F449335

General Info

Members Datasets Scaffolds Average Seq Length
464 318 928 306

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0333996|Ga0436364_0333996_267_1343
Length 358
Sequence LRRFEPWELLSFLLAQPTSARPPQKNARNCPNKLVDKSNYLPDTGKHSIVAGNAPLDKRVEAIRRFNRFYTQKIGVVQEQYLSSRLSLAKARILYELAHREDATASELSRDLGLDAGYLSRTLRDFEERGLVLKKTSGADRRQSLLTLTRKGRRVLEPLEQRAHAETSKLLSDIPESNQKRLVAAIQTIEDVLGERPAPGAYTLRQHRAGDMGLVIHRHGVLYANAYGWNAEFEALVAKIAGEFLEHYDAKRERCWIAEKDGDFAGSVFLVKKDDRTAKLRLLLVEPSARGVGIGSRLVDECIRFAREGGYRRIILWTQSVLTAARRIYERAGFTCVEKQPHHSFGHDLVGETWELDL

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
90 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
141 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
145 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
146 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
147 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
150 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
151 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
152 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
163 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
166 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
167 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
168 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
169 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
173 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
174 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
182 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
191 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
192 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
193 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
194 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
195 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
196 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
197 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
200 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
201 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
202 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
203 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
204 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
205 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
206 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
209 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
218 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
219 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
220 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
221 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
222 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
223 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
235 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
238 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
248 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
249 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
250 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
251 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
252 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
253 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
262 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
263 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
270 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
271 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
272 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
273 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
274 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
275 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
276 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
277 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
278 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
279 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
280 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
281 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
282 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
283 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
284 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
285 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
286 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
287 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
288 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
289 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
290 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
291 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
292 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
293 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
294 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
295 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
296 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
297 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
298 2738543024 Aminobacter sp. AP02 Isolate Unclassified
299 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
300 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
301 2818991450 Burkholderia sp. 604 Isolate Unclassified
302 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
303 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
304 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
305 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
306 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
307 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
308 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
309 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
310 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
311 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
312 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
313 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
314 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
315 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
316 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
317 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
318 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.89
Metatranscriptomes 0
Isolates 7.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.74
Nodule 1.51
Rhizoplane 2.37
Rhizosphere 81.68
Stem 0
Stem Tuber 0
Unclassified 5.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0333996 3300037853 Bacteria 2221
2 JGI24739J22299_10001199 3300001989 Bacteria 9705
3 JGI24739J22299_10009631 3300001989 Bacteria 3597
4 JGI24735J21928_10022852 3300002067 Bacteria 1900
5 JGI25406J46586_10050109 3300003203 Bacteria 1404
6 rootL2_10251488 3300003322 Bacteria 1832
7 Ga0055540_1006456 3300003792 Bacteria 4649
8 Ga0055531_10000542 3300003794 Bacteria 33438
9 Ga0070658_10235538 3300005327 Bacteria 1551
10 Ga0070676_10038673 3300005328 Bacteria 2756
11 Ga0070676_10115293 3300005328 Bacteria 1678
12 Ga0070690_100074574 3300005330 Bacteria 2210
13 Ga0070670_100001835 3300005331 Bacteria 17303
14 Ga0070670_100105498 3300005331 Bacteria 2428
15 Ga0068869_100113702 3300005334 Bacteria 2062
16 Ga0068869_100182957 3300005334 Bacteria 1644
17 Ga0070666_10023284 3300005335 Bacteria 4032
18 Ga0070666_10330256 3300005335 Bacteria 1089
19 Ga0070680_100196828 3300005336 Unclassified 1699
20 Ga0068868_100060375 3300005338 Bacteria 3002
21 Ga0070687_100049821 3300005343 Bacteria 2160
22 Ga0070668_100003318 3300005347 Bacteria 11876
23 Ga0070668_100054051 3300005347 Bacteria 3097
24 Ga0070668_100059991 3300005347 Bacteria 2945
25 Ga0070669_100008602 3300005353 Bacteria 7284
26 Ga0070669_100041591 3300005353 Bacteria 3343
27 Ga0070675_100000320 3300005354 Bacteria 32325
28 Ga0070675_100014721 3300005354 Bacteria 6171
29 Ga0070673_100017184 3300005364 Bacteria 5136
30 Ga0070667_100007876 3300005367 Bacteria 8839
31 Ga0070667_100143004 3300005367 Unclassified 2096
32 Ga0070711_100005710 3300005439 Bacteria 7460
33 Ga0070705_100099382 3300005440 Bacteria 1833
34 Ga0070694_100238361 3300005444 Bacteria 1371
35 Ga0070708_100151970 3300005445 Bacteria 2153
36 Ga0070708_100403035 3300005445 Bacteria 1290
37 Ga0070663_100033735 3300005455 Bacteria 3539
38 Ga0070678_100281910 3300005456 Bacteria 1405
39 Ga0070681_10055660 3300005458 Bacteria 3938
40 Ga0068867_100000289 3300005459 Bacteria 32971
41 Ga0070707_100570780 3300005468 Unclassified 1093
42 Ga0070698_100021240 3300005471 Bacteria 6802
43 Ga0070698_100192132 3300005471 Bacteria 1979
44 Ga0070698_100205277 3300005471 Bacteria 1906
45 Ga0070698_100270774 3300005471 Bacteria 1630
46 Ga0070699_100096132 3300005518 Bacteria 2594
47 Ga0070699_100132570 3300005518 Bacteria 2197
48 Ga0070679_100002534 3300005530 Bacteria 16562
49 Ga0070697_100104969 3300005536 Bacteria 2350
50 Ga0068853_100325238 3300005539 Bacteria 1426
51 Ga0070672_100433626 3300005543 Bacteria 1130
52 Ga0070686_100104542 3300005544 Bacteria 1918
53 Ga0070686_100263613 3300005544 Bacteria 1264
54 Ga0070695_100012950 3300005545 Bacteria 5007
55 Ga0070696_100106742 3300005546 Unclassified 2013
56 Ga0070704_100044107 3300005549 Bacteria 3096
57 Ga0070704_100109486 3300005549 Bacteria 2099
58 Ga0068855_100124623 3300005563 Bacteria 2947
59 Ga0068855_100167004 3300005563 Bacteria 2494
60 Ga0068857_100017897 3300005577 Bacteria 6213
61 Ga0068856_100150928 3300005614 Unclassified 2333
62 Ga0070702_100218324 3300005615 Bacteria 1273
63 Ga0068859_100007957 3300005617 Bacteria 10753
64 Ga0068859_100118451 3300005617 Bacteria 2713
65 Ga0068859_100310342 3300005617 Bacteria 1671
66 Ga0068864_100068636 3300005618 Bacteria 3080
67 Ga0068861_100215025 3300005719 Bacteria 1621
68 Ga0068870_10042128 3300005840 Bacteria 2376
69 Ga0068863_100006084 3300005841 Bacteria 11838
70 Ga0068863_100144789 3300005841 Unclassified 2272
71 Ga0068863_100458692 3300005841 Unclassified 1251
72 Ga0068858_100072308 3300005842 Bacteria 3200
73 Ga0068858_100604937 3300005842 Bacteria 1063
74 Ga0068860_100002227 3300005843 Bacteria 20410
75 Ga0068860_100006589 3300005843 Bacteria 11660
76 Ga0068862_100002329 3300005844 Bacteria 16935
77 Ga0068862_100083405 3300005844 Bacteria 2775
78 Ga0068862_100514550 3300005844 Bacteria 1138
79 Ga0068862_100605333 3300005844 Bacteria 1052
80 Ga0081539_10018901 3300005985 Bacteria 4747
81 Ga0070717_10447781 3300006028 Bacteria 1163
82 Ga0070716_100133255 3300006173 Bacteria 1574
83 Ga0070712_100029338 3300006175 Bacteria 3687
84 Ga0075362_10008656 3300006177 Bacteria 3906
85 Ga0075362_10037089 3300006177 Bacteria 2135
86 Ga0097621_100153541 3300006237 Unclassified 1975
87 Ga0097621_100235270 3300006237 Bacteria 1600
88 Ga0068871_100149157 3300006358 Bacteria 1993
89 Ga0075430_100034455 3300006846 Bacteria 4297
90 Ga0075430_100363482 3300006846 Bacteria 1195
91 Ga0075431_100017303 3300006847 Bacteria 7327
92 Ga0075431_100023309 3300006847 Bacteria 6333
93 Ga0075431_100220589 3300006847 Bacteria 1934
94 Ga0075433_10000327 3300006852 Bacteria 29218
95 Ga0075434_100000276 3300006871 Bacteria 36488
96 Ga0075429_100090391 3300006880 Bacteria 2670
97 Ga0075429_100320417 3300006880 Bacteria 1357
98 Ga0075436_100006029 3300006914 Bacteria 8320
99 Ga0075436_100006750 3300006914 Bacteria 7858
100 Ga0075436_100020724 3300006914 Bacteria 4511
101 Ga0075436_100025039 3300006914 Bacteria 4103
102 Ga0097620_100007958 3300006931 Bacteria 10753
103 Ga0097620_100118455 3300006931 Bacteria 2713
104 Ga0097620_100310381 3300006931 Bacteria 1671
105 Ga0075435_100015810 3300007076 Bacteria 5680
106 Ga0075435_100032859 3300007076 Bacteria 4099
107 Ga0075435_100116473 3300007076 Bacteria 2226
108 Ga0075435_100117732 3300007076 Bacteria 2214
109 Ga0105251_10000055 3300009011 Bacteria 105044
110 Ga0105240_10010282 3300009093 Bacteria 13175
111 Ga0105240_10693495 3300009093 Bacteria 1112
112 Ga0111539_10476566 3300009094 Bacteria 1453
113 Ga0111539_10573559 3300009094 Bacteria 1314
114 Ga0111539_10920660 3300009094 Bacteria 1017
115 Ga0105245_10000189 3300009098 Bacteria 58162
116 Ga0105245_10151958 3300009098 Bacteria 2190
117 Ga0105247_10097930 3300009101 Bacteria 1871
118 Ga0114129_10091499 3300009147 Bacteria 4214
119 Ga0114129_10190395 3300009147 Bacteria 2786
120 Ga0105241_10068266 3300009174 Bacteria 2754
121 Ga0105242_10101543 3300009176 Unclassified 2438
122 Ga0105242_10132471 3300009176 Bacteria 2154
123 Ga0105248_10005459 3300009177 Bacteria 13973
124 Ga0105248_10180503 3300009177 Bacteria 2379
125 Ga0105248_10271554 3300009177 Bacteria 1909
126 Ga0105238_10444172 3300009551 Bacteria 1293
127 Ga0105249_10175535 3300009553 Bacteria 2081
128 Ga0157369_10174639 3300013105 Bacteria 2262
129 Ga0157378_10000560 3300013297 Bacteria 35416
130 Ga0157378_10117056 3300013297 Unclassified 2451
131 Ga0163162_10017425 3300013306 Bacteria 7027
132 Ga0163162_10025684 3300013306 Bacteria 5824
133 Ga0163162_10412509 3300013306 Bacteria 1483
134 Ga0157375_10566938 3300013308 Unclassified 1296
135 Ga0163163_10161005 3300014325 Bacteria 2290
136 Ga0157380_10101297 3300014326 Bacteria 2399
137 Ga0157380_10458134 3300014326 Bacteria 1227
138 Ga0182008_10007829 3300014497 Bacteria 5876
139 Ga0182008_10035200 3300014497 Bacteria 2509
140 Ga0182008_10116744 3300014497 Bacteria 1324
141 Ga0157377_10064985 3300014745 Bacteria 2094
142 Ga0157379_10002376 3300014968 Bacteria 15732
143 Ga0157379_10065344 3300014968 Bacteria 3252
144 Ga0157379_10070427 3300014968 Bacteria 3129
145 Ga0157376_10019079 3300014969 Bacteria 5275
146 Ga0157376_10029177 3300014969 Bacteria 4392
147 Ga0182006_1010665 3300015261 Bacteria 4076
148 Ga0182006_1033685 3300015261 Bacteria 2053
149 Ga0182007_10000891 3300015262 Bacteria 16555
150 Ga0163161_10001512 3300017792 Bacteria 17202
151 Ga0213872_10030416 3300021361 Bacteria 2475
152 Ga0213876_10021599 3300021384 Unclassified 3404
153 Ga0209759_1000175 3300025256 Bacteria 106788
154 Ga0209673_1008337 3300025273 Bacteria 4621
155 Ga0209673_1010644 3300025273 Bacteria 3858
156 Ga0209050_1005169 3300025298 Bacteria 8358
157 Ga0209051_1003393 3300025303 Bacteria 10451
158 Ga0209257_1000012 3300025304 Bacteria 1111138
159 Ga0207713_1000089 3300025735 Bacteria 152927
160 Ga0207713_1000106 3300025735 Bacteria 137911
161 Ga0207710_10174310 3300025900 Bacteria 1053
162 Ga0207647_10000540 3300025904 Bacteria 30173
163 Ga0207645_10168846 3300025907 Bacteria 1433
164 Ga0207705_10087230 3300025909 Bacteria 2281
165 Ga0207671_10140366 3300025914 Bacteria 1861
166 Ga0207693_10086871 3300025915 Unclassified 2451
167 Ga0207693_10211002 3300025915 Bacteria 1526
168 Ga0207652_10015807 3300025921 Bacteria 6149
169 Ga0207646_10052982 3300025922 Bacteria 3630
170 Ga0207681_10044547 3300025923 Bacteria 2974
171 Ga0207681_10314871 3300025923 Bacteria 1242
172 Ga0207694_10154876 3300025924 Bacteria 1848
173 Ga0207650_10005680 3300025925 Bacteria 8516
174 Ga0207650_10118312 3300025925 Unclassified 2060
175 Ga0207659_10000798 3300025926 Bacteria 18626
176 Ga0207687_10000838 3300025927 Bacteria 20789
177 Ga0207687_10035230 3300025927 Bacteria 3403
178 Ga0207700_10276564 3300025928 Bacteria 1443
179 Ga0207644_10129472 3300025931 Bacteria 1930
180 Ga0207706_10063968 3300025933 Bacteria 3239
181 Ga0207686_10076512 3300025934 Unclassified 2170
182 Ga0207686_10166903 3300025934 Bacteria 1549
183 Ga0207669_10045611 3300025937 Bacteria 2584
184 Ga0207665_10004672 3300025939 Bacteria 9100
185 Ga0207665_10104902 3300025939 Bacteria 1979
186 Ga0207691_10396986 3300025940 Bacteria 1176
187 Ga0207711_10019687 3300025941 Bacteria 5619
188 Ga0207711_10103967 3300025941 Bacteria 2516
189 Ga0207689_10001022 3300025942 Bacteria 26894
190 Ga0207689_10269062 3300025942 Bacteria 1411
191 Ga0207667_10136858 3300025949 Bacteria 2522
192 Ga0207651_10008396 3300025960 Bacteria 5576
193 Ga0207712_10121578 3300025961 Bacteria 1976
194 Ga0207668_10008845 3300025972 Bacteria 6021
195 Ga0207668_10146521 3300025972 Bacteria 1822
196 Ga0207658_10058699 3300025986 Bacteria 2864
197 Ga0207703_10356879 3300026035 Bacteria 1347
198 Ga0207678_10046129 3300026067 Bacteria 3769
199 Ga0207708_10012107 3300026075 Bacteria 6430
200 Ga0207641_10362257 3300026088 Bacteria 1384
201 Ga0207648_10000371 3300026089 Bacteria 49303
202 Ga0207676_10007719 3300026095 Bacteria 7647
203 Ga0207674_10044928 3300026116 Bacteria 4548
204 Ga0207675_100000429 3300026118 Bacteria 40687
205 Ga0207675_100290125 3300026118 Bacteria 1591
206 Ga0268265_10005749 3300028380 Bacteria 8466
207 Ga0268265_10211202 3300028380 Bacteria 1691
208 Ga0268264_10021490 3300028381 Bacteria 5269
209 Ga0268264_10170065 3300028381 Bacteria 1970
210 Ga0307515_10007740 3300028794 Bacteria 21147
211 Ga0307513_10000019 3300031456 Bacteria 231194
212 Ga0307513_10108929 3300031456 Bacteria 2769
213 Ga0307408_100005783 3300031548 Bacteria 8234
214 Ga0265342_10006404 3300031712 Bacteria 8772
215 Ga0316576_10171180 3300031727 Unclassified 1639
216 Ga0307412_10000014 3300031911 Bacteria 353795
217 Ga0307412_10025900 3300031911 Bacteria 3639
218 Ga0307416_100002861 3300032002 Bacteria 10048
219 Ga0316583_10043905 3300032133 Bacteria 1580
220 Ga0307507_10139841 3300033179 Bacteria 1860
221 Ga0373934_0000578 3300035086 Bacteria 12902
222 Ga0373923_0000293 3300035111 Bacteria 11051
223 Ga0373936_0016698 3300035113 Bacteria 2825
224 Ga0373953_0000874 3300035117 Bacteria 8460
225 Ga0373954_0013899 3300035118 Unclassified 3588
226 Ga0373956_0000932 3300035119 Bacteria 12149
227 Ga0373957_0001656 3300035120 Bacteria 6103
228 Ga0373955_0000217 3300035172 Bacteria 24101
229 Ga0373924_0006619 3300035410 Bacteria 4156
230 Ga0373924_0086068 3300035410 Bacteria 1341
231 Ga0373933_0000064 3300035724 Bacteria 64360
232 Ga0373937_0000550 3300036401 Bacteria 33311
233 Ga0373937_0257008 3300036401 Bacteria 1647
234 Ga0373925_0111521 3300037068 Bacteria 2114
235 Ga0395899_0000026 3300037312 Bacteria 345291
236 Ga0395898_0422095 3300037466 Bacteria 1271
237 Ga0395905_0111668 3300037471 Bacteria 2566
238 Ga0436364_0641908 3300037853 Bacteria 6771
239 Ga0395901_0396133 3300038443 Bacteria 1419
240 Ga0237819_02956 3300038705 Bacteria 3179
241 Ga0400483_036416 3300039062 Unclassified 2137
242 Ga0436365_1623694 3300039437 Bacteria 15672
243 Ga0436361_0735438 3300039447 Bacteria 6096
244 Ga0439457_031406 3300042014 Bacteria 1178
245 Ga0450898_002365 3300042134 Bacteria 2625
246 Ga0450899_006229 3300042135 Bacteria 1288
247 Ga0466969_0035774 3300044656 Bacteria 2510
248 Ga0466966_0003618 3300044684 Bacteria 10196
249 Ga0466961_0053107 3300044693 Bacteria 2586
250 Ga0466964_0004360 3300044706 Bacteria 5216
251 Ga0466971_0001923 3300044719 Bacteria 8813
252 Ga0466970_0042379 3300044765 Bacteria 2420
253 Ga0466957_0028376 3300044842 Bacteria 3332
254 Ga0466959_0004302 3300045049 Bacteria 9503
255 Ga0466958_0038978 3300045836 Unclassified 2853
256 Ga0466967_0165189 3300045976 Bacteria 2080
257 Ga0495592_0001557 3300046454 Bacteria 16006
258 Ga0495603_0102021 3300046455 Bacteria 1675
259 Ga0495603_0190076 3300046455 Bacteria 1187
260 Ga0495590_0012710 3300046457 Bacteria 3115
261 Ga0495591_000527 3300046458 Bacteria 29884
262 Ga0495629_0000041 3300046459 Bacteria 115135
263 Ga0495629_0005120 3300046459 Bacteria 9801
264 Ga0495638_0054818 3300046460 Bacteria 2477
265 Ga0495641_0128462 3300046461 Bacteria 1131
266 Ga0495651_0001804 3300046462 Bacteria 16513
267 Ga0495651_0006629 3300046462 Bacteria 8844
268 Ga0495651_0026457 3300046462 Bacteria 4519
269 Ga0495651_0191766 3300046462 Bacteria 1437
270 Ga0495653_0000177 3300046463 Bacteria 52704
271 Ga0495653_0004866 3300046463 Bacteria 10894
272 Ga0495653_0213419 3300046463 Bacteria 1302
273 Ga0495650_0003891 3300046471 Bacteria 10562
274 Ga0495650_0031884 3300046471 Bacteria 2364
275 Ga0495580_0004191 3300046472 Bacteria 12129
276 Ga0495580_0012515 3300046472 Bacteria 6504
277 Ga0495580_0015216 3300046472 Bacteria 5814
278 Ga0495582_0104677 3300046473 Bacteria 1586
279 Ga0495605_0023521 3300046474 Bacteria 3238
280 Ga0495605_0054583 3300046474 Bacteria 1934
281 Ga0495664_0057311 3300046477 Bacteria 2318
282 Ga0495584_0212644 3300046491 Bacteria 983
283 Ga0495594_0081791 3300046499 Unclassified 1804
284 Ga0495596_0008578 3300046500 Bacteria 4541
285 Ga0495596_0009420 3300046500 Bacteria 4295
286 Ga0495583_0007156 3300046506 Bacteria 7096
287 Ga0495606_0035132 3300046507 Bacteria 3430
288 Ga0495608_0000996 3300046511 Bacteria 19970
289 Ga0495608_0016282 3300046511 Bacteria 5143
290 Ga0495610_0018851 3300046512 Bacteria 3879
291 Ga0495628_0003163 3300046516 Bacteria 14753
292 Ga0495628_0018447 3300046516 Bacteria 5779
293 Ga0495628_0039869 3300046516 Bacteria 3756
294 Ga0495630_0002488 3300046517 Bacteria 12767
295 Ga0495630_0033337 3300046517 Bacteria 3840
296 Ga0495630_0059257 3300046517 Bacteria 2872
297 Ga0495632_0067056 3300046519 Bacteria 1731
298 Ga0495643_0149043 3300046522 Bacteria 1160
299 Ga0495648_0012114 3300046524 Bacteria 6455
300 Ga0495666_0003586 3300046526 Bacteria 7847
301 Ga0495666_0018667 3300046526 Bacteria 3446
302 Ga0495652_0000413 3300046529 Bacteria 49775
303 Ga0495652_0038003 3300046529 Bacteria 4173
304 Ga0495665_0002995 3300046531 Bacteria 9129
305 Ga0495665_0020667 3300046531 Bacteria 3535
306 Ga0495665_0052992 3300046531 Bacteria 2146
307 Ga0495586_0021976 3300046535 Bacteria 3405
308 Ga0495587_0000324 3300046536 Bacteria 34041
309 Ga0495587_0104795 3300046536 Bacteria 1627
310 Ga0495645_0014311 3300046543 Bacteria 5625
311 Ga0495645_0123680 3300046543 Unclassified 1819
312 Ga0495622_0009083 3300046557 Bacteria 4602
313 Ga0495667_0003547 3300046559 Bacteria 10480
314 Ga0495667_0084931 3300046559 Bacteria 2055
315 Ga0495625_0009574 3300046660 Bacteria 8094
316 Ga0495625_0109450 3300046660 Bacteria 1890
317 Ga0495635_0004800 3300046663 Bacteria 9398
318 Ga0495657_0000208 3300046675 Bacteria 52718
319 Ga0495599_0000230 3300046678 Bacteria 35264
320 Ga0495599_0055325 3300046678 Bacteria 2485
321 Ga0495599_0128628 3300046678 Bacteria 1573
322 Ga0495623_0000025 3300046679 Bacteria 91529
323 Ga0495623_0039904 3300046679 Bacteria 2998
324 Ga0495646_0001280 3300046680 Bacteria 14805
325 Ga0495646_0019921 3300046680 Bacteria 4241
326 Ga0495646_0020737 3300046680 Bacteria 4156
327 Ga0495613_0021961 3300046689 Bacteria 4757
328 Ga0495624_0009286 3300046690 Bacteria 6814
329 Ga0495624_0014314 3300046690 Bacteria 5386
330 Ga0495671_0045455 3300046692 Bacteria 2198
331 Ga0495649_0085160 3300046694 Bacteria 1687
332 Ga0495589_0009922 3300046794 Bacteria 4947
333 Ga0495589_0123834 3300046794 Bacteria 1244
334 Ga0495600_0000239 3300046809 Bacteria 30237
335 Ga0495660_0060139 3300046810 Bacteria 2042
336 Ga0495581_0095867 3300047315 Bacteria 1723
337 Ga0495604_0001305 3300047317 Bacteria 20376
338 Ga0495604_0003313 3300047317 Bacteria 12844
339 Ga0495674_0007344 3300047319 Bacteria 10536
340 Ga0495674_0044984 3300047319 Bacteria 3922
341 Ga0495672_0134527 3300047320 Bacteria 1297
342 Ga0495676_0044996 3300047321 Bacteria 3597
343 Ga0495680_0002834 3300047322 Bacteria 17427
344 Ga0495687_011547 3300047443 Bacteria 4740
345 Ga0495687_034217 3300047443 Bacteria 2298
346 Ga0495675_0000571 3300047444 Bacteria 23831
347 Ga0495675_0005851 3300047444 Bacteria 7513
348 Ga0495675_0221325 3300047444 Bacteria 1145
349 Ga0495679_000007 3300047446 Bacteria 401482
350 Ga0495679_012436 3300047446 Bacteria 3240
351 Ga0495673_0011649 3300047469 Bacteria 4717
352 Ga0495673_0051827 3300047469 Bacteria 1795
353 Ga0495684_0000438 3300047471 Bacteria 34102
354 Ga0495684_0027759 3300047471 Bacteria 4347
355 Ga0495684_0171169 3300047471 Unclassified 1615
356 Ga0495686_0047385 3300047472 Bacteria 2714
357 Ga0495593_0006648 3300047673 Bacteria 6768
358 Ga0495593_0018687 3300047673 Bacteria 3892
359 Ga0495602_0000338 3300048088 Bacteria 43283
360 Ga0495602_0004942 3300048088 Bacteria 13965
361 Ga0495602_0056844 3300048088 Bacteria 3437
362 Ga0495602_0110152 3300048088 Bacteria 2239
363 Ga0495614_0016503 3300048089 Bacteria 3213
364 Ga0496102_0013502 3300048905 Bacteria 7075
365 Ga0496102_0076279 3300048905 Bacteria 3083
366 Ga0496102_0096767 3300048905 Bacteria 2737
367 Ga0496102_0367895 3300048905 Bacteria 1353
368 Ga0496103_0010022 3300048906 Bacteria 5601
369 Ga0496103_0125492 3300048906 Bacteria 1637
370 Ga0496107_0336483 3300048910 Bacteria 1123
371 Ga0496108_0385120 3300048911 Bacteria 1224
372 Ga0496113_0412382 3300048916 Bacteria 1085
373 Ga0496115_0154464 3300048918 Bacteria 1895
374 Ga0496116_0055633 3300048919 Bacteria 2598
375 Ga0496116_0072804 3300048919 Bacteria 2170
376 Ga0496117_0009631 3300048920 Bacteria 8938
377 Ga0496117_0038137 3300048920 Bacteria 3569
378 Ga0496118_0001972 3300048921 Bacteria 29128
379 Ga0496118_0002189 3300048921 Bacteria 27169
380 Ga0496118_0008844 3300048921 Bacteria 10305
381 Ga0496118_0010409 3300048921 Bacteria 9218
382 Ga0496118_0040110 3300048921 Bacteria 3726
383 Ga0496118_0112851 3300048921 Bacteria 1798
384 Ga0496124_0008515 3300048927 Bacteria 10709
385 Ga0496126_0003035 3300048929 Bacteria 21761
386 Ga0496126_0003517 3300048929 Bacteria 19714
387 Ga0495682_0007951 3300049460 Bacteria 4192
388 Ga0495682_0043044 3300049460 Bacteria 1654
389 Ga0501034_0511747 3300049571 Bacteria 1113
390 Ga0501043_0334042 3300049579 Unclassified 1154
391 Ga0501047_0221672 3300049581 Bacteria 1747
392 Ga0501067_0014017 3300049583 Bacteria 4440
393 Ga0501080_0006549 3300049742 Bacteria 10467
394 Ga0501083_0005967 3300049744 Bacteria 8624
395 Ga0501035_0374044 3300049822 Unclassified 1189
396 Ga0501044_0050914 3300049823 Bacteria 4272
397 Ga0501044_0250641 3300049823 Bacteria 1712
398 nmdc:mga03683_1256_c1 3300050489 Bacteria 7514
399 nmdc:mga0yw44_135294_c1 3300050492 Bacteria 1598
400 nmdc:mga04h51_50812_c1 3300050495 Bacteria 1390
401 nmdc:mga05p37_231545_c1 3300050507 Bacteria 2225
402 nmdc:mga09592_83600_c1 3300050508 Bacteria 2721
403 nmdc:mga06r32_23050_c1 3300050510 Bacteria 5758
404 nmdc:mga06r32_30647_c1 3300050510 Bacteria 5048
405 nmdc:mga06r32_85809_c1 3300050510 Bacteria 3069
406 nmdc:mga0n895_317_c1 3300050512 Bacteria 32077
407 nmdc:mga0rr50_164707_c1 3300050513 Bacteria 1802
408 nmdc:mga0rr50_63136_c1 3300050513 Bacteria 2796
409 nmdc:mga08x19_4352_c1 3300050514 Bacteria 8397
410 nmdc:mga08x19_5503_c2 3300050514 Bacteria 6042
411 nmdc:mga08x19_7150_c1 3300050514 Bacteria 6629
412 nmdc:mga0a205_3257_c1 3300050515 Bacteria 14441
413 Ga0495601_0001823 3300053077 Bacteria 11834
414 Ga0495601_0004029 3300053077 Bacteria 8462
415 Ga0495612_0001396 3300053078 Bacteria 9953
416 Ga0495595_0004828 3300053084 Bacteria 5429
417 Ga0495619_0004133 3300053085 Bacteria 9278
418 Ga0500578_0015335 3300053086 Bacteria 4926
419 Ga0500583_0194591 3300053092 Bacteria 1008
420 Ga0500651_0119230 3300053093 Bacteria 1603
421 Ga0500641_0030850 3300053096 Unclassified 2110
422 Ga0500562_029465 3300053108 Bacteria 1444
423 Ga0500594_0008746 3300053118 Bacteria 2315
424 Ga0500594_0053230 3300053118 Bacteria 1146
425 Ga0500604_0001711 3300053151 Bacteria 6150
426 Ga0500604_0002716 3300053151 Bacteria 4810
427 Ga0500620_021675 3300053155 Bacteria 1924
428 Ga0501084_0063706 3300054114 Bacteria 3087
429 Ga0501084_0103042 3300054114 Bacteria 2397
430 Ga0501082_0013701 3300060353 Bacteria 6969
431 Ga0466962_0001799 3300061719 Bacteria 10082
432 2510253178 2510065045 Bacteria 7761063
433 2512347348 2512047030 Bacteria 9031815
434 2515685321 2515154122 Bacteria 8609520
435 2600810310 2600255067 Bacteria 6795583
436 2643775743 2643221551 Bacteria 3750538
437 2643794190 2643221555 Bacteria 3749717
438 2719638967 2718217991 Bacteria 7829542
439 2738823803 2738541296 Bacteria 7285013
440 2738836194 2738541298 Bacteria 7286732
441 2738877724 2738541306 Bacteria 7284992
442 2739189430 2738543002 Bacteria 7284546
443 2739224317 2738543008 Bacteria 7282815
444 2739306250 2738543024 Bacteria 5603683
445 2747947399 2747842428 Bacteria 4689383
446 2753566275 2751185846 Bacteria 7242164
447 2819623925 2818991450 Bacteria 6962147
448 2842331820 2842324504 Bacteria 9364110
449 2842356133 2842348783 Bacteria 9002918
450 2842459333 2842454564 Bacteria 8730687
451 2885278538 2885270888 Bacteria 9831543
452 2900636414 2900634093 Bacteria 10263517
453 2902689093 2902682994 Bacteria 8951596
454 2924765802 2924762789 Bacteria 6561353
455 2928109493 2928108538 Bacteria 7360024
456 2928118604 2928115317 Bacteria 6477646
457 2928137053 2928135762 Bacteria 7259641
458 2928506581 2928503688 Bacteria 7268108
459 2945935209 2945934425 Bacteria 7444609
460 2987673126 2987666974 Bacteria 6509233
461 2990704197 2990703756 Bacteria 7715990
462 642422353 641736151 Bacteria 7477263
463 642620123 642555113 Bacteria 8214658
464 8047720037 8047710418 Bacteria 11023148
465 Ga0436364_0333996
466 JGI24739J22299_10001199
467 JGI24739J22299_10009631
468 JGI24735J21928_10022852
469 JGI25406J46586_10050109
470 rootL2_10251488
471 Ga0055540_1006456
472 Ga0055531_10000542
473 Ga0070658_10235538
474 Ga0070676_10038673
475 Ga0070676_10115293
476 Ga0070690_100074574
477 Ga0070670_100001835
478 Ga0070670_100105498
479 Ga0068869_100113702
480 Ga0068869_100182957
481 Ga0070666_10023284
482 Ga0070666_10330256
483 Ga0070680_100196828
484 Ga0068868_100060375
485 Ga0070687_100049821
486 Ga0070668_100003318
487 Ga0070668_100054051
488 Ga0070668_100059991
489 Ga0070669_100008602
490 Ga0070669_100041591
491 Ga0070675_100000320
492 Ga0070675_100014721
493 Ga0070673_100017184
494 Ga0070667_100007876
495 Ga0070667_100143004
496 Ga0070711_100005710
497 Ga0070705_100099382
498 Ga0070694_100238361
499 Ga0070708_100151970
500 Ga0070708_100403035
501 Ga0070663_100033735
502 Ga0070678_100281910
503 Ga0070681_10055660
504 Ga0068867_100000289
505 Ga0070707_100570780
506 Ga0070698_100021240
507 Ga0070698_100192132
508 Ga0070698_100205277
509 Ga0070698_100270774
510 Ga0070699_100096132
511 Ga0070699_100132570
512 Ga0070679_100002534
513 Ga0070697_100104969
514 Ga0068853_100325238
515 Ga0070672_100433626
516 Ga0070686_100104542
517 Ga0070686_100263613
518 Ga0070695_100012950
519 Ga0070696_100106742
520 Ga0070704_100044107
521 Ga0070704_100109486
522 Ga0068855_100124623
523 Ga0068855_100167004
524 Ga0068857_100017897
525 Ga0068856_100150928
526 Ga0070702_100218324
527 Ga0068859_100007957
528 Ga0068859_100118451
529 Ga0068859_100310342
530 Ga0068864_100068636
531 Ga0068861_100215025
532 Ga0068870_10042128
533 Ga0068863_100006084
534 Ga0068863_100144789
535 Ga0068863_100458692
536 Ga0068858_100072308
537 Ga0068858_100604937
538 Ga0068860_100002227
539 Ga0068860_100006589
540 Ga0068862_100002329
541 Ga0068862_100083405
542 Ga0068862_100514550
543 Ga0068862_100605333
544 Ga0081539_10018901
545 Ga0070717_10447781
546 Ga0070716_100133255
547 Ga0070712_100029338
548 Ga0075362_10008656
549 Ga0075362_10037089
550 Ga0097621_100153541
551 Ga0097621_100235270
552 Ga0068871_100149157
553 Ga0075430_100034455
554 Ga0075430_100363482
555 Ga0075431_100017303
556 Ga0075431_100023309
557 Ga0075431_100220589
558 Ga0075433_10000327
559 Ga0075434_100000276
560 Ga0075429_100090391
561 Ga0075429_100320417
562 Ga0075436_100006029
563 Ga0075436_100006750
564 Ga0075436_100020724
565 Ga0075436_100025039
566 Ga0097620_100007958
567 Ga0097620_100118455
568 Ga0097620_100310381
569 Ga0075435_100015810
570 Ga0075435_100032859
571 Ga0075435_100116473
572 Ga0075435_100117732
573 Ga0105251_10000055
574 Ga0105240_10010282
575 Ga0105240_10693495
576 Ga0111539_10476566
577 Ga0111539_10573559
578 Ga0111539_10920660
579 Ga0105245_10000189
580 Ga0105245_10151958
581 Ga0105247_10097930
582 Ga0114129_10091499
583 Ga0114129_10190395
584 Ga0105241_10068266
585 Ga0105242_10101543
586 Ga0105242_10132471
587 Ga0105248_10005459
588 Ga0105248_10180503
589 Ga0105248_10271554
590 Ga0105238_10444172
591 Ga0105249_10175535
592 Ga0157369_10174639
593 Ga0157378_10000560
594 Ga0157378_10117056
595 Ga0163162_10017425
596 Ga0163162_10025684
597 Ga0163162_10412509
598 Ga0157375_10566938
599 Ga0163163_10161005
600 Ga0157380_10101297
601 Ga0157380_10458134
602 Ga0182008_10007829
603 Ga0182008_10035200
604 Ga0182008_10116744
605 Ga0157377_10064985
606 Ga0157379_10002376
607 Ga0157379_10065344
608 Ga0157379_10070427
609 Ga0157376_10019079
610 Ga0157376_10029177
611 Ga0182006_1010665
612 Ga0182006_1033685
613 Ga0182007_10000891
614 Ga0163161_10001512
615 Ga0213872_10030416
616 Ga0213876_10021599
617 Ga0209759_1000175
618 Ga0209673_1008337
619 Ga0209673_1010644
620 Ga0209050_1005169
621 Ga0209051_1003393
622 Ga0209257_1000012
623 Ga0207713_1000089
624 Ga0207713_1000106
625 Ga0207710_10174310
626 Ga0207647_10000540
627 Ga0207645_10168846
628 Ga0207705_10087230
629 Ga0207671_10140366
630 Ga0207693_10086871
631 Ga0207693_10211002
632 Ga0207652_10015807
633 Ga0207646_10052982
634 Ga0207681_10044547
635 Ga0207681_10314871
636 Ga0207694_10154876
637 Ga0207650_10005680
638 Ga0207650_10118312
639 Ga0207659_10000798
640 Ga0207687_10000838
641 Ga0207687_10035230
642 Ga0207700_10276564
643 Ga0207644_10129472
644 Ga0207706_10063968
645 Ga0207686_10076512
646 Ga0207686_10166903
647 Ga0207669_10045611
648 Ga0207665_10004672
649 Ga0207665_10104902
650 Ga0207691_10396986
651 Ga0207711_10019687
652 Ga0207711_10103967
653 Ga0207689_10001022
654 Ga0207689_10269062
655 Ga0207667_10136858
656 Ga0207651_10008396
657 Ga0207712_10121578
658 Ga0207668_10008845
659 Ga0207668_10146521
660 Ga0207658_10058699
661 Ga0207703_10356879
662 Ga0207678_10046129
663 Ga0207708_10012107
664 Ga0207641_10362257
665 Ga0207648_10000371
666 Ga0207676_10007719
667 Ga0207674_10044928
668 Ga0207675_100000429
669 Ga0207675_100290125
670 Ga0268265_10005749
671 Ga0268265_10211202
672 Ga0268264_10021490
673 Ga0268264_10170065
674 Ga0307515_10007740
675 Ga0307513_10000019
676 Ga0307513_10108929
677 Ga0307408_100005783
678 Ga0265342_10006404
679 Ga0316576_10171180
680 Ga0307412_10000014
681 Ga0307412_10025900
682 Ga0307416_100002861
683 Ga0316583_10043905
684 Ga0307507_10139841
685 Ga0373934_0000578
686 Ga0373923_0000293
687 Ga0373936_0016698
688 Ga0373953_0000874
689 Ga0373954_0013899
690 Ga0373956_0000932
691 Ga0373957_0001656
692 Ga0373955_0000217
693 Ga0373924_0006619
694 Ga0373924_0086068
695 Ga0373933_0000064
696 Ga0373937_0000550
697 Ga0373937_0257008
698 Ga0373925_0111521
699 Ga0395899_0000026
700 Ga0395898_0422095
701 Ga0395905_0111668
702 Ga0436364_0641908
703 Ga0395901_0396133
704 Ga0237819_02956
705 Ga0400483_036416
706 Ga0436365_1623694
707 Ga0436361_0735438
708 Ga0439457_031406
709 Ga0450898_002365
710 Ga0450899_006229
711 Ga0466969_0035774
712 Ga0466966_0003618
713 Ga0466961_0053107
714 Ga0466964_0004360
715 Ga0466971_0001923
716 Ga0466970_0042379
717 Ga0466957_0028376
718 Ga0466959_0004302
719 Ga0466958_0038978
720 Ga0466967_0165189
721 Ga0495592_0001557
722 Ga0495603_0102021
723 Ga0495603_0190076
724 Ga0495590_0012710
725 Ga0495591_000527
726 Ga0495629_0000041
727 Ga0495629_0005120
728 Ga0495638_0054818
729 Ga0495641_0128462
730 Ga0495651_0001804
731 Ga0495651_0006629
732 Ga0495651_0026457
733 Ga0495651_0191766
734 Ga0495653_0000177
735 Ga0495653_0004866
736 Ga0495653_0213419
737 Ga0495650_0003891
738 Ga0495650_0031884
739 Ga0495580_0004191
740 Ga0495580_0012515
741 Ga0495580_0015216
742 Ga0495582_0104677
743 Ga0495605_0023521
744 Ga0495605_0054583
745 Ga0495664_0057311
746 Ga0495584_0212644
747 Ga0495594_0081791
748 Ga0495596_0008578
749 Ga0495596_0009420
750 Ga0495583_0007156
751 Ga0495606_0035132
752 Ga0495608_0000996
753 Ga0495608_0016282
754 Ga0495610_0018851
755 Ga0495628_0003163
756 Ga0495628_0018447
757 Ga0495628_0039869
758 Ga0495630_0002488
759 Ga0495630_0033337
760 Ga0495630_0059257
761 Ga0495632_0067056
762 Ga0495643_0149043
763 Ga0495648_0012114
764 Ga0495666_0003586
765 Ga0495666_0018667
766 Ga0495652_0000413
767 Ga0495652_0038003
768 Ga0495665_0002995
769 Ga0495665_0020667
770 Ga0495665_0052992
771 Ga0495586_0021976
772 Ga0495587_0000324
773 Ga0495587_0104795
774 Ga0495645_0014311
775 Ga0495645_0123680
776 Ga0495622_0009083
777 Ga0495667_0003547
778 Ga0495667_0084931
779 Ga0495625_0009574
780 Ga0495625_0109450
781 Ga0495635_0004800
782 Ga0495657_0000208
783 Ga0495599_0000230
784 Ga0495599_0055325
785 Ga0495599_0128628
786 Ga0495623_0000025
787 Ga0495623_0039904
788 Ga0495646_0001280
789 Ga0495646_0019921
790 Ga0495646_0020737
791 Ga0495613_0021961
792 Ga0495624_0009286
793 Ga0495624_0014314
794 Ga0495671_0045455
795 Ga0495649_0085160
796 Ga0495589_0009922
797 Ga0495589_0123834
798 Ga0495600_0000239
799 Ga0495660_0060139
800 Ga0495581_0095867
801 Ga0495604_0001305
802 Ga0495604_0003313
803 Ga0495674_0007344
804 Ga0495674_0044984
805 Ga0495672_0134527
806 Ga0495676_0044996
807 Ga0495680_0002834
808 Ga0495687_011547
809 Ga0495687_034217
810 Ga0495675_0000571
811 Ga0495675_0005851
812 Ga0495675_0221325
813 Ga0495679_000007
814 Ga0495679_012436
815 Ga0495673_0011649
816 Ga0495673_0051827
817 Ga0495684_0000438
818 Ga0495684_0027759
819 Ga0495684_0171169
820 Ga0495686_0047385
821 Ga0495593_0006648
822 Ga0495593_0018687
823 Ga0495602_0000338
824 Ga0495602_0004942
825 Ga0495602_0056844
826 Ga0495602_0110152
827 Ga0495614_0016503
828 Ga0496102_0013502
829 Ga0496102_0076279
830 Ga0496102_0096767
831 Ga0496102_0367895
832 Ga0496103_0010022
833 Ga0496103_0125492
834 Ga0496107_0336483
835 Ga0496108_0385120
836 Ga0496113_0412382
837 Ga0496115_0154464
838 Ga0496116_0055633
839 Ga0496116_0072804
840 Ga0496117_0009631
841 Ga0496117_0038137
842 Ga0496118_0001972
843 Ga0496118_0002189
844 Ga0496118_0008844
845 Ga0496118_0010409
846 Ga0496118_0040110
847 Ga0496118_0112851
848 Ga0496124_0008515
849 Ga0496126_0003035
850 Ga0496126_0003517
851 Ga0495682_0007951
852 Ga0495682_0043044
853 Ga0501034_0511747
854 Ga0501043_0334042
855 Ga0501047_0221672
856 Ga0501067_0014017
857 Ga0501080_0006549
858 Ga0501083_0005967
859 Ga0501035_0374044
860 Ga0501044_0050914
861 Ga0501044_0250641
862 nmdc:mga03683_1256_c1
863 nmdc:mga0yw44_135294_c1
864 nmdc:mga04h51_50812_c1
865 nmdc:mga05p37_231545_c1
866 nmdc:mga09592_83600_c1
867 nmdc:mga06r32_23050_c1
868 nmdc:mga06r32_30647_c1
869 nmdc:mga06r32_85809_c1
870 nmdc:mga0n895_317_c1
871 nmdc:mga0rr50_164707_c1
872 nmdc:mga0rr50_63136_c1
873 nmdc:mga08x19_4352_c1
874 nmdc:mga08x19_5503_c2
875 nmdc:mga08x19_7150_c1
876 nmdc:mga0a205_3257_c1
877 Ga0495601_0001823
878 Ga0495601_0004029
879 Ga0495612_0001396
880 Ga0495595_0004828
881 Ga0495619_0004133
882 Ga0500578_0015335
883 Ga0500583_0194591
884 Ga0500651_0119230
885 Ga0500641_0030850
886 Ga0500562_029465
887 Ga0500594_0008746
888 Ga0500594_0053230
889 Ga0500604_0001711
890 Ga0500604_0002716
891 Ga0500620_021675
892 Ga0501084_0063706
893 Ga0501084_0103042
894 Ga0501082_0013701
895 Ga0466962_0001799
896 2510253178
897 2512347348
898 2515685321
899 2600810310
900 2643775743
901 2643794190
902 2719638967
903 2738823803
904 2738836194
905 2738877724
906 2739189430
907 2739224317
908 2739306250
909 2747947399
910 2753566275
911 2819623925
912 2842331820
913 2842356133
914 2842459333
915 2885278538
916 2900636414
917 2902689093
918 2924765802
919 2928109493
920 2928118604
921 2928137053
922 2928506581
923 2945935209
924 2987673126
925 2990704197
926 642422353
927 642620123
928 8047720037

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12802

MarR_2

MarR family

86

143

0.97

PF01047

MarR

MarR family

86

144

0.97

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

223

334

0.89

PF13463

HTH_27

Winged helix DNA-binding domain

86

152

0.87

PF08445

FR47

FR47-like protein

269

342

0.84

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

223

350

0.82

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

251

336

0.79

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

202

335

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
5duk-assembly1.cif.gz_A n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.9476 39 89
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9309 39 99
6wxq-assembly1.cif.gz_A crystal structure of crispr-associated transcription factor csa3 complexed with ca4 0.9254 36 110
2wte-assembly1.cif.gz_B the structure of the crispr-associated protein, csa3, from sulfolobus solfataricus at 1.8 angstrom resolution. 0.9231 36 111
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9208 39 100
ID Description Score Start End Superfamily
af_Q54BP5_22_162_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9863 168 307 3.40.630.30
af_Q54BP5_22_162_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9725 168 307 3.40.630.30
af_I1MSW7_129_252_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9549 213 288 3.40.630.30
af_Q69XJ1_51_114_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9465 37 97 1.10.10.10
af_A0A1D6QIS1_205_278_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9416 246 308 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A3D0XZK4-F1-model_v4 N-acetyltransferase domain-containing protein 0.9526 202 308 GO:0008080
AF-A0A7V2LEI0-F1-model_v4 [Ribosomal protein bS18]-alanine N-acetyltransferase (EC 2.3.1.266) 0.9411 214 307 GO:0005737
GO:0005840
GO:0008080
AF-R7UU65-F1-model_v4 N-acetyltransferase domain-containing protein 0.9399 199 308 GO:0008080
AF-A0A357LH61-F1-model_v4 N-acetyltransferase domain-containing protein 0.9371 222 308 GO:0016747
AF-A0A117QHF5-F1-model_v4 deleted 0.9281 205 308

Map