F449331

General Info

Members Datasets Scaffolds Average Seq Length
464 219 928 293

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0448324|Ga0373937_0448324_16_774
Length 252
Sequence LNFIRGAKGARRVVGDHVEEIEDIELVLVGPNVQHAWFNHQCKSKEIHEITIQFHKDLFDDKLLRRNQLSFIKNMFDKSSRGILFPKETIQSVAPRIAELNQKHGFDSVLELISILHDLSISRNLRILSDSAFANEQFTYNSRRIEKTFDYMNKNFDRTITLSEVSKLSNMSDVSFSRFFRQRTGNTFIDSLTEIRLGHASRILIDTTNSIAEVAYHCGFNNISNFNRIFKKKKGCTPREFRESFSGTRIFI

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
153 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
154 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
155 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
158 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
159 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
191 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
202 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
203 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
204 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
205 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
206 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
207 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
208 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
209 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
210 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
211 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
212 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
213 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
214 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
215 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
216 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
217 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
218 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
219 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 0
Isolates 1.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.6
Nodule 0
Rhizoplane 0.43
Rhizosphere 89.66
Stem 0
Stem Tuber 0
Unclassified 9.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0448324 3300036401 Bacteria 1225
2 rootH2_10012230 3300003320 Bacteria 28566
3 rootL2_10068025 3300003322 Bacteria 5227
4 rootH1_10007323 3300003323 Bacteria 15190
5 rootH1_10070821 3300003323 Bacteria 5283
6 rootH1_10233996 3300003323 Unclassified 3651
7 JGI25160J50197_1000787 3300003354 Bacteria 17031
8 JGI25160J50197_1006884 3300003354 Bacteria 4534
9 Ga0070676_10008011 3300005328 Bacteria 5680
10 Ga0070676_10018488 3300005328 Bacteria 3864
11 Ga0070683_100021072 3300005329 Bacteria 5813
12 Ga0070683_100022718 3300005329 Bacteria 5609
13 Ga0070683_100212656 3300005329 Bacteria 1837
14 Ga0070683_100446724 3300005329 Bacteria 1234
15 Ga0070690_100046401 3300005330 Bacteria 2762
16 Ga0070690_100048877 3300005330 Bacteria 2695
17 Ga0070670_100030866 3300005331 Bacteria 4616
18 Ga0070670_100108336 3300005331 Bacteria 2393
19 Ga0070670_100321085 3300005331 Bacteria 1357
20 Ga0070670_100489564 3300005331 Unclassified 1093
21 Ga0070677_10116981 3300005333 Bacteria 1198
22 Ga0068869_100011301 3300005334 Bacteria 5849
23 Ga0068869_100024225 3300005334 Unclassified 4202
24 Ga0068869_100047705 3300005334 Bacteria 3094
25 Ga0068869_100055282 3300005334 Bacteria 2892
26 Ga0068869_100153703 3300005334 Bacteria 1786
27 Ga0068869_100214686 3300005334 Unclassified 1522
28 Ga0068869_100253938 3300005334 Bacteria 1405
29 Ga0070666_10000028 3300005335 Bacteria 144796
30 Ga0070666_10030636 3300005335 Bacteria 3545
31 Ga0070666_10096917 3300005335 Bacteria 2030
32 Ga0070680_100254471 3300005336 Unclassified 1485
33 Ga0070680_100287061 3300005336 Bacteria 1395
34 Ga0070682_100018737 3300005337 Bacteria 4051
35 Ga0068868_100006295 3300005338 Bacteria 8390
36 Ga0068868_100020593 3300005338 Bacteria 4959
37 Ga0068868_100038552 3300005338 Unclassified 3710
38 Ga0068868_100110161 3300005338 Bacteria 2236
39 Ga0070660_100116051 3300005339 Bacteria 2135
40 Ga0070660_100494382 3300005339 Bacteria 1017
41 Ga0070689_100018211 3300005340 Bacteria 5170
42 Ga0070689_100035963 3300005340 Bacteria 3786
43 Ga0070661_100021401 3300005344 Unclassified 4618
44 Ga0070661_100022886 3300005344 Bacteria 4475
45 Ga0070661_100477344 3300005344 Bacteria 995
46 Ga0070668_100005209 3300005347 Bacteria 9645
47 Ga0070668_100121554 3300005347 Bacteria 2088
48 Ga0070669_100006464 3300005353 Bacteria 8439
49 Ga0070675_100115583 3300005354 Bacteria 2275
50 Ga0070675_100164508 3300005354 Bacteria 1910
51 Ga0070675_100206332 3300005354 Bacteria 1707
52 Ga0070675_100405445 3300005354 Bacteria 1217
53 Ga0070671_100049698 3300005355 Bacteria 3489
54 Ga0070671_100064250 3300005355 Bacteria 3057
55 Ga0070674_100002139 3300005356 Bacteria 10845
56 Ga0070674_100092833 3300005356 Unclassified 2183
57 Ga0070674_100100155 3300005356 Bacteria 2109
58 Ga0070673_100002716 3300005364 Bacteria 10850
59 Ga0070673_100128417 3300005364 Bacteria 2124
60 Ga0070673_100162529 3300005364 Bacteria 1900
61 Ga0070673_100339663 3300005364 Bacteria 1330
62 Ga0070688_100024265 3300005365 Bacteria 3575
63 Ga0070688_100024567 3300005365 Bacteria 3557
64 Ga0070659_100011488 3300005366 Bacteria 6549
65 Ga0070667_100015862 3300005367 Bacteria 6233
66 Ga0070667_100026445 3300005367 Bacteria 4827
67 Ga0070667_100110358 3300005367 Bacteria 2385
68 Ga0070667_100122228 3300005367 Bacteria 2265
69 Ga0070667_100135834 3300005367 Bacteria 2150
70 Ga0070678_100007292 3300005456 Bacteria 6547
71 Ga0070678_100091488 3300005456 Bacteria 2335
72 Ga0070678_100203709 3300005456 Bacteria 1635
73 Ga0070662_100005896 3300005457 Bacteria 7859
74 Ga0070662_100044856 3300005457 Bacteria 3169
75 Ga0070662_100225634 3300005457 Bacteria 1496
76 Ga0068867_100012940 3300005459 Bacteria 5903
77 Ga0068867_100053542 3300005459 Unclassified 2981
78 Ga0068867_100083918 3300005459 Bacteria 2406
79 Ga0068867_100267821 3300005459 Unclassified 1395
80 Ga0070684_100000659 3300005535 Bacteria 23833
81 Ga0070684_100014851 3300005535 Bacteria 6319
82 Ga0070684_100084951 3300005535 Bacteria 2806
83 Ga0070684_100092591 3300005535 Bacteria 2690
84 Ga0068853_100013150 3300005539 Bacteria 6755
85 Ga0068853_100016636 3300005539 Bacteria 6055
86 Ga0068853_100252638 3300005539 Bacteria 1618
87 Ga0068853_100570624 3300005539 Bacteria 1073
88 Ga0068853_100674360 3300005539 Bacteria 985
89 Ga0070672_100053834 3300005543 Bacteria 3148
90 Ga0070672_100164368 3300005543 Unclassified 1843
91 Ga0070672_100279673 3300005543 Bacteria 1411
92 Ga0070672_100323995 3300005543 Bacteria 1310
93 Ga0070686_100008908 3300005544 Bacteria 5625
94 Ga0070693_100181873 3300005547 Bacteria 1354
95 Ga0070693_100205028 3300005547 Bacteria 1283
96 Ga0070693_100342775 3300005547 Bacteria 1020
97 Ga0070665_100026986 3300005548 Bacteria 5782
98 Ga0070665_100035372 3300005548 Bacteria 5022
99 Ga0068855_100003684 3300005563 Bacteria 18745
100 Ga0068855_100202262 3300005563 Bacteria 2235
101 Ga0070664_100009470 3300005564 Bacteria 7897
102 Ga0070664_100018521 3300005564 Bacteria 5723
103 Ga0070664_100146521 3300005564 Bacteria 2082
104 Ga0070664_100182611 3300005564 Unclassified 1865
105 Ga0070664_100192573 3300005564 Bacteria 1817
106 Ga0068857_100008019 3300005577 Bacteria 9107
107 Ga0068857_100013463 3300005577 Bacteria 7125
108 Ga0068857_100190485 3300005577 Bacteria 1868
109 Ga0068857_100389617 3300005577 Bacteria 1295
110 Ga0068854_100302746 3300005578 Bacteria 1294
111 Ga0068852_100075644 3300005616 Bacteria 2970
112 Ga0068852_100164700 3300005616 Bacteria 2073
113 Ga0068852_100178831 3300005616 Bacteria 1993
114 Ga0068852_100219978 3300005616 Bacteria 1805
115 Ga0068852_100431102 3300005616 Bacteria 1302
116 Ga0068859_100000012 3300005617 Bacteria 300376
117 Ga0068859_100000381 3300005617 Bacteria 44189
118 Ga0068859_100017680 3300005617 Bacteria 7168
119 Ga0068859_100071438 3300005617 Bacteria 3507
120 Ga0068859_100547234 3300005617 Unclassified 1252
121 Ga0068864_100005032 3300005618 Bacteria 10825
122 Ga0068864_100005623 3300005618 Bacteria 10274
123 Ga0068864_100180240 3300005618 Bacteria 1931
124 Ga0068864_100570317 3300005618 Bacteria 1096
125 Ga0068861_100024806 3300005719 Unclassified 4341
126 Ga0068861_100043885 3300005719 Bacteria 3359
127 Ga0068861_100148487 3300005719 Bacteria 1921
128 Ga0068851_10060277 3300005834 Bacteria 1942
129 Ga0068870_10012970 3300005840 Bacteria 3906
130 Ga0068870_10016511 3300005840 Bacteria 3529
131 Ga0068863_100001545 3300005841 Bacteria 22711
132 Ga0068858_100001867 3300005842 Bacteria 21490
133 Ga0068858_100014891 3300005842 Bacteria 7316
134 Ga0068858_100166144 3300005842 Bacteria 2079
135 Ga0068858_100224297 3300005842 Bacteria 1781
136 Ga0068860_100005418 3300005843 Bacteria 12946
137 Ga0068860_100007388 3300005843 Bacteria 10989
138 Ga0068860_100198212 3300005843 Bacteria 1945
139 Ga0068860_100245031 3300005843 Unclassified 1744
140 Ga0068860_100259325 3300005843 Bacteria 1694
141 Ga0068862_100060736 3300005844 Unclassified 3248
142 Ga0081540_1021733 3300005983 Bacteria 3810
143 Ga0081539_10008681 3300005985 Bacteria 8745
144 Ga0097621_100157083 3300006237 Bacteria 1953
145 Ga0097621_100189235 3300006237 Unclassified 1782
146 Ga0097621_100213404 3300006237 Bacteria 1680
147 Ga0068871_100011064 3300006358 Bacteria 6614
148 Ga0068871_100020969 3300006358 Bacteria 5014
149 Ga0068871_100025166 3300006358 Bacteria 4627
150 Ga0068871_100069289 3300006358 Bacteria 2896
151 Ga0068871_100202179 3300006358 Bacteria 1715
152 Ga0075428_100165849 3300006844 Bacteria 2396
153 Ga0075431_100007212 3300006847 Bacteria 11058
154 Ga0075429_100107233 3300006880 Bacteria 2441
155 Ga0075429_100277331 3300006880 Bacteria 1468
156 Ga0068865_100004701 3300006881 Bacteria 8249
157 Ga0097620_100000012 3300006931 Bacteria 300376
158 Ga0097620_100000381 3300006931 Bacteria 44189
159 Ga0097620_100017680 3300006931 Bacteria 7168
160 Ga0097620_100071440 3300006931 Bacteria 3507
161 Ga0097620_100547247 3300006931 Unclassified 1252
162 Ga0105240_10045421 3300009093 Bacteria 5572
163 Ga0105240_10346639 3300009093 Bacteria 1686
164 Ga0111539_10040609 3300009094 Bacteria 5599
165 Ga0111539_10046477 3300009094 Bacteria 5192
166 Ga0105245_10122983 3300009098 Bacteria 2426
167 Ga0105247_10005782 3300009101 Bacteria 7746
168 Ga0105247_10101425 3300009101 Bacteria 1840
169 Ga0114129_10018014 3300009147 Bacteria 10058
170 Ga0105241_10003220 3300009174 Bacteria 12148
171 Ga0105241_10102616 3300009174 Bacteria 2276
172 Ga0105241_10104805 3300009174 Unclassified 2254
173 Ga0105241_10333229 3300009174 Bacteria 1312
174 Ga0105242_10026585 3300009176 Bacteria 4587
175 Ga0105242_10044524 3300009176 Bacteria 3595
176 Ga0105242_10120004 3300009176 Bacteria 2255
177 Ga0105248_10299859 3300009177 Bacteria 1809
178 Ga0105237_10002273 3300009545 Bacteria 23899
179 Ga0105237_10005390 3300009545 Bacteria 14455
180 Ga0105237_10011159 3300009545 Bacteria 9524
181 Ga0105237_10083275 3300009545 Bacteria 3190
182 Ga0105249_10089079 3300009553 Bacteria 2883
183 Ga0105249_10274162 3300009553 Bacteria 1682
184 Ga0105239_10094996 3300010375 Bacteria 3293
185 Ga0105246_10021211 3300011119 Bacteria 4178
186 Ga0105246_10211591 3300011119 Unclassified 1514
187 Ga0157373_10036512 3300013100 Bacteria 3526
188 Ga0157373_10085046 3300013100 Bacteria 2229
189 Ga0157371_10007974 3300013102 Bacteria 8497
190 Ga0157371_10019418 3300013102 Bacteria 5014
191 Ga0157371_10061949 3300013102 Bacteria 2653
192 Ga0157371_10102623 3300013102 Bacteria 2029
193 Ga0157370_10133427 3300013104 Bacteria 2316
194 Ga0157369_10000619 3300013105 Bacteria 46205
195 Ga0157369_10007912 3300013105 Bacteria 12221
196 Ga0157374_10000381 3300013296 Bacteria 40826
197 Ga0157374_10011801 3300013296 Bacteria 7581
198 Ga0157374_10051978 3300013296 Bacteria 3814
199 Ga0157374_10209090 3300013296 Bacteria 1913
200 Ga0157374_10218697 3300013296 Unclassified 1869
201 Ga0157374_10366604 3300013296 Bacteria 1433
202 Ga0157378_10001986 3300013297 Bacteria 18311
203 Ga0157378_10005678 3300013297 Bacteria 10917
204 Ga0157378_10143962 3300013297 Bacteria 2216
205 Ga0163162_10000282 3300013306 Bacteria 46472
206 Ga0163162_10015645 3300013306 Bacteria 7414
207 Ga0163162_10047155 3300013306 Bacteria 4319
208 Ga0163162_10101445 3300013306 Bacteria 2970
209 Ga0163162_10141298 3300013306 Unclassified 2521
210 Ga0163162_10181327 3300013306 Unclassified 2232
211 Ga0163162_10210817 3300013306 Bacteria 2072
212 Ga0163162_10449660 3300013306 Bacteria 1420
213 Ga0157372_10015814 3300013307 Bacteria 8094
214 Ga0157372_10053760 3300013307 Bacteria 4490
215 Ga0157372_10064342 3300013307 Bacteria 4115
216 Ga0157372_10142890 3300013307 Bacteria 2759
217 Ga0157372_10335260 3300013307 Unclassified 1761
218 Ga0157372_10445197 3300013307 Bacteria 1510
219 Ga0157372_10464715 3300013307 Unclassified 1475
220 Ga0157372_10649385 3300013307 Bacteria 1229
221 Ga0157375_10000676 3300013308 Bacteria 30185
222 Ga0157375_10031796 3300013308 Bacteria 4997
223 Ga0157375_10063896 3300013308 Bacteria 3664
224 Ga0157375_10108030 3300013308 Bacteria 2876
225 Ga0157375_10148111 3300013308 Bacteria 2480
226 Ga0157375_10261253 3300013308 Bacteria 1893
227 Ga0157375_10613451 3300013308 Bacteria 1246
228 Ga0163163_10000195 3300014325 Bacteria 62526
229 Ga0163163_10045610 3300014325 Bacteria 4304
230 Ga0157380_10051982 3300014326 Bacteria 3243
231 Ga0157380_10479561 3300014326 Unclassified 1202
232 Ga0157377_10032441 3300014745 Bacteria 2844
233 Ga0157377_10057264 3300014745 Bacteria 2215
234 Ga0157377_10256591 3300014745 Bacteria 1136
235 Ga0157379_10091637 3300014968 Unclassified 2726
236 Ga0157379_10117510 3300014968 Bacteria 2392
237 Ga0157379_10126944 3300014968 Bacteria 2295
238 Ga0157379_10211363 3300014968 Bacteria 1756
239 Ga0157376_10021950 3300014969 Bacteria 4966
240 Ga0157376_10101970 3300014969 Bacteria 2509
241 Ga0157376_10185068 3300014969 Bacteria 1906
242 Ga0157376_10410332 3300014969 Bacteria 1312
243 Ga0157376_10645770 3300014969 Unclassified 1058
244 Ga0163161_10017295 3300017792 Bacteria 5046
245 Ga0213876_10001384 3300021384 Bacteria 15141
246 Ga0209436_100249 3300025208 Bacteria 24709
247 Ga0209258_100081 3300025242 Bacteria 254564
248 Ga0209148_1000255 3300025254 Bacteria 84164
249 Ga0209130_1001185 3300025284 Bacteria 18625
250 Ga0207426_1000002 3300025302 Bacteria 1249660
251 Ga0207426_1000415 3300025302 Bacteria 70247
252 Ga0207697_10120143 3300025315 Bacteria 1130
253 Ga0207656_10032108 3300025321 Bacteria 2179
254 Ga0207642_10018529 3300025899 Bacteria 2674
255 Ga0207710_10064965 3300025900 Bacteria 1662
256 Ga0207688_10024228 3300025901 Bacteria 3327
257 Ga0207680_10001464 3300025903 Bacteria 11180
258 Ga0207647_10063756 3300025904 Unclassified 2241
259 Ga0207645_10000496 3300025907 Bacteria 32469
260 Ga0207645_10014698 3300025907 Bacteria 5226
261 Ga0207645_10161376 3300025907 Bacteria 1467
262 Ga0207643_10003378 3300025908 Bacteria 8602
263 Ga0207705_10161956 3300025909 Bacteria 1681
264 Ga0207695_10380436 3300025913 Bacteria 1297
265 Ga0207671_10072887 3300025914 Bacteria 2564
266 Ga0207671_10074329 3300025914 Bacteria 2540
267 Ga0207671_10158438 3300025914 Bacteria 1752
268 Ga0207662_10007822 3300025918 Bacteria 5824
269 Ga0207657_10104621 3300025919 Bacteria 2344
270 Ga0207649_10009280 3300025920 Bacteria 5381
271 Ga0207649_10032062 3300025920 Bacteria 3129
272 Ga0207649_10121703 3300025920 Bacteria 1760
273 Ga0207649_10186558 3300025920 Bacteria 1455
274 Ga0207652_10133379 3300025921 Bacteria 2216
275 Ga0207650_10011402 3300025925 Bacteria 6118
276 Ga0207650_10063830 3300025925 Unclassified 2755
277 Ga0207659_10053115 3300025926 Bacteria 2890
278 Ga0207644_10026019 3300025931 Bacteria 4028
279 Ga0207690_10022238 3300025932 Unclassified 3942
280 Ga0207706_10005953 3300025933 Bacteria 11342
281 Ga0207706_10010305 3300025933 Bacteria 8546
282 Ga0207706_10124619 3300025933 Bacteria 2266
283 Ga0207706_10139824 3300025933 Bacteria 2130
284 Ga0207706_10180996 3300025933 Bacteria 1851
285 Ga0207706_10350084 3300025933 Unclassified 1285
286 Ga0207686_10196183 3300025934 Bacteria 1443
287 Ga0207670_10010666 3300025936 Bacteria 5302
288 Ga0207704_10009048 3300025938 Bacteria 4787
289 Ga0207704_10161972 3300025938 Bacteria 1593
290 Ga0207691_10026445 3300025940 Bacteria 5443
291 Ga0207691_10065516 3300025940 Bacteria 3288
292 Ga0207691_10355923 3300025940 Bacteria 1252
293 Ga0207689_10000897 3300025942 Bacteria 28597
294 Ga0207689_10001208 3300025942 Bacteria 24837
295 Ga0207689_10002542 3300025942 Bacteria 16930
296 Ga0207689_10032897 3300025942 Bacteria 4310
297 Ga0207689_10048708 3300025942 Bacteria 3496
298 Ga0207689_10284208 3300025942 Bacteria 1370
299 Ga0207661_10007264 3300025944 Bacteria 7880
300 Ga0207661_10058734 3300025944 Bacteria 3097
301 Ga0207661_10510778 3300025944 Bacteria 1098
302 Ga0207679_10001262 3300025945 Bacteria 16042
303 Ga0207679_10110992 3300025945 Bacteria 2164
304 Ga0207679_10128260 3300025945 Bacteria 2031
305 Ga0207679_10142221 3300025945 Bacteria 1941
306 Ga0207667_10013250 3300025949 Bacteria 9450
307 Ga0207651_10095658 3300025960 Bacteria 2188
308 Ga0207651_10125886 3300025960 Unclassified 1952
309 Ga0207651_10287979 3300025960 Unclassified 1361
310 Ga0207712_10050847 3300025961 Bacteria 2895
311 Ga0207712_10157792 3300025961 Bacteria 1759
312 Ga0207668_10071880 3300025972 Bacteria 2473
313 Ga0207668_10082681 3300025972 Unclassified 2334
314 Ga0207640_10079962 3300025981 Unclassified 2230
315 Ga0207658_10216790 3300025986 Bacteria 1607
316 Ga0207658_10274917 3300025986 Bacteria 1441
317 Ga0207658_10367237 3300025986 Bacteria 1257
318 Ga0207677_10029402 3300026023 Bacteria 3491
319 Ga0207677_10106856 3300026023 Unclassified 2074
320 Ga0207677_10142518 3300026023 Bacteria 1837
321 Ga0207677_10323652 3300026023 Bacteria 1282
322 Ga0207703_10006316 3300026035 Bacteria 9472
323 Ga0207703_10107327 3300026035 Bacteria 2377
324 Ga0207639_10009397 3300026041 Bacteria 6745
325 Ga0207639_10340513 3300026041 Bacteria 1337
326 Ga0207639_10434093 3300026041 Bacteria 1190
327 Ga0207678_10035620 3300026067 Bacteria 4333
328 Ga0207641_10001493 3300026088 Bacteria 22880
329 Ga0207648_10001041 3300026089 Bacteria 31089
330 Ga0207648_10019162 3300026089 Bacteria 6174
331 Ga0207648_10026390 3300026089 Bacteria 5162
332 Ga0207648_10190542 3300026089 Bacteria 1817
333 Ga0207676_10006269 3300026095 Bacteria 8397
334 Ga0207676_10042696 3300026095 Bacteria 3488
335 Ga0207676_10078427 3300026095 Bacteria 2675
336 Ga0207676_10140157 3300026095 Bacteria 2069
337 Ga0207676_10212024 3300026095 Bacteria 1719
338 Ga0207674_10003593 3300026116 Bacteria 18910
339 Ga0207674_10004449 3300026116 Bacteria 16843
340 Ga0207674_10216645 3300026116 Bacteria 1863
341 Ga0207674_10221536 3300026116 Bacteria 1840
342 Ga0207675_100008367 3300026118 Bacteria 9750
343 Ga0207675_100037094 3300026118 Bacteria 4547
344 Ga0207683_10005221 3300026121 Bacteria 11148
345 Ga0207683_10056097 3300026121 Bacteria 3455
346 Ga0207683_10078170 3300026121 Bacteria 2932
347 Ga0207698_10054417 3300026142 Bacteria 3079
348 Ga0207698_10134838 3300026142 Bacteria 2117
349 Ga0207698_10175905 3300026142 Bacteria 1890
350 Ga0207698_10287065 3300026142 Bacteria 1525
351 Ga0268266_10027718 3300028379 Bacteria 4816
352 Ga0268266_10714847 3300028379 Unclassified 966
353 Ga0268264_10002106 3300028381 Bacteria 17740
354 Ga0268264_10010026 3300028381 Bacteria 7843
355 Ga0268264_10240485 3300028381 Bacteria 1677
356 Ga0268264_10244473 3300028381 Unclassified 1664
357 Ga0268264_10265279 3300028381 Bacteria 1602
358 Ga0307515_10000002 3300028794 Bacteria 1231751
359 Ga0307515_10000039 3300028794 Bacteria 323229
360 Ga0265327_10000701 3300031251 Bacteria 53104
361 Ga0265327_10026083 3300031251 Bacteria 3392
362 Ga0307513_10133258 3300031456 Bacteria 2425
363 Ga0307509_10028970 3300031507 Bacteria 6150
364 Ga0307509_10355600 3300031507 Bacteria 1186
365 Ga0307508_10002327 3300031616 Bacteria 20151
366 Ga0307413_10053442 3300031824 Bacteria 2445
367 Ga0307407_10361348 3300031903 Bacteria 1031
368 Ga0307416_100024996 3300032002 Bacteria 4371
369 Ga0307415_100063787 3300032126 Bacteria 2561
370 Ga0316580_10010684 3300032139 Bacteria 2780
371 Ga0373955_0030768 3300035172 Bacteria 2807
372 Ga0373955_0092932 3300035172 Bacteria 1722
373 Ga0436365_0614130 3300039437 Bacteria 27402
374 Ga0436365_1514287 3300039437 Bacteria 23671
375 Ga0451807_0042623 3300041486 Bacteria 1413
376 Ga0451849_1515896 3300041505 Bacteria 1084
377 Ga0439449_0012182 3300042007 Bacteria 3233
378 Ga0439449_0025094 3300042007 Bacteria 2228
379 Ga0439457_002128 3300042014 Bacteria 5762
380 Ga0451577_0286085 3300042876 Bacteria 1494
381 Ga0466969_0001015 3300044656 Bacteria 15184
382 Ga0466972_0000038 3300044658 Bacteria 135937
383 Ga0453683_0034138 3300044673 Unclassified 3207
384 Ga0466966_0001863 3300044684 Bacteria 13675
385 Ga0453684_0001489 3300044712 Bacteria 66094
386 Ga0453684_0004101 3300044712 Bacteria 31606
387 Ga0466968_0223951 3300044735 Bacteria 887
388 Ga0466957_0003323 3300044842 Bacteria 8814
389 Ga0466959_0000157 3300045049 Bacteria 44458
390 Ga0466959_0057340 3300045049 Bacteria 2840
391 Ga0495592_0108934 3300046454 Bacteria 1963
392 Ga0495580_0100608 3300046472 Bacteria 2011
393 Ga0495582_0076028 3300046473 Bacteria 1861
394 Ga0495608_0144583 3300046511 Bacteria 1517
395 Ga0495618_0084045 3300046514 Bacteria 2034
396 Ga0495586_0109838 3300046535 Bacteria 1534
397 Ga0495668_0001134 3300046616 Bacteria 27278
398 Ga0495599_0132974 3300046678 Bacteria 1545
399 Ga0495674_0094440 3300047319 Bacteria 2551
400 Ga0496110_0267070 3300048913 Bacteria 1558
401 Ga0496124_0081391 3300048927 Bacteria 2662
402 Ga0501032_0017575 3300049569 Bacteria 5020
403 Ga0501034_0002888 3300049571 Bacteria 19981
404 Ga0501034_0007305 3300049571 Bacteria 11774
405 Ga0501036_0011223 3300049572 Bacteria 7413
406 Ga0501036_0132967 3300049572 Bacteria 2099
407 Ga0501036_0395854 3300049572 Unclassified 1152
408 Ga0501037_0076722 3300049573 Bacteria 2426
409 Ga0501038_0045191 3300049574 Bacteria 3824
410 Ga0501038_0171173 3300049574 Bacteria 1758
411 Ga0501038_0243070 3300049574 Bacteria 1428
412 Ga0501039_0262514 3300049575 Bacteria 1357
413 Ga0501043_0032362 3300049579 Bacteria 4111
414 Ga0501043_0199767 3300049579 Bacteria 1552
415 Ga0501046_0003785 3300049580 Bacteria 13848
416 Ga0501047_0002239 3300049581 Bacteria 18518
417 Ga0501047_0172271 3300049581 Bacteria 2033
418 Ga0501048_0058767 3300049582 Bacteria 2725
419 Ga0501067_0005159 3300049583 Bacteria 7263
420 Ga0501070_0584619 3300049586 Bacteria 891
421 Ga0501073_0005404 3300049589 Bacteria 9572
422 Ga0501074_0008452 3300049590 Bacteria 7463
423 Ga0501223_001155 3300049663 Bacteria 6222
424 Ga0501225_0020252 3300049705 Bacteria 1839
425 Ga0501080_0020026 3300049742 Bacteria 6191
426 Ga0501083_0031393 3300049744 Bacteria 3646
427 Ga0501241_010307 3300049758 Bacteria 1700
428 Ga0501035_0005981 3300049822 Bacteria 11459
429 Ga0501035_0259647 3300049822 Bacteria 1473
430 Ga0501044_0021191 3300049823 Bacteria 6940
431 Ga0501044_0026282 3300049823 Bacteria 6164
432 Ga0501044_0050124 3300049823 Bacteria 4309
433 Ga0501044_0054913 3300049823 Bacteria 4092
434 Ga0501044_0065701 3300049823 Bacteria 3699
435 Ga0501044_0146975 3300049823 Bacteria 2342
436 Ga0501284_00003 3300050005 Bacteria 212116
437 nmdc:mga05p37_14329_c1 3300050507 Bacteria 9519
438 nmdc:mga09592_168807_c1 3300050508 Bacteria 1892
439 nmdc:mga08y16_21070_c1 3300050511 Bacteria 6882
440 nmdc:mga08y16_499033_c1 3300050511 Bacteria 1237
441 Ga0500578_0036495 3300053086 Bacteria 3157
442 Ga0500646_0033560 3300053090 Bacteria 1420
443 Ga0500583_0000047 3300053092 Bacteria 78958
444 Ga0500583_0001380 3300053092 Bacteria 6953
445 Ga0500583_0006354 3300053092 Bacteria 4058
446 Ga0500583_0056408 3300053092 Bacteria 1841
447 Ga0500562_000016 3300053108 Bacteria 131323
448 Ga0500607_126333 3300053121 Unclassified 1228
449 Ga0500658_0039019 3300053134 Unclassified 1895
450 Ga0500559_0009607 3300053136 Bacteria 4178
451 Ga0500577_0014922 3300053142 Unclassified 2414
452 Ga0500589_008614 3300053147 Bacteria 4267
453 Ga0500589_058402 3300053147 Unclassified 1774
454 Ga0500616_0009329 3300053153 Bacteria 5977
455 Ga0500622_0007566 3300053156 Bacteria 6155
456 Ga0500622_0158285 3300053156 Bacteria 1064
457 Ga0500611_012653 3300053727 Bacteria 1429
458 Ga0500661_008522 3300055283 Bacteria 1886
459 2819576316 2818991442 Bacteria 8318214
460 2819677331 2818991460 Bacteria 7595395
461 2884797197 2884791551 Bacteria 8511252
462 2929177259 2929177148 Bacteria 7883697
463 2945979629 2945977869 Bacteria 7777518
464 2946014504 2946013367 Bacteria 7766675
465 Ga0373937_0448324
466 rootH2_10012230
467 rootL2_10068025
468 rootH1_10007323
469 rootH1_10070821
470 rootH1_10233996
471 JGI25160J50197_1000787
472 JGI25160J50197_1006884
473 Ga0070676_10008011
474 Ga0070676_10018488
475 Ga0070683_100021072
476 Ga0070683_100022718
477 Ga0070683_100212656
478 Ga0070683_100446724
479 Ga0070690_100046401
480 Ga0070690_100048877
481 Ga0070670_100030866
482 Ga0070670_100108336
483 Ga0070670_100321085
484 Ga0070670_100489564
485 Ga0070677_10116981
486 Ga0068869_100011301
487 Ga0068869_100024225
488 Ga0068869_100047705
489 Ga0068869_100055282
490 Ga0068869_100153703
491 Ga0068869_100214686
492 Ga0068869_100253938
493 Ga0070666_10000028
494 Ga0070666_10030636
495 Ga0070666_10096917
496 Ga0070680_100254471
497 Ga0070680_100287061
498 Ga0070682_100018737
499 Ga0068868_100006295
500 Ga0068868_100020593
501 Ga0068868_100038552
502 Ga0068868_100110161
503 Ga0070660_100116051
504 Ga0070660_100494382
505 Ga0070689_100018211
506 Ga0070689_100035963
507 Ga0070661_100021401
508 Ga0070661_100022886
509 Ga0070661_100477344
510 Ga0070668_100005209
511 Ga0070668_100121554
512 Ga0070669_100006464
513 Ga0070675_100115583
514 Ga0070675_100164508
515 Ga0070675_100206332
516 Ga0070675_100405445
517 Ga0070671_100049698
518 Ga0070671_100064250
519 Ga0070674_100002139
520 Ga0070674_100092833
521 Ga0070674_100100155
522 Ga0070673_100002716
523 Ga0070673_100128417
524 Ga0070673_100162529
525 Ga0070673_100339663
526 Ga0070688_100024265
527 Ga0070688_100024567
528 Ga0070659_100011488
529 Ga0070667_100015862
530 Ga0070667_100026445
531 Ga0070667_100110358
532 Ga0070667_100122228
533 Ga0070667_100135834
534 Ga0070678_100007292
535 Ga0070678_100091488
536 Ga0070678_100203709
537 Ga0070662_100005896
538 Ga0070662_100044856
539 Ga0070662_100225634
540 Ga0068867_100012940
541 Ga0068867_100053542
542 Ga0068867_100083918
543 Ga0068867_100267821
544 Ga0070684_100000659
545 Ga0070684_100014851
546 Ga0070684_100084951
547 Ga0070684_100092591
548 Ga0068853_100013150
549 Ga0068853_100016636
550 Ga0068853_100252638
551 Ga0068853_100570624
552 Ga0068853_100674360
553 Ga0070672_100053834
554 Ga0070672_100164368
555 Ga0070672_100279673
556 Ga0070672_100323995
557 Ga0070686_100008908
558 Ga0070693_100181873
559 Ga0070693_100205028
560 Ga0070693_100342775
561 Ga0070665_100026986
562 Ga0070665_100035372
563 Ga0068855_100003684
564 Ga0068855_100202262
565 Ga0070664_100009470
566 Ga0070664_100018521
567 Ga0070664_100146521
568 Ga0070664_100182611
569 Ga0070664_100192573
570 Ga0068857_100008019
571 Ga0068857_100013463
572 Ga0068857_100190485
573 Ga0068857_100389617
574 Ga0068854_100302746
575 Ga0068852_100075644
576 Ga0068852_100164700
577 Ga0068852_100178831
578 Ga0068852_100219978
579 Ga0068852_100431102
580 Ga0068859_100000012
581 Ga0068859_100000381
582 Ga0068859_100017680
583 Ga0068859_100071438
584 Ga0068859_100547234
585 Ga0068864_100005032
586 Ga0068864_100005623
587 Ga0068864_100180240
588 Ga0068864_100570317
589 Ga0068861_100024806
590 Ga0068861_100043885
591 Ga0068861_100148487
592 Ga0068851_10060277
593 Ga0068870_10012970
594 Ga0068870_10016511
595 Ga0068863_100001545
596 Ga0068858_100001867
597 Ga0068858_100014891
598 Ga0068858_100166144
599 Ga0068858_100224297
600 Ga0068860_100005418
601 Ga0068860_100007388
602 Ga0068860_100198212
603 Ga0068860_100245031
604 Ga0068860_100259325
605 Ga0068862_100060736
606 Ga0081540_1021733
607 Ga0081539_10008681
608 Ga0097621_100157083
609 Ga0097621_100189235
610 Ga0097621_100213404
611 Ga0068871_100011064
612 Ga0068871_100020969
613 Ga0068871_100025166
614 Ga0068871_100069289
615 Ga0068871_100202179
616 Ga0075428_100165849
617 Ga0075431_100007212
618 Ga0075429_100107233
619 Ga0075429_100277331
620 Ga0068865_100004701
621 Ga0097620_100000012
622 Ga0097620_100000381
623 Ga0097620_100017680
624 Ga0097620_100071440
625 Ga0097620_100547247
626 Ga0105240_10045421
627 Ga0105240_10346639
628 Ga0111539_10040609
629 Ga0111539_10046477
630 Ga0105245_10122983
631 Ga0105247_10005782
632 Ga0105247_10101425
633 Ga0114129_10018014
634 Ga0105241_10003220
635 Ga0105241_10102616
636 Ga0105241_10104805
637 Ga0105241_10333229
638 Ga0105242_10026585
639 Ga0105242_10044524
640 Ga0105242_10120004
641 Ga0105248_10299859
642 Ga0105237_10002273
643 Ga0105237_10005390
644 Ga0105237_10011159
645 Ga0105237_10083275
646 Ga0105249_10089079
647 Ga0105249_10274162
648 Ga0105239_10094996
649 Ga0105246_10021211
650 Ga0105246_10211591
651 Ga0157373_10036512
652 Ga0157373_10085046
653 Ga0157371_10007974
654 Ga0157371_10019418
655 Ga0157371_10061949
656 Ga0157371_10102623
657 Ga0157370_10133427
658 Ga0157369_10000619
659 Ga0157369_10007912
660 Ga0157374_10000381
661 Ga0157374_10011801
662 Ga0157374_10051978
663 Ga0157374_10209090
664 Ga0157374_10218697
665 Ga0157374_10366604
666 Ga0157378_10001986
667 Ga0157378_10005678
668 Ga0157378_10143962
669 Ga0163162_10000282
670 Ga0163162_10015645
671 Ga0163162_10047155
672 Ga0163162_10101445
673 Ga0163162_10141298
674 Ga0163162_10181327
675 Ga0163162_10210817
676 Ga0163162_10449660
677 Ga0157372_10015814
678 Ga0157372_10053760
679 Ga0157372_10064342
680 Ga0157372_10142890
681 Ga0157372_10335260
682 Ga0157372_10445197
683 Ga0157372_10464715
684 Ga0157372_10649385
685 Ga0157375_10000676
686 Ga0157375_10031796
687 Ga0157375_10063896
688 Ga0157375_10108030
689 Ga0157375_10148111
690 Ga0157375_10261253
691 Ga0157375_10613451
692 Ga0163163_10000195
693 Ga0163163_10045610
694 Ga0157380_10051982
695 Ga0157380_10479561
696 Ga0157377_10032441
697 Ga0157377_10057264
698 Ga0157377_10256591
699 Ga0157379_10091637
700 Ga0157379_10117510
701 Ga0157379_10126944
702 Ga0157379_10211363
703 Ga0157376_10021950
704 Ga0157376_10101970
705 Ga0157376_10185068
706 Ga0157376_10410332
707 Ga0157376_10645770
708 Ga0163161_10017295
709 Ga0213876_10001384
710 Ga0209436_100249
711 Ga0209258_100081
712 Ga0209148_1000255
713 Ga0209130_1001185
714 Ga0207426_1000002
715 Ga0207426_1000415
716 Ga0207697_10120143
717 Ga0207656_10032108
718 Ga0207642_10018529
719 Ga0207710_10064965
720 Ga0207688_10024228
721 Ga0207680_10001464
722 Ga0207647_10063756
723 Ga0207645_10000496
724 Ga0207645_10014698
725 Ga0207645_10161376
726 Ga0207643_10003378
727 Ga0207705_10161956
728 Ga0207695_10380436
729 Ga0207671_10072887
730 Ga0207671_10074329
731 Ga0207671_10158438
732 Ga0207662_10007822
733 Ga0207657_10104621
734 Ga0207649_10009280
735 Ga0207649_10032062
736 Ga0207649_10121703
737 Ga0207649_10186558
738 Ga0207652_10133379
739 Ga0207650_10011402
740 Ga0207650_10063830
741 Ga0207659_10053115
742 Ga0207644_10026019
743 Ga0207690_10022238
744 Ga0207706_10005953
745 Ga0207706_10010305
746 Ga0207706_10124619
747 Ga0207706_10139824
748 Ga0207706_10180996
749 Ga0207706_10350084
750 Ga0207686_10196183
751 Ga0207670_10010666
752 Ga0207704_10009048
753 Ga0207704_10161972
754 Ga0207691_10026445
755 Ga0207691_10065516
756 Ga0207691_10355923
757 Ga0207689_10000897
758 Ga0207689_10001208
759 Ga0207689_10002542
760 Ga0207689_10032897
761 Ga0207689_10048708
762 Ga0207689_10284208
763 Ga0207661_10007264
764 Ga0207661_10058734
765 Ga0207661_10510778
766 Ga0207679_10001262
767 Ga0207679_10110992
768 Ga0207679_10128260
769 Ga0207679_10142221
770 Ga0207667_10013250
771 Ga0207651_10095658
772 Ga0207651_10125886
773 Ga0207651_10287979
774 Ga0207712_10050847
775 Ga0207712_10157792
776 Ga0207668_10071880
777 Ga0207668_10082681
778 Ga0207640_10079962
779 Ga0207658_10216790
780 Ga0207658_10274917
781 Ga0207658_10367237
782 Ga0207677_10029402
783 Ga0207677_10106856
784 Ga0207677_10142518
785 Ga0207677_10323652
786 Ga0207703_10006316
787 Ga0207703_10107327
788 Ga0207639_10009397
789 Ga0207639_10340513
790 Ga0207639_10434093
791 Ga0207678_10035620
792 Ga0207641_10001493
793 Ga0207648_10001041
794 Ga0207648_10019162
795 Ga0207648_10026390
796 Ga0207648_10190542
797 Ga0207676_10006269
798 Ga0207676_10042696
799 Ga0207676_10078427
800 Ga0207676_10140157
801 Ga0207676_10212024
802 Ga0207674_10003593
803 Ga0207674_10004449
804 Ga0207674_10216645
805 Ga0207674_10221536
806 Ga0207675_100008367
807 Ga0207675_100037094
808 Ga0207683_10005221
809 Ga0207683_10056097
810 Ga0207683_10078170
811 Ga0207698_10054417
812 Ga0207698_10134838
813 Ga0207698_10175905
814 Ga0207698_10287065
815 Ga0268266_10027718
816 Ga0268266_10714847
817 Ga0268264_10002106
818 Ga0268264_10010026
819 Ga0268264_10240485
820 Ga0268264_10244473
821 Ga0268264_10265279
822 Ga0307515_10000002
823 Ga0307515_10000039
824 Ga0265327_10000701
825 Ga0265327_10026083
826 Ga0307513_10133258
827 Ga0307509_10028970
828 Ga0307509_10355600
829 Ga0307508_10002327
830 Ga0307413_10053442
831 Ga0307407_10361348
832 Ga0307416_100024996
833 Ga0307415_100063787
834 Ga0316580_10010684
835 Ga0373955_0030768
836 Ga0373955_0092932
837 Ga0436365_0614130
838 Ga0436365_1514287
839 Ga0451807_0042623
840 Ga0451849_1515896
841 Ga0439449_0012182
842 Ga0439449_0025094
843 Ga0439457_002128
844 Ga0451577_0286085
845 Ga0466969_0001015
846 Ga0466972_0000038
847 Ga0453683_0034138
848 Ga0466966_0001863
849 Ga0453684_0001489
850 Ga0453684_0004101
851 Ga0466968_0223951
852 Ga0466957_0003323
853 Ga0466959_0000157
854 Ga0466959_0057340
855 Ga0495592_0108934
856 Ga0495580_0100608
857 Ga0495582_0076028
858 Ga0495608_0144583
859 Ga0495618_0084045
860 Ga0495586_0109838
861 Ga0495668_0001134
862 Ga0495599_0132974
863 Ga0495674_0094440
864 Ga0496110_0267070
865 Ga0496124_0081391
866 Ga0501032_0017575
867 Ga0501034_0002888
868 Ga0501034_0007305
869 Ga0501036_0011223
870 Ga0501036_0132967
871 Ga0501036_0395854
872 Ga0501037_0076722
873 Ga0501038_0045191
874 Ga0501038_0171173
875 Ga0501038_0243070
876 Ga0501039_0262514
877 Ga0501043_0032362
878 Ga0501043_0199767
879 Ga0501046_0003785
880 Ga0501047_0002239
881 Ga0501047_0172271
882 Ga0501048_0058767
883 Ga0501067_0005159
884 Ga0501070_0584619
885 Ga0501073_0005404
886 Ga0501074_0008452
887 Ga0501223_001155
888 Ga0501225_0020252
889 Ga0501080_0020026
890 Ga0501083_0031393
891 Ga0501241_010307
892 Ga0501035_0005981
893 Ga0501035_0259647
894 Ga0501044_0021191
895 Ga0501044_0026282
896 Ga0501044_0050124
897 Ga0501044_0054913
898 Ga0501044_0065701
899 Ga0501044_0146975
900 Ga0501284_00003
901 nmdc:mga05p37_14329_c1
902 nmdc:mga09592_168807_c1
903 nmdc:mga08y16_21070_c1
904 nmdc:mga08y16_499033_c1
905 Ga0500578_0036495
906 Ga0500646_0033560
907 Ga0500583_0000047
908 Ga0500583_0001380
909 Ga0500583_0006354
910 Ga0500583_0056408
911 Ga0500562_000016
912 Ga0500607_126333
913 Ga0500658_0039019
914 Ga0500559_0009607
915 Ga0500577_0014922
916 Ga0500589_008614
917 Ga0500589_058402
918 Ga0500616_0009329
919 Ga0500622_0007566
920 Ga0500622_0158285
921 Ga0500611_012653
922 Ga0500661_008522
923 2819576316
924 2819677331
925 2884797197
926 2929177259
927 2945979629
928 2946014504

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

165

244

0.96

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

204

243

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.9353 182 284
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9323 182 282
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9322 182 284
3mn2-assembly2.cif.gz_B the crystal structure of a probable arac family transcriptional regulator from rhodopseudomonas palustris cga009 0.9285 182 285
3oou-assembly1.cif.gz_A the structure of a protein with unkown function from listeria innocua 0.9276 182 285
ID Description Score Start End Superfamily
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9988 236 285 1.10.10.60
1d5yD02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9699 236 283 1.10.10.60
3lsgA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9679 240 282 1.10.10.60
af_P77379_178_282_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9627 185 284 1.10.10.60
5suwA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9606 227 285 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A538R932-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9862 182 285 GO:0003700
GO:0043565
AF-A0A6D1W0T7-F1-model_v4 deleted 0.9819 183 285
AF-A0A1G6WRX3-F1-model_v4 deleted 0.9747 184 286
AF-A0A6N0X2W9-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9729 184 284 GO:0003700
GO:0043565
AF-A0A2S4GJ94-F1-model_v4 deleted 0.9727 184 285

Map