395898_0330124_164_820 218
27 3300037471 Ga0395905_0114512 Ga0395905_0114512_252_929 218
28 3300038443 Ga0395901_0014845 Ga0395901_0014845_643_1299 218
29 3300044842 Ga0466957_0305906 Ga0466957_0305906_342_998 218
30 3300045049 Ga0466959_0185886 Ga0466959_0185886_643_1299 218
31 3300005333 Ga0070677_10030593 Ga0070677_100305932 219
32 3300005334 Ga0068869_100000464 Ga0068869_1000004642 219
33 3300005338 Ga0068868_100024545 Ga0068868_1000245452 219
34 3300005339 Ga0070660_100035264 Ga0070660_1000352643 219
35 3300005339 Ga0070660_100043150 Ga0070660_1000431503 219
36 3300005344 Ga0070661_100070279 Ga0070661_1000702792 219
37 3300005344 Ga0070661_100287211 Ga0070661_1002872111 219
38 3300005353 Ga0070669_100118282 Ga0070669_1001182822 219
39 3300005354 Ga0070675_100066270 Ga0070675_1000662702 219
40 3300005355 Ga0070671_100093670 Ga0070671_1000936704 219
41 3300005355 Ga0070671_100188831 Ga0070671_1001888312 219
42 3300005366 Ga0070659_100041489 Ga0070659_1000414893 219
43 3300005366 Ga0070659_100042174 Ga0070659_1000421743 219
44 3300005366 Ga0070659_100469234 Ga0070659_1004692342 219
45 3300005367 Ga0070667_100085199 Ga0070667_1000851992 219
46 3300005367 Ga0070667_100103280 Ga0070667_1001032803 219
47 3300005457 Ga0070662_100022984 Ga0070662_1000229843 219
48 3300005459 Ga0068867_100502936 Ga0068867_1005029362 219
49 3300005539 Ga0068853_100075065 Ga0068853_1000750653 219
50 3300005543 Ga0070672_100154130 Ga0070672_1001541301 219
51 3300005543 Ga0070672_100298989 Ga0070672_1002989892 219
52 3300005547 Ga0070693_100137358 Ga0070693_1001373582 219
53 3300005563 Ga0068855_100008017 Ga0068855_1000080179 219
54 3300005564 Ga0070664_100136742 Ga0070664_1001367422 219
55 3300005615 Ga0070702_100055234 Ga0070702_1000552343 219
56 3300005616 Ga0068852_100040508 Ga0068852_1000405083 219
57 3300005616 Ga0068852_100044841 Ga0068852_1000448413 219
58 3300005617 Ga0068859_100123917 Ga0068859_1001239174 219
59 3300005618 Ga0068864_100030475 Ga0068864_1000304753 219
60 3300005719 Ga0068861_100000440 Ga0068861_10000044014 219
61 3300005841 Ga0068863_100944260 Ga0068863_1009442601 219
62 3300005842 Ga0068858_100024257 Ga0068858_1000242571 219
63 3300005842 Ga0068858_100025524 Ga0068858_1000255244 219
64 3300005843 Ga0068860_100238385 Ga0068860_1002383852 219
65 3300005844 Ga0068862_100693521 Ga0068862_1006935212 219
66 3300006237 Ga0097621_100002381 Ga0097621_1000023812 219
67 3300006358 Ga0068871_100016363 Ga0068871_1000163636 219
68 3300006871 Ga0075434_100675546 Ga0075434_1006755462 219
69 3300006881 Ga0068865_100339923 Ga0068865_1003399232 219
70 3300006931 Ga0097620_100123917 Ga0097620_1001239174 219
71 3300009177 Ga0105248_10022187 Ga0105248_100221873 219
72 3300009551 Ga0105238_10133281 Ga0105238_101332813 219
73 3300009551 Ga0105238_10149995 Ga0105238_101499952 219
74 3300013102 Ga0157371_10282269 Ga0157371_102822692 219
75 3300013296 Ga0157374_10135356 Ga0157374_101353562 219
76 3300013307 Ga0157372_10126678 Ga0157372_101266782 219
77 3300013307 Ga0157372_10236538 Ga0157372_102365382 219
78 3300013308 Ga0157375_10128246 Ga0157375_101282463 219
79 3300013308 Ga0157375_10588304 Ga0157375_105883042 219
80 3300014745 Ga0157377_10002982 Ga0157377_100029826 219
81 3300014968 Ga0157379_10003329 Ga0157379_100033292 219
82 3300014968 Ga0157379_10004534 Ga0157379_1000453410 219
83 3300017792 Ga0163161_10024998 Ga0163161_100249984 219
84 3300025893 Ga0207682_10072580 Ga0207682_100725802 219
85 3300025901 Ga0207688_10010433 Ga0207688_100104332 219
86 3300025903 Ga0207680_10163789 Ga0207680_101637892 219
87 3300025907 Ga0207645_10022454 Ga0207645_100224544 219
88 3300025918 Ga0207662_10075279 Ga0207662_100752792 219
89 3300025919 Ga0207657_10118120 Ga0207657_101181202 219
90 3300025919 Ga0207657_10159330 Ga0207657_101593302 219
91 3300025920 Ga0207649_10002109 Ga0207649_100021093 219
92 3300025920 Ga0207649_10280902 Ga0207649_102809022 219
93 3300025923 Ga0207681_10044288 Ga0207681_100442884 219
94 3300025924 Ga0207694_10022120 Ga0207694_100221206 219
95 3300025924 Ga0207694_10127138 Ga0207694_101271381 219
96 3300025926 Ga0207659_10048115 Ga0207659_100481152 219
97 3300025927 Ga0207687_10093565 Ga0207687_100935652 219
98 3300025931 Ga0207644_10541653 Ga0207644_105416531 219
99 3300025932 Ga0207690_10117599 Ga0207690_101175992 219
100 3300025938 Ga0207704_10304714 Ga0207704_103047142 219
101 3300025940 Ga0207691_10127233 Ga0207691_101272332 219
102 3300025941 Ga0207711_10025119 Ga0207711_100251196 219
103 3300025942 Ga0207689_10000150 Ga0207689_1000015026 219
104 3300025949 Ga0207667_10050849 Ga0207667_100508492 219
105 3300025972 Ga0207668_10293756 Ga0207668_102937562 219
106 3300025981 Ga0207640_10092438 Ga0207640_100924383 219
107 3300026023 Ga0207677_10013608 Ga0207677_100136082 219
108 3300026035 Ga0207703_10059185 Ga0207703_100591852 219
109 3300026041 Ga0207639_10016829 Ga0207639_100168296 219
110 3300026078 Ga0207702_10020221 Ga0207702_100202212 219
111 3300026089 Ga0207648_10396000 Ga0207648_103960003 219
112 3300026095 Ga0207676_10284424 Ga0207676_102844242 219
113 3300026116 Ga0207674_10077783 Ga0207674_100777833 219
114 3300026118 Ga0207675_100001131 Ga0207675_1000011313 219
115 3300026142 Ga0207698_10011455 Ga0207698_100114557 219
116 3300026142 Ga0207698_10106789 Ga0207698_101067893 219
117 3300028380 Ga0268265_10510634 Ga0268265_105106342 219
118 3300028381 Ga0268264_10086507 Ga0268264_100865072 219
119 3300028381 Ga0268264_10472517 Ga0268264_104725172 219
120 3300035084 Ga0373928_0010600 Ga0373928_0010600_370_1032 219
121 3300035085 Ga0373929_0029115 Ga0373929_0029115_148_810 219
122 3300037466 Ga0395898_0297426 Ga0395898_0297426_456_1115 219
123 3300038443 Ga0395901_0489644 Ga0395901_0489644_57_716 219
124 3300039450 Ga0436363_0641504 Ga0436363_0641504_1164_1826 219
125 3300045049 Ga0466959_0242629 Ga0466959_0242629_271_930 219
126 3300045051 Ga0451576_0212260 Ga0451576_0212260_1231_1890 219
127 3300048907 Ga0496104_0426431 Ga0496104_0426431_282_944 219
128 3300048909 Ga0496106_0002868 Ga0496106_0002868_11992_12654 219
129 3300048910 Ga0496107_0020480 Ga0496107_0020480_2613_3275 219
130 3300048913 Ga0496110_0041505 Ga0496110_0041505_2958_3620 219
131 3300048917 Ga0496114_0115730 Ga0496114_0115730_547_1209 219
132 3300050512 nmdc:mga0n895_456152_c1 nmdc:mga0n895_456152_c1_227_889 219
133 3300005327 Ga0070658_10132230 Ga0070658_101322302 220
134 3300005328 Ga0070676_10042231 Ga0070676_100422314 220
135 3300005330 Ga0070690_100007548 Ga0070690_1000075483 220
136 3300005331 Ga0070670_100007455 Ga0070670_1000074559 220
137 3300005331 Ga0070670_100021864 Ga0070670_1000218645 220
138 3300005331 Ga0070670_100025286 Ga0070670_1000252862 220
139 3300005331 Ga0070670_100041140 Ga0070670_1000411403 220
140 3300005331 Ga0070670_100052768 Ga0070670_1000527682 220
141 3300005331 Ga0070670_100119759 Ga0070670_1001197593 220
142 3300005331 Ga0070670_100137641 Ga0070670_1001376413 220
143 3300005333 Ga0070677_10011779 Ga0070677_100117794 220
144 3300005333 Ga0070677_10182910 Ga0070677_101829102 220
145 3300005334 Ga0068869_100009432 Ga0068869_1000094325 220
146 3300005335 Ga0070666_10022466 Ga0070666_100224664 220
147 3300005335 Ga0070666_10027084 Ga0070666_100270843 220
148 3300005335 Ga0070666_10055390 Ga0070666_100553903 220
149 3300005336 Ga0070680_100033470 Ga0070680_1000334703 220
150 3300005338 Ga0068868_100011181 Ga0068868_1000111814 220
151 3300005338 Ga0068868_100032002 Ga0068868_1000320022 220
152 3300005338 Ga0068868_100589555 Ga0068868_1005895551 220
153 3300005343 Ga0070687_100016323 Ga0070687_1000163233 220
154 3300005347 Ga0070668_100039919 Ga0070668_1000399194 220
155 3300005347 Ga0070668_100054107 Ga0070668_1000541074 220
156 3300005353 Ga0070669_100002239 Ga0070669_1000022395 220
157 3300005354 Ga0070675_100004844 Ga0070675_1000048444 220
158 3300005354 Ga0070675_100007869 Ga0070675_1000078695 220
159 3300005354 Ga0070675_100018789 Ga0070675_1000187894 220
160 3300005354 Ga0070675_100048896 Ga0070675_1000488963 220
161 3300005355 Ga0070671_100016824 Ga0070671_1000168244 220
162 3300005355 Ga0070671_100039450 Ga0070671_1000394505 220
163 3300005355 Ga0070671_100097856 Ga0070671_1000978562 220
164 3300005355 Ga0070671_100104539 Ga0070671_1001045391 220
165 3300005355 Ga0070671_100164312 Ga0070671_1001643122 220
166 3300005355 Ga0070671_100444901 Ga0070671_1004449012 220
167 3300005356 Ga0070674_100005056 Ga0070674_1000050566 220
168 3300005356 Ga0070674_100239980 Ga0070674_1002399802 220
169 3300005364 Ga0070673_100002462 Ga0070673_1000024627 220
170 3300005364 Ga0070673_100119106 Ga0070673_1001191062 220
171 3300005364 Ga0070673_100306519 Ga0070673_1003065192 220
172 3300005367 Ga0070667_100006464 Ga0070667_1000064643 220
173 3300005367 Ga0070667_100123450 Ga0070667_1001234503 220
174 3300005367 Ga0070667_100580870 Ga0070667_1005808702 220
175 3300005367 Ga0070667_100902411 Ga0070667_1009024111 220
176 3300005441 Ga0070700_100089968 Ga0070700_1000899683 220
177 3300005455 Ga0070663_100276522 Ga0070663_1002765222 220
178 3300005456 Ga0070678_100032467 Ga0070678_1000324673 220
179 3300005456 Ga0070678_100064870 Ga0070678_1000648703 220
180 3300005456 Ga0070678_100124718 Ga0070678_1001247181 220
181 3300005456 Ga0070678_100136213 Ga0070678_1001362131 220
182 3300005456 Ga0070678_100200224 Ga0070678_1002002242 220
183 3300005456 Ga0070678_100201816 Ga0070678_1002018162 220
184 3300005456 Ga0070678_100236125 Ga0070678_1002361252 220
185 3300005457 Ga0070662_100005139 Ga0070662_1000051395 220
186 3300005457 Ga0070662_100163207 Ga0070662_1001632071 220
187 3300005458 Ga0070681_10106867 Ga0070681_101068672 220
188 3300005459 Ga0068867_100002576 Ga0068867_1000025767 220
189 3300005459 Ga0068867_100328398 Ga0068867_1003283981 220
190 3300005466 Ga0070685_10023445 Ga0070685_100234453 220
191 3300005530 Ga0070679_100019960 Ga0070679_1000199603 220
192 3300005543 Ga0070672_100000916 Ga0070672_10000091611 220
193 3300005543 Ga0070672_100030282 Ga0070672_1000302822 220
194 3300005543 Ga0070672_100291540 Ga0070672_1002915402 220
195 3300005544 Ga0070686_100160723 Ga0070686_1001607232 220
196 3300005547 Ga0070693_100128113 Ga0070693_1001281132 220
197 3300005564 Ga0070664_100219045 Ga0070664_1002190452 220
198 3300005564 Ga0070664_100262913 Ga0070664_1002629132 220
199 3300005616 Ga0068852_100116893 Ga0068852_1001168934 220
200 3300005616 Ga0068852_100175400 Ga0068852_1001754002 220
201 3300005616 Ga0068852_100313965 Ga0068852_1003139652 220
202 3300005617 Ga0068859_100040581 Ga0068859_1000405814 220
203 3300005617 Ga0068859_100240143 Ga0068859_1002401432 220
204 3300005618 Ga0068864_100002922 Ga0068864_1000029222 220
205 3300005618 Ga0068864_100030463 Ga0068864_1000304633 220
206 3300005618 Ga0068864_100420985 Ga0068864_1004209851 220
207 3300005718 Ga0068866_10002226 Ga0068866_100022262 220
208 3300005719 Ga0068861_100004200 Ga0068861_1000042003 220
209 3300005719 Ga0068861_100190139 Ga0068861_1001901392 220
210 3300005719 Ga0068861_100806197 Ga0068861_1008061971 220
211 3300005834 Ga0068851_10028043 Ga0068851_100280432 220
212 3300005840 Ga0068870_10258648 Ga0068870_102586482 220
213 3300005840 Ga0068870_10466867 Ga0068870_104668671 220
214 3300005841 Ga0068863_100003278 Ga0068863_10000327813 220
215 3300005841 Ga0068863_100007276 Ga0068863_1000072765 220
216 3300005841 Ga0068863_100332178 Ga0068863_1003321782 220
217 3300005842 Ga0068858_100004599 Ga0068858_1000045994 220
218 3300005843 Ga0068860_100012522 Ga0068860_1000125225 220
219 3300005844 Ga0068862_100026533 Ga0068862_1000265335 220
220 3300005844 Ga0068862_100053697 Ga0068862_1000536972 220
221 3300006173 Ga0070716_100193027 Ga0070716_1001930272 220
222 3300006237 Ga0097621_100106432 Ga0097621_1001064322 220
223 3300006237 Ga0097621_100148365 Ga0097621_1001483652 220
224 3300006237 Ga0097621_100492271 Ga0097621_1004922712 220
225 3300006358 Ga0068871_100040495 Ga0068871_1000404952 220
226 3300006358 Ga0068871_100211263 Ga0068871_1002112632 220
227 3300006358 Ga0068871_100363866 Ga0068871_1003638662 220
228 3300006358 Ga0068871_100401448 Ga0068871_1004014482 220
229 3300006881 Ga0068865_100005036 Ga0068865_1000050363 220
230 3300006931 Ga0097620_100040580 Ga0097620_1000405804 220
231 3300006931 Ga0097620_100240142 Ga0097620_1002401422 220
232 3300009094 Ga0111539_10401006 Ga0111539_104010062 220
233 3300009098 Ga0105245_10087650 Ga0105245_100876501 220
234 3300009148 Ga0105243_10019186 Ga0105243_100191865 220
235 3300009176 Ga0105242_10537688 Ga0105242_105376882 220
236 3300009177 Ga0105248_10026657 Ga0105248_100266573 220
237 3300009177 Ga0105248_10085851 Ga0105248_100858512 220
238 3300009177 Ga0105248_10197915 Ga0105248_101979151 220
239 3300009177 Ga0105248_10422947 Ga0105248_104229472 220
240 3300009177 Ga0105248_10823580 Ga0105248_108235802 220
241 3300009553 Ga0105249_10050085 Ga0105249_100500853 220
242 3300009553 Ga0105249_10116842 Ga0105249_101168423 220
243 3300009553 Ga0105249_10713164 Ga0105249_107131641 220
244 3300013105 Ga0157369_10719138 Ga0157369_107191381 220
245 3300013296 Ga0157374_10025027 Ga0157374_100250276 220
246 3300013297 Ga0157378_10313496 Ga0157378_103134962 220
247 3300013306 Ga0163162_10006628 Ga0163162_100066285 220
248 3300013306 Ga0163162_10090410 Ga0163162_100904103 220
249 3300013306 Ga0163162_10160787 Ga0163162_101607872 220
250 3300013306 Ga0163162_10167166 Ga0163162_101671662 220
251 3300013307 Ga0157372_10155072 Ga0157372_101550722 220
252 3300013308 Ga0157375_10002901 Ga0157375_100029014 220
253 3300013308 Ga0157375_10003893 Ga0157375_100038936 220
254 3300013308 Ga0157375_10118835 Ga0157375_101188352 220
255 3300013308 Ga0157375_10323599 Ga0157375_103235992 220
256 3300013308 Ga0157375_10476039 Ga0157375_104760391 220
257 3300014325 Ga0163163_10056676 Ga0163163_100566762 220
258 3300014325 Ga0163163_10198758 Ga0163163_101987582 220
259 3300014325 Ga0163163_10725375 Ga0163163_107253752 220
260 3300014326 Ga0157380_10003957 Ga0157380_100039576 220
261 3300014326 Ga0157380_10260783 Ga0157380_102607832 220
262 3300014968 Ga0157379_10003009 Ga0157379_100030095 220
263 3300014968 Ga0157379_10028360 Ga0157379_100283602 220
264 3300014968 Ga0157379_10496448 Ga0157379_104964482 220
265 3300014969 Ga0157376_10004959 Ga0157376_100049596 220
266 3300014969 Ga0157376_11100510 Ga0157376_111005101 220
267 3300017792 Ga0163161_10076704 Ga0163161_100767042 220
268 3300017792 Ga0163161_10084192 Ga0163161_100841922 220
269 3300017792 Ga0163161_10453992 Ga0163161_104539922 220
270 3300025321 Ga0207656_10136917 Ga0207656_101369172 220
271 3300025321 Ga0207656_10152166 Ga0207656_101521662 220
272 3300025899 Ga0207642_10001920 Ga0207642_100019202 220
273 3300025903 Ga0207680_10004452 Ga0207680_100044523 220
274 3300025903 Ga0207680_10030064 Ga0207680_100300642 220
275 3300025903 Ga0207680_10099700 Ga0207680_100997002 220
276 3300025903 Ga0207680_10388760 Ga0207680_103887602 220
277 3300025907 Ga0207645_10094471 Ga0207645_100944712 220
278 3300025907 Ga0207645_10129510 Ga0207645_101295102 220
279 3300025907 Ga0207645_10360519 Ga0207645_103605192 220
280 3300025908 Ga0207643_10242055 Ga0207643_102420552 220
281 3300025909 Ga0207705_10405402 Ga0207705_104054022 220
282 3300025912 Ga0207707_10232594 Ga0207707_102325942 220
283 3300025917 Ga0207660_10020382 Ga0207660_100203824 220
284 3300025919 Ga0207657_10308450 Ga0207657_103084502 220
285 3300025919 Ga0207657_10450748 Ga0207657_104507481 220
286 3300025921 Ga0207652_10015845 Ga0207652_100158455 220
287 3300025923 Ga0207681_10006711 Ga0207681_100067114 220
288 3300025923 Ga0207681_10097909 Ga0207681_100979092 220
289 3300025925 Ga0207650_10003058 Ga0207650_100030589 220
290 3300025925 Ga0207650_10056491 Ga0207650_100564912 220
291 3300025925 Ga0207650_10099358 Ga0207650_100993582 220
292 3300025925 Ga0207650_10371576 Ga0207650_103715762 220
293 3300025926 Ga0207659_10002916 Ga0207659_100029164 220
294 3300025926 Ga0207659_10063754 Ga0207659_100637542 220
295 3300025926 Ga0207659_10106106 Ga0207659_101061062 220
296 3300025931 Ga0207644_10003073 Ga0207644_100030734 220
297 3300025931 Ga0207644_10004154 Ga0207644_100041549 220
298 3300025931 Ga0207644_10025171 Ga0207644_100251715 220
299 3300025931 Ga0207644_10125410 Ga0207644_101254102 220
300 3300025931 Ga0207644_10240826 Ga0207644_102408262 220
301 3300025933 Ga0207706_10005107 Ga0207706_100051076 220
302 3300025933 Ga0207706_10053548 Ga0207706_100535482 220
303 3300025933 Ga0207706_10225040 Ga0207706_102250402 220
304 3300025934 Ga0207686_10006046 Ga0207686_100060463 220
305 3300025934 Ga0207686_10128196 Ga0207686_101281962 220
306 3300025935 Ga0207709_10115718 Ga0207709_101157182 220
307 3300025937 Ga0207669_10001759 Ga0207669_100017593 220
308 3300025938 Ga0207704_10004132 Ga0207704_100041324 220
309 3300025938 Ga0207704_10094121 Ga0207704_100941212 220
310 3300025938 Ga0207704_10730316 Ga0207704_107303161 220
311 3300025939 Ga0207665_10070557 Ga0207665_100705572 220
312 3300025940 Ga0207691_10000873 Ga0207691_1000087319 220
313 3300025940 Ga0207691_10009179 Ga0207691_100091793 220
314 3300025940 Ga0207691_10037546 Ga0207691_100375462 220
315 3300025940 Ga0207691_10115673 Ga0207691_101156732 220
316 3300025940 Ga0207691_10159940 Ga0207691_101599402 220
317 3300025940 Ga0207691_10209164 Ga0207691_102091642 220
318 3300025940 Ga0207691_10320948 Ga0207691_103209482 220
319 3300025941 Ga0207711_10169247 Ga0207711_101692472 220
320 3300025942 Ga0207689_10010223 Ga0207689_100102237 220
321 3300025945 Ga0207679_10149072 Ga0207679_101490722 220
322 3300025945 Ga0207679_10149487 Ga0207679_101494872 220
323 3300025960 Ga0207651_10002504 Ga0207651_100025044 220
324 3300025960 Ga0207651_10141987 Ga0207651_101419872 220
325 3300025961 Ga0207712_10004896 Ga0207712_100048963 220
326 3300025961 Ga0207712_10113244 Ga0207712_101132442 220
327 3300025972 Ga0207668_10003068 Ga0207668_100030684 220
328 3300025972 Ga0207668_10256351 Ga0207668_102563512 220
329 3300025981 Ga0207640_10074897 Ga0207640_100748972 220
330 3300025986 Ga0207658_10002384 Ga0207658_100023847 220
331 3300025986 Ga0207658_10019265 Ga0207658_100192652 220
332 3300025986 Ga0207658_10250108 Ga0207658_102501082 220
333 3300026023 Ga0207677_10016970 Ga0207677_100169703 220
334 3300026023 Ga0207677_10080531 Ga0207677_100805313 220
335 3300026023 Ga0207677_10371286 Ga0207677_103712862 220
336 3300026035 Ga0207703_10001756 Ga0207703_1000175613 220
337 3300026035 Ga0207703_10005091 Ga0207703_100050915 220
338 3300026067 Ga0207678_10078826 Ga0207678_100788263 220
339 3300026067 Ga0207678_10126415 Ga0207678_101264152 220
340 3300026075 Ga0207708_10026840 Ga0207708_100268402 220
341 3300026088 Ga0207641_10006917 Ga0207641_100069173 220
342 3300026088 Ga0207641_10012983 Ga0207641_100129833 220
343 3300026088 Ga0207641_10869787 Ga0207641_108697871 220
344 3300026089 Ga0207648_10004626 Ga0207648_100046267 220
345 3300026089 Ga0207648_10122608 Ga0207648_101226082 220
346 3300026089 Ga0207648_10351871 Ga0207648_103518711 220
347 3300026089 Ga0207648_10487677 Ga0207648_104876772 220
348 3300026095 Ga0207676_10016928 Ga0207676_100169282 220
349 3300026095 Ga0207676_10025525 Ga0207676_100255253 220
350 3300026095 Ga0207676_10039306 Ga0207676_100393063 220
351 3300026095 Ga0207676_10101921 Ga0207676_101019212 220
352 3300026118 Ga0207675_100008626 Ga0207675_1000086268 220
353 3300026118 Ga0207675_100124267 Ga0207675_1001242672 220
354 3300026118 Ga0207675_100250477 Ga0207675_1002504772 220
355 3300026121 Ga0207683_10006338 Ga0207683_100063385 220
356 3300026121 Ga0207683_10051801 Ga0207683_100518013 220
357 3300026121 Ga0207683_10115861 Ga0207683_101158612 220
358 3300026121 Ga0207683_10151481 Ga0207683_101514812 220
359 3300026121 Ga0207683_10156051 Ga0207683_101560512 220
360 3300026121 Ga0207683_10179522 Ga0207683_101795222 220
361 3300026121 Ga0207683_10202229 Ga0207683_102022292 220
362 3300026121 Ga0207683_10415770 Ga0207683_104157702 220
363 3300026142 Ga0207698_10043817 Ga0207698_100438174 220
364 3300026142 Ga0207698_10203614 Ga0207698_102036142 220
365 3300028379 Ga0268266_10169798 Ga0268266_101697982 220
366 3300028380 Ga0268265_10010223 Ga0268265_100102235 220
367 3300028380 Ga0268265_10207961 Ga0268265_102079612 220
368 3300028381 Ga0268264_10006491 Ga0268264_100064915 220
369 3300031548 Ga0307408_100036908 Ga0307408_1000369082 220
370 3300031852 Ga0307410_10647422 Ga0307410_106474222 220
371 3300031903 Ga0307407_10416489 Ga0307407_104164892 220
372 3300031995 Ga0307409_100000230 Ga0307409_10000023017 220
373 3300031995 Ga0307409_100438531 Ga0307409_1004385312 220
374 3300032002 Ga0307416_100009392 Ga0307416_1000093927 220
375 3300032126 Ga0307415_100001495 Ga0307415_10000149512 220
376 3300035089 Ga0373944_0024307 Ga0373944_0024307_715_1380 220
377 3300035116 Ga0373945_0057418 Ga0373945_0057418_232_897 220
378 3300035120 Ga0373957_0201610 Ga0373957_0201610_42_707 220
379 3300035410 Ga0373924_0049936 Ga0373924_0049936_313_978 220
380 3300046475 Ga0495639_0189139 Ga0495639_0189139_268_933 220
381 3300046529 Ga0495652_0299469 Ga0495652_0299469_175_840 220
382 3300046539 Ga0495621_0248136 Ga0495621_0248136_15_680 220
383 3300046543 Ga0495645_0035093 Ga0495645_0035093_2638_3303 220
384 3300046683 Ga0495658_0055262 Ga0495658_0055262_305_970 220
385 3300046683 Ga0495658_0181615 Ga0495658_0181615_474_1139 220
386 3300048908 Ga0496105_0509164 Ga0496105_0509164_234_899 220
387 3300048911 Ga0496108_0424209 Ga0496108_0424209_109_774 220
388 3300048911 Ga0496108_0588308 Ga0496108_0588308_230_895 220
389 3300048912 Ga0496109_0165831 Ga0496109_0165831_748_1413 220
390 3300048917 Ga0496114_0096098 Ga0496114_0096098_720_1385 220
391 3300053077 Ga0495601_0302860 Ga0495601_0302860_232_897 220
392 3300005457 Ga0070662_100050816 Ga0070662_1000508163 221
393 3300005535 Ga0070684_100016798 Ga0070684_1000167983 221
394 3300013307 Ga0157372_10722769 Ga0157372_107227691 221
395 3300025917 Ga0207660_10264893 Ga0207660_102648932 221
396 3300025933 Ga0207706_10142941 Ga0207706_101429411 221
397 3300044693 Ga0466961_0099391 Ga0466961_0099391_892_1557 221
398 3300044719 Ga0466971_0098303 Ga0466971_0098303_543_1208 221
399 3300005331 Ga0070670_100493179 Ga0070670_1004931791 222
400 3300005354 Ga0070675_100060157 Ga0070675_1000601574 222
401 3300005354 Ga0070675_100410149 Ga0070675_1004101492 222
402 3300005356 Ga0070674_100131388 Ga0070674_1001313882 222
403 3300005364 Ga0070673_100118955 Ga0070673_1001189552 222
404 3300005457 Ga0070662_100165856 Ga0070662_1001658562 222
405 3300025907 Ga0207645_10254436 Ga0207645_102544362 222
406 3300025925 Ga0207650_10195703 Ga0207650_101957032 222
407 3300025925 Ga0207650_10201841 Ga0207650_102018412 222
408 3300025926 Ga0207659_10022044 Ga0207659_100220444 222
409 3300025926 Ga0207659_10223965 Ga0207659_102239652 222
410 3300025933 Ga0207706_10148678 Ga0207706_101486782 222
411 3300025933 Ga0207706_10183236 Ga0207706_101832362 222
412 3300025937 Ga0207669_10159235 Ga0207669_101592352 222
413 3300025940 Ga0207691_10063558 Ga0207691_100635584 222
414 3300026118 Ga0207675_100489635 Ga0207675_1004896352 222
415 3300026121 Ga0207683_10341494 Ga0207683_103414942 222
416 3300028379 Ga0268266_10303270 Ga0268266_103032702 222
417 3300042008 Ga0439450_036630 Ga0439450_036630_383_1054 222
418 3300042115 Ga0450911_000114 Ga0450911_000114_1756_2427 222
419 3300042137 Ga0450902_012033 Ga0450902_012033_529_1200 222
420 3300042439 Ga0439464_0002879 Ga0439464_0002879_2352_3023 222
421 3300042461 Ga0439460_0038937 Ga0439460_0038937_591_1262 222
422 3300048924 Ga0496121_0000761 Ga0496121_0000761_41537_42208 222
423 3300048925 Ga0496122_0108806 Ga0496122_0108806_1141_1812 222
424 3300048927 Ga0496124_0164856 Ga0496124_0164856_1042_1713 222
425 3300048928 Ga0496125_0046754 Ga0496125_0046754_2232_2903 222
426 3300048928 Ga0496125_0241204 Ga0496125_0241204_149_820 222
427 3300048928 Ga0496125_0282407 Ga0496125_0282407_272_943 222
428 3300013308 Ga0157375_10033097 Ga0157375_100330973 223
429 3300014325 Ga0163163_10134346 Ga0163163_101343462 223
430 3300045836 Ga0466958_0177730 Ga0466958_0177730_504_1175 223
431 iso_pu_bacteria 2643221644 2644243875 223
432 iso_pu_bacteria 2643221544 2643745343 224
433 3300003322 rootL2_10265642 rootL2_102656422 225
434 3300003771 Ga0055526_1012252 Ga0055526_10122524 225
435 3300012513 Ga0157326_1007880 Ga0157326_10078802 225
436 3300025295 Ga0209564_1001658 Ga0209564_10016587 225
437 3300026142 Ga0207698_10754934 Ga0207698_107549342 225
438 3300027876 Ga0209974_10012928 Ga0209974_100129282 225
439 3300037471 Ga0395905_0088314 Ga0395905_0088314_444_1121 225
440 3300041406 Ga0439439_0001426 Ga0439439_0001426_908_1585 225
441 3300041407 Ga0439447_011756 Ga0439447_011756_1644_2321 225
442 3300041997 Ga0439431_0013030 Ga0439431_0013030_1162_1839 225
443 3300042007 Ga0439449_0002277 Ga0439449_0002277_6357_7034 225
444 3300042015 Ga0439462_0044044 Ga0439462_0044044_206_883 225
445 3300042126 Ga0450888_000217 Ga0450888_000217_2487_3164 225
446 3300042127 Ga0450890_000962 Ga0450890_000962_3254_3931 225
447 3300042127 Ga0450890_027148 Ga0450890_027148_106_783 225
448 3300042129 Ga0450891_000465 Ga0450891_000465_906_1583 225
449 3300042130 Ga0450892_000306 Ga0450892_000306_290_967 225
450 3300042144 Ga0450889_006361 Ga0450889_006361_279_956 225
451 3300042156 Ga0439446_0010342 Ga0439446_0010342_484_1161 225
452 3300042435 Ga0439434_0110687 Ga0439434_0110687_39_716 225
453 3300042439 Ga0439464_0050617 Ga0439464_0050617_504_1181 225
454 3300042532 Ga0450893_0001004 Ga0450893_0001004_473_1150 225
455 3300045051 Ga0451576_0025071 Ga0451576_0025071_2357_3034 225
456 3300049521 Ga0501298_009113 Ga0501298_009113_744_1421 225
457 3300049662 Ga0501222_007735 Ga0501222_007735_99_776 225
458 3300049762 Ga0501265_002521 Ga0501265_002521_170_847 225
459 3300049777 Ga0501281_00645 Ga0501281_00645_1003_1680 225
460 3300046558 Ga0495633_0001059 Ga0495633_0001059_17947_18642 227
461 3300048928 Ga0496125_0266476 Ga0496125_0266476_92_787 227
462 iso_pu_bacteria 2904479285 2904481059 227
463 3300003316 rootH1_10032265 rootH1_100322654 228
464 3300025294 Ga0209025_1023375 Ga0209025_10233754 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00596

Aldolase_II

Class II Aldolase and Adducin N-terminal domain

39

227

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vop-assembly1.cif.gz_A crystal structure of ygbl, a putative aldolase/epimerase/decarboxylase from escherichia coli 0.9115 6 221
6voq-assembly1.cif.gz_A crystal structure of ygbl, a putative aldolase/epimerase/decarboxylase from klebsiella pneumoniae 0.9046 3 221
6voq-assembly1.cif.gz_A crystal structure of ygbl, a putative aldolase/epimerase/decarboxylase from klebsiella pneumoniae 0.9005 3 221
2opi-assembly1.cif.gz_B crystal structure of l-fuculose-1-phosphate aldolase from bacteroides thetaiotaomicron 0.8952 11 225
6vop-assembly1.cif.gz_A crystal structure of ygbl, a putative aldolase/epimerase/decarboxylase from escherichia coli 0.8949 6 221
ID Description Score Start End Superfamily
af_Q58813_1_180_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9276 10 204 3.40.225.10
af_Q46890_7_212_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9131 6 221 3.40.225.10
af_Q46890_7_212_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9005 6 221 3.40.225.10
2fuaA00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.8904 4 225 3.40.225.10
2opiA00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.8903 11 220 3.40.225.10
ID Description Score Start End GO Terms
AF-A0A4Q3RC82-F1-model_v4 deleted 0.9743 4 228
AF-A0A528GYK9-F1-model_v4 Aldolase 0.9694 4 85 GO:0005829
GO:0016832
GO:0019323
AF-A0A520DIA0-F1-model_v4 Aldolase 0.9683 4 228 GO:0005829
GO:0016832
GO:0019323
AF-A0A6A4R612-F1-model_v4 Aldolase 0.9645 6 71 GO:0005829
GO:0016832
GO:0019323
AF-A0A520DIA0-F1-model_v4 Aldolase 0.964 4 228 GO:0005829
GO:0016832
GO:0019323

Feature Viewer

pLDDT pTM Quality
91.38 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map