F449334

General Info

Members Datasets Scaffolds Average Seq Length
464 287 928 752

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0027170|Ga0395905_0027170_2767_5103
Length 778
Sequence MQQQHTIHQAGRTGDAAATRAAGSAPLTPGDNVLATLQVDLDEDLRFAPGQLVLSERALFARLGPGGAWRQHELLPGMTLRHHDHAGVGTLELADEQRLIARWRFTLAANVQALRLVKRFEQLQKARALGVAAEGDDPTRCPTCRAPLPPDSDEXXLCTRELAEPPSTWVLLRLWRFARPYRFKLLFGFLLTLASTGATLVPPYLTIPLMDEVLIPFQNGQKIDTGYVVLLLSGLLGSALIAWSLGWARTWLLALVSERIAADLRVGAFEHLLQLSLDYFGAKRTGDLMSRIGSETDRISVFLSLHALDFATDVLLLGMTSVILFSINPWLALVTLLPLPFIAWMIHLVRDRLRTGFEKIDRVWGDVTNVLADTIPGIRVVKAFAQESREASRFREANKQNLHVNDRLNKTWSLFTPTVSLLTDVGLLVVWAFGIWQVSRGQITVGVLTAFIAYIGRFYGRLDSMSRIVSVTQKAAAGAKRIFDILDHVSNVPEPTQPVKMDELDGGGLKGGVTMDNIGFRYGNRSVIRGLNLQIQPGEMIGLVGHSGSGKSTLVNLICRFYDVTDGRILVDGVDIRRFAVSDYRRHIGLVLQEPFLFFGTVAENIAYGKPEATREEIVAAARAAHAHEFILRLPQGYDSLVGERGQGLSGGERQRISIARALLIDPRLLILDEATSAVDTETEKEIQKALDNLVKGRTTIAIAHRLSTLRKADRLVVMDRGVVVEVGPHDELMAQQGAYWRLYEAQARKAEAEGSDHDAVVIANNLPQPSAHEEVNS

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
47 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
59 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
60 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
61 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
62 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
66 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
75 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
76 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
77 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
80 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
113 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
114 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
115 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
116 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
119 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
123 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
124 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
127 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
132 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
133 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
144 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
147 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
152 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
153 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
154 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
155 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
160 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
161 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
165 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
166 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
167 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
172 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
173 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
176 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
179 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
180 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
181 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
188 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
189 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
190 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
191 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
195 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
203 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
204 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
205 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
206 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
207 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
208 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
221 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
222 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
223 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
224 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
225 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
226 2547132512 Azospira oryzae 6a3 Isolate Unclassified
227 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
228 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
229 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
230 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
231 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
232 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
233 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
234 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
235 2643221556 Massilia sp. Root1485 Isolate Unclassified
236 2643221570 Acidovorax sp. Root568 Isolate Unclassified
237 2643221585 Pelomonas sp. Root662 Isolate Unclassified
238 2643221596 Acidovorax sp. Root70 Isolate Unclassified
239 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
240 2643221645 Massilia sp. Root351 Isolate Unclassified
241 2643221652 Acidovorax sp. Root402 Isolate Unclassified
242 2643221656 Pelomonas sp. Root405 Isolate Unclassified
243 2643221664 Massilia sp. Root418 Isolate Unclassified
244 2643221684 Massilia sp. Root133 Isolate Unclassified
245 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
246 2738541280 Massilia sp. GV090 Isolate Unclassified
247 2738541300 Massilia sp. GV016 Isolate Unclassified
248 2738543013 Variovorax sp. BT01 Isolate Unclassified
249 2738543018 Massilia sp. GV045 Isolate Unclassified
250 2738543030 Massilia sp. GV097 Isolate Unclassified
251 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
252 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
253 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
254 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
255 2818991436 Collimonas arenae 515 Isolate Unclassified
256 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
257 2831864461 Roseateles noduli HZ7 Isolate Nodule
258 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
259 2842677519 Variovorax sp. R-72495 Isolate Unclassified
260 2842733646 Variovorax sp. R-72446 Isolate Unclassified
261 2842747753 Variovorax sp. R-72060 Isolate Unclassified
262 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
263 2855730933 Achromobacter sp. HZ28 Isolate Nodule
264 2855767633 Achromobacter sp. HZ34 Isolate Nodule
265 2857564685 Duganella sp. R-74599 Isolate Unclassified
266 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
267 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
268 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
269 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
270 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
271 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
272 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
273 2885266251 Ralstonia sp. SET104 Isolate Nodule
274 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
275 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
276 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
277 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
278 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
279 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
280 2928058823 Ralstonia sp. 1138 Isolate Unclassified
281 2928070936 Variovorax gossypii 1167 Isolate Unclassified
282 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
283 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
284 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
285 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
286 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
287 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.34
Metatranscriptomes 0.43
Isolates 14.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.65
Nodule 2.16
Rhizoplane 2.37
Rhizosphere 54.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0027170 3300037471 Bacteria 5397
2 JGI24741J21665_1000400 3300001915 Bacteria 13092
3 JGI25155J39150_1000117 3300002704 Bacteria 39472
4 JGI25155J39150_1000227 3300002704 Bacteria 22140
5 JGI25156J39149_1000108 3300002705 Bacteria 59882
6 JGI25156J39149_1001271 3300002705 Bacteria 10955
7 JGI25162J39368_1000001 3300002737 Bacteria 740113
8 JGI25162J39368_1003616 3300002737 Bacteria 4275
9 JGI25154J39366_1000222 3300002738 Bacteria 38773
10 JGI25154J39366_1000582 3300002738 Bacteria 17719
11 JGI25154J39366_1000586 3300002738 Bacteria 17612
12 JGI25157J39369_1000120 3300002741 Bacteria 67137
13 JGI25152J39213_1001423 3300002773 Bacteria 10355
14 JGI25159J45721_1000313 3300002987 Bacteria 22625
15 JGI25151J46595_10001055 3300003187 Bacteria 20544
16 JGI25151J46595_10005302 3300003187 Bacteria 6678
17 JGI25151J46595_10006849 3300003187 Bacteria 5659
18 JGI25165J46597_1000001 3300003214 Bacteria 1111887
19 rootL2_10007230 3300003322 Bacteria 22552
20 JGI25160J50197_1000226 3300003354 Bacteria 44500
21 JGI25160J50197_1001607 3300003354 Bacteria 11116
22 JGI25161J50226_1000037 3300003374 Bacteria 133331
23 Ga0055538_1000001 3300003751 Bacteria 1111887
24 Ga0055539_1000001 3300003752 Bacteria 1111887
25 Ga0055539_1000201 3300003752 Bacteria 47514
26 Ga0055533_1000003 3300003756 Bacteria 1111887
27 Ga0055533_1002212 3300003756 Bacteria 4590
28 Ga0055532_1000051 3300003758 Bacteria 165365
29 Ga0055532_1000073 3300003758 Bacteria 131021
30 Ga0055525_1000003 3300003759 Bacteria 962094
31 Ga0055525_1000073 3300003759 Bacteria 180663
32 Ga0055525_1000222 3300003759 Bacteria 61500
33 Ga0055527_1001022 3300003760 Bacteria 6701
34 Ga0055535_1000055 3300003761 Bacteria 131021
35 Ga0055529_1001030 3300003763 Bacteria 13290
36 Ga0055526_1000093 3300003771 Bacteria 81432
37 Ga0055526_1007425 3300003771 Bacteria 5697
38 Ga0055526_1012267 3300003771 Bacteria 3755
39 Ga0055524_1002933 3300003775 Bacteria 8512
40 Ga0055524_1004371 3300003775 Bacteria 6525
41 Ga0055536_1000095 3300003781 Bacteria 76235
42 Ga0055534_1002931 3300003784 Bacteria 5655
43 Ga0055528_1003051 3300003790 Bacteria 8624
44 Ga0055540_1000212 3300003792 Bacteria 54979
45 Ga0055531_10000775 3300003794 Bacteria 26585
46 Ga0055541_1000001 3300003841 Bacteria 1111887
47 Ga0055541_1000347 3300003841 Bacteria 14435
48 Ga0055543_1001262 3300004625 Bacteria 10444
49 Ga0055543_1006333 3300004625 Bacteria 2874
50 Ga0065165_1000350 3300005262 Bacteria 75453
51 Ga0065165_1000555 3300005262 Bacteria 55601
52 Ga0070660_100000336 3300005339 Bacteria 31165
53 Ga0070661_100000061 3300005344 Bacteria 86581
54 Ga0070661_100001182 3300005344 Bacteria 18421
55 Ga0070661_100013724 3300005344 Bacteria 5691
56 Ga0070669_100012925 3300005353 Bacteria 5929
57 Ga0070671_100009682 3300005355 Bacteria 7741
58 Ga0070659_100000567 3300005366 Bacteria 27028
59 Ga0070659_100004207 3300005366 Bacteria 10271
60 Ga0070663_100000009 3300005455 Bacteria 187718
61 Ga0068855_100011447 3300005563 Bacteria 10716
62 Ga0070664_100000010 3300005564 Bacteria 165664
63 Ga0070664_100002550 3300005564 Bacteria 14696
64 Ga0068857_100108282 3300005577 Bacteria 2497
65 Ga0068854_100001632 3300005578 Bacteria 13649
66 Ga0068856_100000069 3300005614 Bacteria 95628
67 Ga0075366_10000917 3300006195 Bacteria 14301
68 Ga0075370_10003051 3300006353 Bacteria 7896
69 Ga0099823_1000065 3300006944 Bacteria 50323
70 Ga0099826_10000028 3300006948 Bacteria 129794
71 Ga0105240_10016280 3300009093 Bacteria 10073
72 Ga0105248_10000445 3300009177 Bacteria 46980
73 Ga0105238_10006674 3300009551 Bacteria 11510
74 Ga0157319_1000004 3300012497 Bacteria 394735
75 Ga0157373_10007730 3300013100 Bacteria 7992
76 Ga0157371_10000088 3300013102 Bacteria 145526
77 Ga0157370_10000041 3300013104 Bacteria 133912
78 Ga0157369_10025853 3300013105 Bacteria 6513
79 Ga0163162_10110043 3300013306 Bacteria 2852
80 Ga0157372_10000097 3300013307 Bacteria 90742
81 Ga0182006_1008959 3300015261 Bacteria 4513
82 Ga0182007_10001630 3300015262 Bacteria 11893
83 Ga0182007_10002076 3300015262 Bacteria 10289
84 Ga0182005_1000117 3300015265 Bacteria 57578
85 Ga0183362_10003 3300015683 Bacteria 977584
86 Ga0206351_10450512 3300020077 Bacteria 8498
87 Ga0154015_1045000 3300020610 Bacteria 11514
88 Ga0213872_10021872 3300021361 Bacteria 2945
89 Ga0209435_100028 3300025206 Bacteria 182520
90 Ga0209435_100345 3300025206 Bacteria 10752
91 Ga0209784_100004 3300025224 Bacteria 1378156
92 Ga0209784_100008 3300025224 Bacteria 740293
93 Ga0209784_100262 3300025224 Bacteria 31953
94 Ga0209566_100004 3300025225 Bacteria 1531866
95 Ga0209566_100006 3300025225 Bacteria 789272
96 Ga0209566_100582 3300025225 Bacteria 23555
97 Ga0209566_100612 3300025225 Bacteria 22172
98 Ga0209674_100006 3300025226 Bacteria 1531866
99 Ga0209674_100045 3300025226 Bacteria 362387
100 Ga0209674_100114 3300025226 Bacteria 139197
101 Ga0209672_100950 3300025228 Bacteria 12918
102 Ga0209672_101107 3300025228 Bacteria 11405
103 Ga0209147_100004 3300025229 Bacteria 1371850
104 Ga0209147_100005 3300025229 Bacteria 1036530
105 Ga0209563_100007 3300025230 Bacteria 1579402
106 Ga0209563_100009 3300025230 Bacteria 1378156
107 Ga0209563_100016 3300025230 Bacteria 802091
108 Ga0209563_100088 3300025230 Bacteria 175375
109 Ga0209563_103444 3300025230 Bacteria 3268
110 Ga0209437_100004 3300025233 Bacteria 1378156
111 Ga0209437_100053 3300025233 Bacteria 375580
112 Ga0209258_100007 3300025242 Bacteria 1036530
113 Ga0209258_100667 3300025242 Bacteria 24373
114 Ga0207425_1000135 3300025245 Bacteria 66450
115 Ga0207425_1001058 3300025245 Bacteria 12702
116 Ga0209646_1000021 3300025246 Bacteria 461083
117 Ga0209646_1000027 3300025246 Bacteria 395141
118 Ga0209646_1000095 3300025246 Bacteria 182520
119 Ga0209026_1000110 3300025250 Bacteria 141989
120 Ga0209026_1001352 3300025250 Bacteria 10951
121 Ga0209677_100005 3300025253 Bacteria 1378156
122 Ga0209677_100008 3300025253 Bacteria 802091
123 Ga0209677_101863 3300025253 Bacteria 8567
124 Ga0209677_102194 3300025253 Bacteria 7590
125 Ga0209148_1000019 3300025254 Bacteria 748518
126 Ga0209148_1000760 3300025254 Bacteria 24607
127 Ga0209759_1000080 3300025256 Bacteria 171186
128 Ga0209759_1000115 3300025256 Bacteria 141877
129 Ga0209759_1000155 3300025256 Bacteria 118819
130 Ga0209759_1005152 3300025256 Bacteria 4658
131 Ga0209129_1000043 3300025258 Bacteria 298978
132 Ga0209129_1000147 3300025258 Bacteria 115120
133 Ga0209233_1000005 3300025261 Bacteria 1531866
134 Ga0209565_1000102 3300025263 Bacteria 127545
135 Ga0209565_1000136 3300025263 Bacteria 103019
136 Ga0209565_1000715 3300025263 Bacteria 20127
137 Ga0209565_1006764 3300025263 Bacteria 3176
138 Ga0209455_1000011 3300025272 Bacteria 947242
139 Ga0209673_1000189 3300025273 Bacteria 123470
140 Ga0209673_1006562 3300025273 Bacteria 5578
141 Ga0209130_1002577 3300025284 Bacteria 8825
142 Ga0209675_1000212 3300025291 Bacteria 61040
143 Ga0209675_1000358 3300025291 Bacteria 39167
144 Ga0209675_1004961 3300025291 Bacteria 5737
145 Ga0209676_1000066 3300025292 Bacteria 317897
146 Ga0209676_1000145 3300025292 Bacteria 174391
147 Ga0209025_1000040 3300025294 Bacteria 376228
148 Ga0209025_1001071 3300025294 Bacteria 39701
149 Ga0209025_1002105 3300025294 Bacteria 22465
150 Ga0209025_1002636 3300025294 Bacteria 18394
151 Ga0209564_1000007 3300025295 Bacteria 1028582
152 Ga0209564_1000014 3300025295 Bacteria 621501
153 Ga0209564_1000021 3300025295 Bacteria 571316
154 Ga0209564_1000344 3300025295 Bacteria 88136
155 Ga0209564_1001392 3300025295 Bacteria 25203
156 Ga0209564_1004455 3300025295 Bacteria 8557
157 Ga0209758_1000093 3300025297 Bacteria 241169
158 Ga0209758_1000199 3300025297 Bacteria 133164
159 Ga0209758_1000248 3300025297 Bacteria 110671
160 Ga0209050_1000023 3300025298 Bacteria 537172
161 Ga0209256_1000003 3300025299 Bacteria 1661127
162 Ga0209256_1000151 3300025299 Bacteria 145299
163 Ga0209256_1002457 3300025299 Bacteria 15083
164 Ga0209256_1003984 3300025299 Bacteria 9694
165 Ga0207426_1000049 3300025302 Bacteria 401954
166 Ga0207426_1000145 3300025302 Bacteria 191065
167 Ga0209051_1000017 3300025303 Bacteria 537172
168 Ga0209051_1000241 3300025303 Bacteria 91816
169 Ga0209051_1003002 3300025303 Bacteria 11450
170 Ga0209051_1009826 3300025303 Bacteria 4895
171 Ga0209257_1000015 3300025304 Bacteria 908141
172 Ga0209257_1000041 3300025304 Bacteria 537172
173 Ga0209257_1001234 3300025304 Bacteria 31754
174 Ga0209257_1001568 3300025304 Bacteria 26416
175 Ga0207705_10001598 3300025909 Bacteria 17989
176 Ga0207695_10004380 3300025913 Bacteria 19306
177 Ga0207695_10013045 3300025913 Bacteria 9925
178 Ga0207657_10001256 3300025919 Bacteria 27132
179 Ga0207649_10000860 3300025920 Bacteria 19318
180 Ga0207649_10005512 3300025920 Bacteria 6852
181 Ga0207690_10001156 3300025932 Bacteria 16705
182 Ga0207690_10001785 3300025932 Bacteria 13226
183 Ga0207709_10005727 3300025935 Bacteria 7017
184 Ga0207679_10000002 3300025945 Bacteria 634491
185 Ga0207679_10000512 3300025945 Bacteria 26391
186 Ga0207679_10003738 3300025945 Bacteria 9438
187 Ga0207667_10044618 3300025949 Bacteria 4697
188 Ga0207667_10062311 3300025949 Bacteria 3900
189 Ga0207640_10000398 3300025981 Bacteria 27651
190 Ga0207678_10000018 3300026067 Bacteria 135549
191 Ga0207702_10000053 3300026078 Bacteria 137538
192 Ga0207698_10033947 3300026142 Bacteria 3713
193 Ga0209282_1000051 3300027666 Bacteria 107809
194 Ga0268266_10027396 3300028379 Bacteria 4846
195 Ga0265336_10000183 3300028666 Bacteria 44089
196 Ga0307515_10000399 3300028794 Bacteria 105068
197 Ga0265324_10000011 3300029957 Bacteria 218521
198 Ga0316183_1064842 3300030742 Bacteria 7124
199 Ga0265330_10000046 3300031235 Bacteria 108853
200 Ga0265332_10000024 3300031238 Bacteria 209663
201 Ga0265332_10000028 3300031238 Bacteria 184029
202 Ga0265328_10000099 3300031239 Bacteria 42676
203 Ga0265328_10000541 3300031239 Bacteria 17570
204 Ga0265325_10002230 3300031241 Bacteria 13143
205 Ga0265325_10004995 3300031241 Bacteria 8264
206 Ga0265340_10008429 3300031247 Bacteria 5567
207 Ga0265331_10000030 3300031250 Bacteria 215032
208 Ga0265327_10000020 3300031251 Bacteria 424552
209 Ga0265327_10000072 3300031251 Bacteria 215055
210 Ga0265327_10000320 3300031251 Bacteria 91776
211 Ga0265327_10000327 3300031251 Bacteria 90721
212 Ga0265327_10000438 3300031251 Bacteria 75623
213 Ga0265327_10022415 3300031251 Bacteria 3776
214 Ga0307513_10000004 3300031456 Bacteria 558931
215 Ga0307514_10000526 3300031649 Bacteria 75004
216 Ga0265314_10000054 3300031711 Bacteria 184029
217 Ga0265314_10007873 3300031711 Bacteria 9197
218 Ga0307516_10000178 3300031730 Bacteria 81997
219 Ga0307516_10004622 3300031730 Bacteria 16890
220 Ga0307411_10001167 3300032005 Bacteria 10333
221 Ga0307411_10001204 3300032005 Bacteria 10249
222 Ga0373939_0000014 3300035114 Bacteria 66133
223 Ga0373960_0000150 3300035121 Bacteria 11755
224 Ga0395899_0002372 3300037312 Bacteria 15328
225 Ga0395899_0007127 3300037312 Bacteria 8649
226 Ga0395899_0009595 3300037312 Bacteria 7430
227 Ga0395900_0001682 3300037418 Bacteria 25734
228 Ga0395900_0003949 3300037418 Bacteria 15828
229 Ga0395900_0020182 3300037418 Bacteria 6799
230 Ga0395898_0109921 3300037466 Bacteria 2642
231 Ga0395905_0000111 3300037471 Bacteria 136345
232 Ga0395905_0000728 3300037471 Bacteria 43400
233 Ga0395905_0012670 3300037471 Bacteria 8113
234 Ga0436361_0943202 3300039447 Bacteria 12249
235 Ga0439445_0000236 3300042004 Bacteria 10343
236 Ga0450918_000475 3300042531 Bacteria 8550
237 Ga0451577_0000013 3300042876 Bacteria 550689
238 Ga0451577_0000186 3300042876 Bacteria 131630
239 Ga0451577_0001782 3300042876 Bacteria 27637
240 Ga0451577_0045186 3300042876 Bacteria 3942
241 Ga0466972_0003776 3300044658 Bacteria 7533
242 Ga0453683_0000059 3300044673 Bacteria 187158
243 Ga0466965_0000943 3300044683 Bacteria 11195
244 Ga0466965_0006598 3300044683 Bacteria 5286
245 Ga0466961_0000077 3300044693 Bacteria 60661
246 Ga0453684_0000121 3300044712 Bacteria 341067
247 Ga0453684_0000585 3300044712 Bacteria 135647
248 Ga0453684_0000989 3300044712 Bacteria 92793
249 Ga0453684_0002679 3300044712 Bacteria 42376
250 Ga0453684_0003502 3300044712 Bacteria 35240
251 Ga0453684_0053139 3300044712 Bacteria 5290
252 Ga0466968_0000955 3300044735 Bacteria 10179
253 Ga0466957_0000038 3300044842 Bacteria 47609
254 Ga0466957_0009900 3300044842 Bacteria 5450
255 Ga0451576_0000018 3300045051 Bacteria 550689
256 Ga0451576_0000034 3300045051 Bacteria 390778
257 Ga0451576_0011310 3300045051 Bacteria 10155
258 Ga0451576_0040091 3300045051 Bacteria 4958
259 Ga0495617_000008 3300046452 Bacteria 340369
260 Ga0495590_0009530 3300046457 Bacteria 3685
261 Ga0495638_0001289 3300046460 Bacteria 23375
262 Ga0495638_0030324 3300046460 Bacteria 3482
263 Ga0495653_0000013 3300046463 Bacteria 250453
264 Ga0495650_0000272 3300046471 Bacteria 98846
265 Ga0495650_0000650 3300046471 Bacteria 45757
266 Ga0495582_0013286 3300046473 Bacteria 4533
267 Ga0495582_0016753 3300046473 Bacteria 4013
268 Ga0495605_0000239 3300046474 Bacteria 65496
269 Ga0495605_0000773 3300046474 Bacteria 23060
270 Ga0495605_0005254 3300046474 Bacteria 7553
271 Ga0495639_0024155 3300046475 Bacteria 2674
272 Ga0495584_0000085 3300046491 Bacteria 65081
273 Ga0495584_0000249 3300046491 Bacteria 38940
274 Ga0495584_0005578 3300046491 Bacteria 6654
275 Ga0495585_0002698 3300046492 Bacteria 12443
276 Ga0495596_0003052 3300046500 Bacteria 8657
277 Ga0495596_0003710 3300046500 Bacteria 7633
278 Ga0495607_0004238 3300046501 Bacteria 10633
279 Ga0495607_0011627 3300046501 Bacteria 5850
280 Ga0495583_0000113 3300046506 Bacteria 136475
281 Ga0495583_0000141 3300046506 Bacteria 121899
282 Ga0495583_0001163 3300046506 Bacteria 28607
283 Ga0495606_0000266 3300046507 Bacteria 92444
284 Ga0495606_0008922 3300046507 Bacteria 8587
285 Ga0495616_0000639 3300046513 Bacteria 26134
286 Ga0495616_0007060 3300046513 Bacteria 6748
287 Ga0495616_0011997 3300046513 Bacteria 4933
288 Ga0495628_0000623 3300046516 Bacteria 32379
289 Ga0495631_0001998 3300046518 Bacteria 11917
290 Ga0495631_0010495 3300046518 Bacteria 4580
291 Ga0495644_0000746 3300046523 Bacteria 13420
292 Ga0495648_0000403 3300046524 Bacteria 47579
293 Ga0495666_0005976 3300046526 Bacteria 6134
294 Ga0495642_0013691 3300046528 Bacteria 3141
295 Ga0495654_0000261 3300046530 Bacteria 47872
296 Ga0495609_0000021 3300046538 Bacteria 281770
297 Ga0495609_0000813 3300046538 Bacteria 23272
298 Ga0495609_0003082 3300046538 Bacteria 9771
299 Ga0495597_0000038 3300046542 Bacteria 113027
300 Ga0495597_0000757 3300046542 Bacteria 25516
301 Ga0495633_0001110 3300046558 Bacteria 21652
302 Ga0495668_0000220 3300046616 Bacteria 83065
303 Ga0495668_0001844 3300046616 Bacteria 19097
304 Ga0495668_0002963 3300046616 Bacteria 13323
305 Ga0495611_0000847 3300046648 Bacteria 16785
306 Ga0495611_0004283 3300046648 Bacteria 6200
307 Ga0495625_0002538 3300046660 Bacteria 19640
308 Ga0495625_0016808 3300046660 Bacteria 5745
309 Ga0495659_0000101 3300046664 Bacteria 37957
310 Ga0495661_0000091 3300046665 Bacteria 110008
311 Ga0495661_0000798 3300046665 Bacteria 29791
312 Ga0495661_0002534 3300046665 Bacteria 14014
313 Ga0495661_0015892 3300046665 Bacteria 5010
314 Ga0495588_0000083 3300046674 Bacteria 197018
315 Ga0495599_0003959 3300046678 Bacteria 8714
316 Ga0495646_0000348 3300046680 Bacteria 23747
317 Ga0495669_0000085 3300046684 Bacteria 62167
318 Ga0495613_0038944 3300046689 Bacteria 3525
319 Ga0495670_0014137 3300046691 Bacteria 3927
320 Ga0495671_0000282 3300046692 Bacteria 42563
321 Ga0495671_0005341 3300046692 Bacteria 7540
322 Ga0495589_0000012 3300046794 Bacteria 248641
323 Ga0495589_0000022 3300046794 Bacteria 196021
324 Ga0495660_0000044 3300046810 Bacteria 150926
325 Ga0495660_0001502 3300046810 Bacteria 15758
326 Ga0495660_0009635 3300046810 Bacteria 5631
327 Ga0495581_0035134 3300047315 Bacteria 2900
328 Ga0495636_0002428 3300047318 Bacteria 7140
329 Ga0495672_0000523 3300047320 Bacteria 43871
330 Ga0495672_0003100 3300047320 Bacteria 14522
331 Ga0495672_0006427 3300047320 Bacteria 9105
332 Ga0495672_0035567 3300047320 Bacteria 3067
333 Ga0495676_0000214 3300047321 Bacteria 46256
334 Ga0495680_0010677 3300047322 Bacteria 8190
335 Ga0495683_0003539 3300047323 Bacteria 9088
336 Ga0495683_0004958 3300047323 Bacteria 7447
337 Ga0495687_000099 3300047443 Bacteria 132139
338 Ga0495687_000151 3300047443 Bacteria 105607
339 Ga0495687_000214 3300047443 Bacteria 83035
340 Ga0495687_000284 3300047443 Bacteria 66578
341 Ga0495687_000807 3300047443 Bacteria 33697
342 Ga0495687_017505 3300047443 Bacteria 3573
343 Ga0495677_0000046 3300047445 Bacteria 73466
344 Ga0495677_0001126 3300047445 Bacteria 10691
345 Ga0495677_0001445 3300047445 Bacteria 9518
346 Ga0495685_000112 3300047447 Bacteria 28941
347 Ga0495681_0000334 3300047470 Bacteria 37186
348 Ga0495681_0001031 3300047470 Bacteria 21270
349 Ga0495686_0000328 3300047472 Bacteria 78155
350 Ga0495686_0000348 3300047472 Bacteria 75868
351 Ga0495602_0073308 3300048088 Bacteria 2915
352 Ga0495614_0000591 3300048089 Bacteria 15155
353 Ga0495626_0000021 3300048091 Bacteria 217213
354 Ga0495626_0001996 3300048091 Bacteria 15058
355 Ga0495626_0003540 3300048091 Bacteria 9982
356 Ga0495626_0003582 3300048091 Bacteria 9896
357 Ga0496102_0001908 3300048905 Bacteria 17972
358 Ga0496102_0012280 3300048905 Bacteria 7408
359 Ga0496105_0000270 3300048908 Bacteria 34384
360 Ga0496110_0000085 3300048913 Bacteria 49001
361 Ga0496112_0001641 3300048915 Bacteria 17350
362 Ga0496114_0036745 3300048917 Bacteria 4049
363 Ga0496115_0014912 3300048918 Bacteria 5892
364 Ga0496121_0007627 3300048924 Bacteria 13013
365 Ga0496122_0000319 3300048925 Bacteria 105543
366 Ga0496122_0000432 3300048925 Bacteria 87744
367 Ga0496122_0017715 3300048925 Bacteria 6633
368 Ga0496123_0000117 3300048926 Bacteria 161679
369 Ga0496123_0000295 3300048926 Bacteria 97562
370 Ga0496123_0001349 3300048926 Bacteria 34606
371 Ga0496124_0017546 3300048927 Bacteria 6741
372 Ga0496125_0001908 3300048928 Bacteria 28521
373 Ga0496125_0028268 3300048928 Bacteria 5069
374 Ga0495678_000436 3300049459 Bacteria 41678
375 Ga0495678_000443 3300049459 Bacteria 41243
376 Ga0495678_001070 3300049459 Bacteria 23187
377 Ga0495682_0000532 3300049460 Bacteria 26301
378 Ga0495682_0005951 3300049460 Bacteria 4998
379 Ga0501031_0001732 3300049568 Bacteria 13673
380 Ga0501032_0001898 3300049569 Bacteria 16499
381 Ga0501034_0000280 3300049571 Bacteria 91814
382 Ga0501034_0082040 3300049571 Bacteria 3226
383 Ga0501036_0000319 3300049572 Bacteria 33522
384 Ga0501037_0001674 3300049573 Bacteria 16119
385 Ga0501043_0000090 3300049579 Bacteria 81336
386 Ga0501043_0002846 3300049579 Bacteria 14452
387 Ga0501043_0081127 3300049579 Bacteria 2548
388 Ga0501046_0000126 3300049580 Bacteria 81334
389 Ga0501046_0004743 3300049580 Bacteria 12270
390 Ga0501046_0091872 3300049580 Bacteria 2334
391 Ga0501047_0000160 3300049581 Bacteria 81946
392 Ga0501047_0003483 3300049581 Bacteria 14876
393 Ga0501047_0046539 3300049581 Bacteria 4192
394 Ga0501035_0006275 3300049822 Bacteria 11180
395 Ga0501044_0000322 3300049823 Bacteria 60519
396 Ga0501045_0000882 3300049824 Bacteria 19499
397 nmdc:mga07m45_7547_c1 3300050496 Bacteria 5561
398 Ga0466962_0008014 3300061719 Bacteria 5066
399 2511246396 2511231002 Bacteria 5042903
400 2511247722 2511231003 Bacteria 5606035
401 2511386673 2511231026 Bacteria 5225445
402 2526210623 2526164512 Bacteria 4025691
403 2548847651 2547132512 Bacteria 3416496
404 2550692892 2548876994 Bacteria 4904866
405 2597030349 2596583598 Bacteria 5251611
406 2599447807 2599185178 Bacteria 5365746
407 2599620745 2599185214 Bacteria 8209958
408 2599674044 2599185226 Bacteria 8233575
409 2599678639 2599185227 Bacteria 8246414
410 2599690256 2599185229 Bacteria 8216126
411 2643744098 2643221544 Bacteria 5886209
412 2643798486 2643221556 Bacteria 7251154
413 2643867301 2643221570 Bacteria 5103772
414 2643932432 2643221585 Bacteria 5812563
415 2643990218 2643221596 Bacteria 5006805
416 2644244650 2643221644 Bacteria 6865017
417 2644253087 2643221645 Bacteria 7207331
418 2644295711 2643221652 Bacteria 5140275
419 2644313683 2643221656 Bacteria 5809961
420 2644354850 2643221664 Bacteria 7272945
421 2644475492 2643221684 Bacteria 7145183
422 2723876879 2721755763 Bacteria 4464185
423 2738738004 2738541280 Bacteria 6630198
424 2738842215 2738541300 Bacteria 6675882
425 2739250241 2738543013 Bacteria 5618633
426 2739273074 2738543018 Bacteria 6718814
427 2739342118 2738543030 Bacteria 6719714
428 2739613703 2739367655 Bacteria 4051151
429 2808983871 2808606386 Bacteria 4471946
430 2809130931 2808606415 Bacteria 4576710
431 2809150734 2808606419 Bacteria 4576925
432 2819542850 2818991436 Bacteria 5376622
433 2819593229 2818991445 Bacteria 4955017
434 2831867903 2831864461 Bacteria 6502356
435 2834641485 2834641062 Bacteria 5559922
436 2842679434 2842677519 Bacteria 5615038
437 2842734087 2842733646 Bacteria 5716726
438 2842749638 2842747753 Bacteria 5578255
439 2852622251 2852618963 Bacteria 4577824
440 2855736580 2855730933 Bacteria 7047938
441 2855773517 2855767633 Bacteria 7049357
442 2857565118 2857564685 Bacteria 6290584
443 2881101457 2881101125 Bacteria 4590519
444 2881418491 2881412998 Bacteria 6492157
445 2881928781 2881927736 Bacteria 3993927
446 2884812377 2884811622 Bacteria 5552861
447 2884838127 2884836552 Bacteria 5219991
448 2884854420 2884852848 Bacteria 5221161
449 2885197169 2885192300 Bacteria 5882526
450 2885266617 2885266251 Bacteria 4796748
451 2886849864 2886848708 Bacteria 5632523
452 2887376529 2887375801 Bacteria 5334027
453 2895513328 2895511927 Bacteria 6802080
454 2896154464 2896154374 Bacteria 5221518
455 2900580775 2900577576 Bacteria 5438534
456 2919462589 2919462493 Bacteria 5817112
457 2928059523 2928058823 Bacteria 5520022
458 2928073471 2928070936 Bacteria 8062541
459 2928120886 2928115317 Bacteria 6477646
460 2945949620 2945945610 Bacteria 5951079
461 2974322240 2974320154 Bacteria 4571377
462 2990711062 2990710928 Bacteria 5002431
463 644747081 644736347 Bacteria 6476522
464 8047674187 8047673197 Bacteria 7395230
465 Ga0395905_0027170
466 JGI24741J21665_1000400
467 JGI25155J39150_1000117
468 JGI25155J39150_1000227
469 JGI25156J39149_1000108
470 JGI25156J39149_1001271
471 JGI25162J39368_1000001
472 JGI25162J39368_1003616
473 JGI25154J39366_1000222
474 JGI25154J39366_1000582
475 JGI25154J39366_1000586
476 JGI25157J39369_1000120
477 JGI25152J39213_1001423
478 JGI25159J45721_1000313
479 JGI25151J46595_10001055
480 JGI25151J46595_10005302
481 JGI25151J46595_10006849
482 JGI25165J46597_1000001
483 rootL2_10007230
484 JGI25160J50197_1000226
485 JGI25160J50197_1001607
486 JGI25161J50226_1000037
487 Ga0055538_1000001
488 Ga0055539_1000001
489 Ga0055539_1000201
490 Ga0055533_1000003
491 Ga0055533_1002212
492 Ga0055532_1000051
493 Ga0055532_1000073
494 Ga0055525_1000003
495 Ga0055525_1000073
496 Ga0055525_1000222
497 Ga0055527_1001022
498 Ga0055535_1000055
499 Ga0055529_1001030
500 Ga0055526_1000093
501 Ga0055526_1007425
502 Ga0055526_1012267
503 Ga0055524_1002933
504 Ga0055524_1004371
505 Ga0055536_1000095
506 Ga0055534_1002931
507 Ga0055528_1003051
508 Ga0055540_1000212
509 Ga0055531_10000775
510 Ga0055541_1000001
511 Ga0055541_1000347
512 Ga0055543_1001262
513 Ga0055543_1006333
514 Ga0065165_1000350
515 Ga0065165_1000555
516 Ga0070660_100000336
517 Ga0070661_100000061
518 Ga0070661_100001182
519 Ga0070661_100013724
520 Ga0070669_100012925
521 Ga0070671_100009682
522 Ga0070659_100000567
523 Ga0070659_100004207
524 Ga0070663_100000009
525 Ga0068855_100011447
526 Ga0070664_100000010
527 Ga0070664_100002550
528 Ga0068857_100108282
529 Ga0068854_100001632
530 Ga0068856_100000069
531 Ga0075366_10000917
532 Ga0075370_10003051
533 Ga0099823_1000065
534 Ga0099826_10000028
535 Ga0105240_10016280
536 Ga0105248_10000445
537 Ga0105238_10006674
538 Ga0157319_1000004
539 Ga0157373_10007730
540 Ga0157371_10000088
541 Ga0157370_10000041
542 Ga0157369_10025853
543 Ga0163162_10110043
544 Ga0157372_10000097
545 Ga0182006_1008959
546 Ga0182007_10001630
547 Ga0182007_10002076
548 Ga0182005_1000117
549 Ga0183362_10003
550 Ga0206351_10450512
551 Ga0154015_1045000
552 Ga0213872_10021872
553 Ga0209435_100028
554 Ga0209435_100345
555 Ga0209784_100004
556 Ga0209784_100008
557 Ga0209784_100262
558 Ga0209566_100004
559 Ga0209566_100006
560 Ga0209566_100582
561 Ga0209566_100612
562 Ga0209674_100006
563 Ga0209674_100045
564 Ga0209674_100114
565 Ga0209672_100950
566 Ga0209672_101107
567 Ga0209147_100004
568 Ga0209147_100005
569 Ga0209563_100007
570 Ga0209563_100009
571 Ga0209563_100016
572 Ga0209563_100088
573 Ga0209563_103444
574 Ga0209437_100004
575 Ga0209437_100053
576 Ga0209258_100007
577 Ga0209258_100667
578 Ga0207425_1000135
579 Ga0207425_1001058
580 Ga0209646_1000021
581 Ga0209646_1000027
582 Ga0209646_1000095
583 Ga0209026_1000110
584 Ga0209026_1001352
585 Ga0209677_100005
586 Ga0209677_100008
587 Ga0209677_101863
588 Ga0209677_102194
589 Ga0209148_1000019
590 Ga0209148_1000760
591 Ga0209759_1000080
592 Ga0209759_1000115
593 Ga0209759_1000155
594 Ga0209759_1005152
595 Ga0209129_1000043
596 Ga0209129_1000147
597 Ga0209233_1000005
598 Ga0209565_1000102
599 Ga0209565_1000136
600 Ga0209565_1000715
601 Ga0209565_1006764
602 Ga0209455_1000011
603 Ga0209673_1000189
604 Ga0209673_1006562
605 Ga0209130_1002577
606 Ga0209675_1000212
607 Ga0209675_1000358
608 Ga0209675_1004961
609 Ga0209676_1000066
610 Ga0209676_1000145
611 Ga0209025_1000040
612 Ga0209025_1001071
613 Ga0209025_1002105
614 Ga0209025_1002636
615 Ga0209564_1000007
616 Ga0209564_1000014
617 Ga0209564_1000021
618 Ga0209564_1000344
619 Ga0209564_1001392
620 Ga0209564_1004455
621 Ga0209758_1000093
622 Ga0209758_1000199
623 Ga0209758_1000248
624 Ga0209050_1000023
625 Ga0209256_1000003
626 Ga0209256_1000151
627 Ga0209256_1002457
628 Ga0209256_1003984
629 Ga0207426_1000049
630 Ga0207426_1000145
631 Ga0209051_1000017
632 Ga0209051_1000241
633 Ga0209051_1003002
634 Ga0209051_1009826
635 Ga0209257_1000015
636 Ga0209257_1000041
637 Ga0209257_1001234
638 Ga0209257_1001568
639 Ga0207705_10001598
640 Ga0207695_10004380
641 Ga0207695_10013045
642 Ga0207657_10001256
643 Ga0207649_10000860
644 Ga0207649_10005512
645 Ga0207690_10001156
646 Ga0207690_10001785
647 Ga0207709_10005727
648 Ga0207679_10000002
649 Ga0207679_10000512
650 Ga0207679_10003738
651 Ga0207667_10044618
652 Ga0207667_10062311
653 Ga0207640_10000398
654 Ga0207678_10000018
655 Ga0207702_10000053
656 Ga0207698_10033947
657 Ga0209282_1000051
658 Ga0268266_10027396
659 Ga0265336_10000183
660 Ga0307515_10000399
661 Ga0265324_10000011
662 Ga0316183_1064842
663 Ga0265330_10000046
664 Ga0265332_10000024
665 Ga0265332_10000028
666 Ga0265328_10000099
667 Ga0265328_10000541
668 Ga0265325_10002230
669 Ga0265325_10004995
670 Ga0265340_10008429
671 Ga0265331_10000030
672 Ga0265327_10000020
673 Ga0265327_10000072
674 Ga0265327_10000320
675 Ga0265327_10000327
676 Ga0265327_10000438
677 Ga0265327_10022415
678 Ga0307513_10000004
679 Ga0307514_10000526
680 Ga0265314_10000054
681 Ga0265314_10007873
682 Ga0307516_10000178
683 Ga0307516_10004622
684 Ga0307411_10001167
685 Ga0307411_10001204
686 Ga0373939_0000014
687 Ga0373960_0000150
688 Ga0395899_0002372
689 Ga0395899_0007127
690 Ga0395899_0009595
691 Ga0395900_0001682
692 Ga0395900_0003949
693 Ga0395900_0020182
694 Ga0395898_0109921
695 Ga0395905_0000111
696 Ga0395905_0000728
697 Ga0395905_0012670
698 Ga0436361_0943202
699 Ga0439445_0000236
700 Ga0450918_000475
701 Ga0451577_0000013
702 Ga0451577_0000186
703 Ga0451577_0001782
704 Ga0451577_0045186
705 Ga0466972_0003776
706 Ga0453683_0000059
707 Ga0466965_0000943
708 Ga0466965_0006598
709 Ga0466961_0000077
710 Ga0453684_0000121
711 Ga0453684_0000585
712 Ga0453684_0000989
713 Ga0453684_0002679
714 Ga0453684_0003502
715 Ga0453684_0053139
716 Ga0466968_0000955
717 Ga0466957_0000038
718 Ga0466957_0009900
719 Ga0451576_0000018
720 Ga0451576_0000034
721 Ga0451576_0011310
722 Ga0451576_0040091
723 Ga0495617_000008
724 Ga0495590_0009530
725 Ga0495638_0001289
726 Ga0495638_0030324
727 Ga0495653_0000013
728 Ga0495650_0000272
729 Ga0495650_0000650
730 Ga0495582_0013286
731 Ga0495582_0016753
732 Ga0495605_0000239
733 Ga0495605_0000773
734 Ga0495605_0005254
735 Ga0495639_0024155
736 Ga0495584_0000085
737 Ga0495584_0000249
738 Ga0495584_0005578
739 Ga0495585_0002698
740 Ga0495596_0003052
741 Ga0495596_0003710
742 Ga0495607_0004238
743 Ga0495607_0011627
744 Ga0495583_0000113
745 Ga0495583_0000141
746 Ga0495583_0001163
747 Ga0495606_0000266
748 Ga0495606_0008922
749 Ga0495616_0000639
750 Ga0495616_0007060
751 Ga0495616_0011997
752 Ga0495628_0000623
753 Ga0495631_0001998
754 Ga0495631_0010495
755 Ga0495644_0000746
756 Ga0495648_0000403
757 Ga0495666_0005976
758 Ga0495642_0013691
759 Ga0495654_0000261
760 Ga0495609_0000021
761 Ga0495609_0000813
762 Ga0495609_0003082
763 Ga0495597_0000038
764 Ga0495597_0000757
765 Ga0495633_0001110
766 Ga0495668_0000220
767 Ga0495668_0001844
768 Ga0495668_0002963
769 Ga0495611_0000847
770 Ga0495611_0004283
771 Ga0495625_0002538
772 Ga0495625_0016808
773 Ga0495659_0000101
774 Ga0495661_0000091
775 Ga0495661_0000798
776 Ga0495661_0002534
777 Ga0495661_0015892
778 Ga0495588_0000083
779 Ga0495599_0003959
780 Ga0495646_0000348
781 Ga0495669_0000085
782 Ga0495613_0038944
783 Ga0495670_0014137
784 Ga0495671_0000282
785 Ga0495671_0005341
786 Ga0495589_0000012
787 Ga0495589_0000022
788 Ga0495660_0000044
789 Ga0495660_0001502
790 Ga0495660_0009635
791 Ga0495581_0035134
792 Ga0495636_0002428
793 Ga0495672_0000523
794 Ga0495672_0003100
795 Ga0495672_0006427
796 Ga0495672_0035567
797 Ga0495676_0000214
798 Ga0495680_0010677
799 Ga0495683_0003539
800 Ga0495683_0004958
801 Ga0495687_000099
802 Ga0495687_000151
803 Ga0495687_000214
804 Ga0495687_000284
805 Ga0495687_000807
806 Ga0495687_017505
807 Ga0495677_0000046
808 Ga0495677_0001126
809 Ga0495677_0001445
810 Ga0495685_000112
811 Ga0495681_0000334
812 Ga0495681_0001031
813 Ga0495686_0000328
814 Ga0495686_0000348
815 Ga0495602_0073308
816 Ga0495614_0000591
817 Ga0495626_0000021
818 Ga0495626_0001996
819 Ga0495626_0003540
820 Ga0495626_0003582
821 Ga0496102_0001908
822 Ga0496102_0012280
823 Ga0496105_0000270
824 Ga0496110_0000085
825 Ga0496112_0001641
826 Ga0496114_0036745
827 Ga0496115_0014912
828 Ga0496121_0007627
829 Ga0496122_0000319
830 Ga0496122_0000432
831 Ga0496122_0017715
832 Ga0496123_0000117
833 Ga0496123_0000295
834 Ga0496123_0001349
835 Ga0496124_0017546
836 Ga0496125_0001908
837 Ga0496125_0028268
838 Ga0495678_000436
839 Ga0495678_000443
840 Ga0495678_001070
841 Ga0495682_0000532
842 Ga0495682_0005951
843 Ga0501031_0001732
844 Ga0501032_0001898
845 Ga0501034_0000280
846 Ga0501034_0082040
847 Ga0501036_0000319
848 Ga0501037_0001674
849 Ga0501043_0000090
850 Ga0501043_0002846
851 Ga0501043_0081127
852 Ga0501046_0000126
853 Ga0501046_0004743
854 Ga0501046_0091872
855 Ga0501047_0000160
856 Ga0501047_0003483
857 Ga0501047_0046539
858 Ga0501035_0006275
859 Ga0501044_0000322
860 Ga0501045_0000882
861 nmdc:mga07m45_7547_c1
862 Ga0466962_0008014
863 2511246396
864 2511247722
865 2511386673
866 2526210623
867 2548847651
868 2550692892
869 2597030349
870 2599447807
871 2599620745
872 2599674044
873 2599678639
874 2599690256
875 2643744098
876 2643798486
877 2643867301
878 2643932432
879 2643990218
880 2644244650
881 2644253087
882 2644295711
883 2644313683
884 2644354850
885 2644475492
886 2723876879
887 2738738004
888 2738842215
889 2739250241
890 2739273074
891 2739342118
892 2739613703
893 2808983871
894 2809130931
895 2809150734
896 2819542850
897 2819593229
898 2831867903
899 2834641485
900 2842679434
901 2842734087
902 2842749638
903 2852622251
904 2855736580
905 2855773517
906 2857565118
907 2881101457
908 2881418491
909 2881928781
910 2884812377
911 2884838127
912 2884854420
913 2885197169
914 2885266617
915 2886849864
916 2887376529
917 2895513328
918 2896154464
919 2900580775
920 2919462589
921 2928059523
922 2928073471
923 2928120886
924 2945949620
925 2974322240
926 2990711062
927 644747081
928 8047674187

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00664

ABC_membrane

ABC transporter transmembrane region

185

462

0.94

PF00005

ABC_tran

ABC transporter

528

677

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q7l-assembly3.cif.gz_C structure of nbd288 of tm287/288 0.9306 538 775
4q7l-assembly1.cif.gz_A structure of nbd288 of tm287/288 0.9293 538 774
6bzr-assembly1.cif.gz_B human abcc6 nbd2 in adp-bound state 0.9254 538 775
4q7l-assembly2.cif.gz_B structure of nbd288 of tm287/288 0.9237 538 775
6bzr-assembly2.cif.gz_A human abcc6 nbd2 in adp-bound state 0.922 538 775
ID Description Score Start End Superfamily
af_Q2FVJ2_326_574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9311 529 778 3.40.50.300
af_A0A0P0VTT5_46_316_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9285 531 765 3.40.50.300
af_Q61102_466_725_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9251 537 784 3.40.50.300
af_Q9R1S7_1246_1490_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.924 537 768 3.40.50.300
af_Q2FVJ2_326_574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.924 529 778 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A4P6PA45-F1-model_v4 ATP-binding cassette domain-containing protein 0.9418 504 774 GO:0005524
GO:0005886
GO:0016887
GO:0034040
AF-A0A847KX24-F1-model_v4 deleted 0.9283 565 780
AF-A0A7V9FMT5-F1-model_v4 ATP-binding cassette domain-containing protein 0.9279 554 777 GO:0005524
GO:0016887
GO:0034040
AF-X1NN55-F1-model_v4 ABC transporter domain-containing protein 0.9242 581 774 GO:0005524
GO:0005743
GO:0015421
GO:0016887
GO:0090374
AF-A0A139QMA0-F1-model_v4 ABC transporter, ATP-binding/permease protein 0.924 587 775 GO:0005524
GO:0015421
GO:0016887
GO:0090374

Map