F449343

General Info

Members Datasets Scaffolds Average Seq Length
464 219 464 153

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0033941|Ga0466967_0033941_89_556
Length 150
Sequence MARQTGEKLIVDNRRARHEYHLGDRVEAGLVLAGTEVKSLRDGEATLQQAYAEVWLLGLHVPEYSQGNVANHDPDRPRKLLLHRREIERLASGVAEKGFTLVPTRLYFKDGRVKVELALARGKELRDKRRDIADRDARRQIERELKSLRR

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
56 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
91 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
92 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
95 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
103 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
104 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
105 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
114 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
115 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
116 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
117 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
118 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
121 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
122 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
216 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 1.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.9
Rhizosphere 93.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10019775 3300003373 Bacteria 1750
2 JGI25407J50210_10043636 3300003373 Bacteria 1146
3 Ga0070658_10032587 3300005327 Bacteria 4190
4 Ga0070658_10046223 3300005327 Bacteria 3523
5 Ga0070658_10213436 3300005327 Bacteria 1631
6 Ga0070683_101321265 3300005329 Bacteria 693
7 Ga0070680_100174085 3300005336 Bacteria 1812
8 Ga0070682_100014383 3300005337 Bacteria 4572
9 Ga0070682_100094162 3300005337 Bacteria 1965
10 Ga0070682_100158887 3300005337 Bacteria 1559
11 Ga0070660_100009622 3300005339 Bacteria 6808
12 Ga0070660_100027532 3300005339 Bacteria 4243
13 Ga0070660_100244549 3300005339 Bacteria 1462
14 Ga0070661_100116702 3300005344 Bacteria 1996
15 Ga0070661_100628849 3300005344 Bacteria 870
16 Ga0070671_100063051 3300005355 Bacteria 3086
17 Ga0070659_100363918 3300005366 Bacteria 1216
18 Ga0070659_100384164 3300005366 Bacteria 1183
19 Ga0070709_10811301 3300005434 Bacteria 735
20 Ga0070714_100002979 3300005435 Bacteria 12547
21 Ga0070714_100019455 3300005435 Bacteria 5533
22 Ga0070714_100168255 3300005435 Bacteria 1987
23 Ga0070714_100505678 3300005435 Bacteria 1153
24 Ga0070714_101234004 3300005435 Bacteria 729
25 Ga0070713_100011606 3300005436 Bacteria 6425
26 Ga0070713_100054997 3300005436 Bacteria 3305
27 Ga0070710_10043347 3300005437 Bacteria 2491
28 Ga0070711_100050255 3300005439 Bacteria 2858
29 Ga0070694_100033647 3300005444 Bacteria 3375
30 Ga0070681_10095974 3300005458 Bacteria 2913
31 Ga0070681_10137338 3300005458 Bacteria 2375
32 Ga0070681_10227932 3300005458 Bacteria 1778
33 Ga0070707_100122895 3300005468 Unclassified 2520
34 Ga0070707_100497613 3300005468 Bacteria 1180
35 Ga0070698_100248240 3300005471 Bacteria 1712
36 Ga0070679_100028071 3300005530 Bacteria 5545
37 Ga0070679_100029662 3300005530 Bacteria 5396
38 Ga0070679_100093186 3300005530 Bacteria 3000
39 Ga0070679_100150653 3300005530 Bacteria 2303
40 Ga0070684_100251485 3300005535 Bacteria 1615
41 Ga0068853_100584454 3300005539 Bacteria 1060
42 Ga0070696_100508752 3300005546 Bacteria 959
43 Ga0068855_100067821 3300005563 Bacteria 4154
44 Ga0068855_100306062 3300005563 Bacteria 1759
45 Ga0068856_100363415 3300005614 Bacteria 1466
46 Ga0068852_100085284 3300005616 Bacteria 2813
47 Ga0068859_101255521 3300005617 Bacteria 816
48 Ga0081455_10040418 3300005937 Bacteria 4112
49 Ga0081455_10043286 3300005937 Bacteria 3941
50 Ga0081455_10097147 3300005937 Bacteria 2374
51 Ga0081538_10000043 3300005981 Bacteria 115532
52 Ga0081538_10003176 3300005981 Bacteria 15626
53 Ga0081538_10008251 3300005981 Bacteria 8874
54 Ga0081538_10014658 3300005981 Bacteria 6126
55 Ga0081538_10022360 3300005981 Bacteria 4582
56 Ga0081538_10058135 3300005981 Bacteria 2246
57 Ga0081538_10059772 3300005981 Bacteria 2199
58 Ga0070717_10011023 3300006028 Bacteria 6846
59 Ga0070717_10016012 3300006028 Bacteria 5806
60 Ga0070715_10009602 3300006163 Bacteria 3416
61 Ga0070716_100037561 3300006173 Bacteria 2677
62 Ga0070712_100034028 3300006175 Bacteria 3452
63 Ga0097621_100185375 3300006237 Bacteria 1800
64 Ga0068871_100927447 3300006358 Bacteria 808
65 Ga0075428_100218303 3300006844 Bacteria 2059
66 Ga0075428_101145425 3300006844 Bacteria 821
67 Ga0075430_100041487 3300006846 Bacteria 3893
68 Ga0075429_100137011 3300006880 Bacteria 2142
69 Ga0097620_101255547 3300006931 Bacteria 816
70 Ga0105251_10100170 3300009011 Bacteria 1324
71 Ga0105240_10110154 3300009093 Bacteria 3333
72 Ga0105240_10667708 3300009093 Bacteria 1137
73 Ga0105247_10497604 3300009101 Bacteria 888
74 Ga0114129_10005345 3300009147 Bacteria 18124
75 Ga0105241_10096462 3300009174 Bacteria 2342
76 Ga0105241_10283371 3300009174 Bacteria 1416
77 Ga0105237_10795308 3300009545 Bacteria 953
78 Ga0105238_10354487 3300009551 Bacteria 1456
79 Ga0105238_10898615 3300009551 Bacteria 904
80 Ga0157373_10162348 3300013100 Bacteria 1572
81 Ga0157373_10572786 3300013100 Bacteria 820
82 Ga0157371_10072094 3300013102 Bacteria 2446
83 Ga0157370_10029792 3300013104 Bacteria 5351
84 Ga0157370_10587161 3300013104 Bacteria 1020
85 Ga0157370_11251169 3300013104 Bacteria 669
86 Ga0157369_10034321 3300013105 Bacteria 5569
87 Ga0157369_10081681 3300013105 Bacteria 3459
88 Ga0157374_10023100 3300013296 Bacteria 5557
89 Ga0157372_12125899 3300013307 Bacteria 645
90 Ga0163163_11154400 3300014325 Bacteria 837
91 Ga0182008_10006843 3300014497 Bacteria 6344
92 Ga0182008_10676638 3300014497 Bacteria 587
93 Ga0157379_10287856 3300014968 Bacteria 1496
94 Ga0182006_1010744 3300015261 Bacteria 4055
95 Ga0182007_10007092 3300015262 Bacteria 4742
96 Ga0206356_11318110 3300020070 Bacteria 2036
97 Ga0206354_10516362 3300020081 Bacteria 773
98 Ga0206354_11248895 3300020081 Bacteria 2677
99 Ga0206353_10127145 3300020082 Bacteria 1134
100 Ga0206353_10829062 3300020082 Bacteria 1801
101 Ga0213871_10008275 3300021441 Bacteria 2286
102 Ga0213871_10017072 3300021441 Bacteria 1759
103 Ga0207685_10015949 3300025905 Bacteria 2393
104 Ga0207699_10040090 3300025906 Bacteria 2696
105 Ga0207699_10269031 3300025906 Bacteria 1180
106 Ga0207705_10122858 3300025909 Bacteria 1928
107 Ga0207705_10161142 3300025909 Bacteria 1685
108 Ga0207705_10169397 3300025909 Bacteria 1644
109 Ga0207654_10225113 3300025911 Bacteria 1246
110 Ga0207707_10047911 3300025912 Bacteria 3722
111 Ga0207707_10074774 3300025912 Bacteria 2955
112 Ga0207707_10178047 3300025912 Bacteria 1857
113 Ga0207707_10232791 3300025912 Bacteria 1603
114 Ga0207695_10302506 3300025913 Bacteria 1491
115 Ga0207671_10567436 3300025914 Bacteria 905
116 Ga0207693_10002992 3300025915 Bacteria 14627
117 Ga0207663_10017338 3300025916 Bacteria 4010
118 Ga0207663_10532085 3300025916 Bacteria 917
119 Ga0207660_10185621 3300025917 Bacteria 1617
120 Ga0207660_10597043 3300025917 Bacteria 899
121 Ga0207657_10009122 3300025919 Bacteria 10008
122 Ga0207657_10024058 3300025919 Bacteria 5654
123 Ga0207657_10087820 3300025919 Bacteria 2600
124 Ga0207657_10175451 3300025919 Bacteria 1735
125 Ga0207657_10428155 3300025919 Bacteria 1040
126 Ga0207649_10071062 3300025920 Bacteria 2222
127 Ga0207652_10006261 3300025921 Bacteria 9605
128 Ga0207652_10060270 3300025921 Bacteria 3274
129 Ga0207652_10089285 3300025921 Bacteria 2706
130 Ga0207652_10153587 3300025921 Bacteria 2062
131 Ga0207652_10229982 3300025921 Bacteria 1671
132 Ga0207652_10949584 3300025921 Bacteria 758
133 Ga0207646_10073448 3300025922 Bacteria 3055
134 Ga0207694_10734503 3300025924 Bacteria 833
135 Ga0207687_10186918 3300025927 Bacteria 1609
136 Ga0207700_10093252 3300025928 Bacteria 2382
137 Ga0207700_10439855 3300025928 Bacteria 1148
138 Ga0207664_10029811 3300025929 Bacteria 4160
139 Ga0207664_10091921 3300025929 Bacteria 2489
140 Ga0207664_10262062 3300025929 Bacteria 1512
141 Ga0207664_10343346 3300025929 Bacteria 1320
142 Ga0207664_10572933 3300025929 Bacteria 1013
143 Ga0207644_10053950 3300025931 Bacteria 2894
144 Ga0207690_10606471 3300025932 Bacteria 894
145 Ga0207690_11062141 3300025932 Bacteria 674
146 Ga0207665_10000070 3300025939 Bacteria 66142
147 Ga0207661_10165185 3300025944 Bacteria 1923
148 Ga0207661_11268329 3300025944 Bacteria 677
149 Ga0207679_10678371 3300025945 Bacteria 934
150 Ga0207667_10104427 3300025949 Bacteria 2923
151 Ga0207667_10152589 3300025949 Bacteria 2377
152 Ga0207667_10999912 3300025949 Bacteria 824
153 Ga0207640_10032513 3300025981 Bacteria 3236
154 Ga0207639_10504756 3300026041 Bacteria 1106
155 Ga0207639_10524777 3300026041 Bacteria 1085
156 Ga0207639_10775917 3300026041 Bacteria 892
157 Ga0207678_10439040 3300026067 Unclassified 1134
158 Ga0207702_10333012 3300026078 Bacteria 1448
159 Ga0207698_10089227 3300026142 Bacteria 2517
160 Ga0265319_1084080 3300028563 Bacteria 1008
161 Ga0265334_10009863 3300028573 Bacteria 4036
162 Ga0265334_10129567 3300028573 Bacteria 898
163 Ga0265323_10091445 3300028653 Bacteria 1016
164 Ga0265338_10011084 3300028800 Bacteria 10457
165 Ga0265338_10013886 3300028800 Bacteria 9040
166 Ga0265338_10086777 3300028800 Bacteria 2602
167 Ga0265338_10599854 3300028800 Bacteria 767
168 Ga0265338_10678874 3300028800 Bacteria 712
169 Ga0265338_10687470 3300028800 Bacteria 707
170 Ga0265330_10069502 3300031235 Bacteria 1524
171 Ga0265320_10057262 3300031240 Bacteria 1870
172 Ga0265325_10052206 3300031241 Bacteria 2099
173 Ga0265329_10001736 3300031242 Bacteria 10414
174 Ga0265327_10020427 3300031251 Bacteria 4034
175 Ga0265313_10033218 3300031595 Bacteria 2625
176 Ga0265342_10479291 3300031712 Bacteria 636
177 Ga0307406_10607448 3300031901 Bacteria 903
178 Ga0373940_0045866 3300035088 Bacteria 1215
179 Ga0373939_0395465 3300035114 Bacteria 572
180 Ga0373946_0328785 3300035171 Unclassified 761
181 Ga0373961_0269934 3300035241 Bacteria 621
182 Ga0373947_0249685 3300035725 Bacteria 1173
183 Ga0373925_1466402 3300037068 Bacteria 559
184 Ga0395899_0009475 3300037312 Bacteria 7475
185 Ga0395899_0013856 3300037312 Bacteria 6159
186 Ga0395899_0042176 3300037312 Bacteria 3407
187 Ga0395899_0103937 3300037312 Bacteria 2048
188 Ga0395900_0004419 3300037418 Bacteria 14907
189 Ga0395900_0909826 3300037418 Bacteria 803
190 Ga0395900_1443815 3300037418 Bacteria 601
191 Ga0395898_0056047 3300037466 Bacteria 3843
192 Ga0395898_0488403 3300037466 Bacteria 1171
193 Ga0395898_0635530 3300037466 Bacteria 1010
194 Ga0395898_0636229 3300037466 Bacteria 1009
195 Ga0395898_0829730 3300037466 Bacteria 864
196 Ga0395898_1245920 3300037466 Bacteria 674
197 Ga0395898_1593195 3300037466 Bacteria 577
198 Ga0395905_0017747 3300037471 Bacteria 6757
199 Ga0395905_0025436 3300037471 Bacteria 5583
200 Ga0395905_0109537 3300037471 Bacteria 2593
201 Ga0395901_0157219 3300038443 Bacteria 2387
202 Ga0395901_0492761 3300038443 Bacteria 1248
203 Ga0395901_1208796 3300038443 Bacteria 721
204 Ga0242420_013647 3300038996 Bacteria 1387
205 Ga0436360_0665838 3300039438 Bacteria 1890
206 Ga0436360_1011977 3300039438 Bacteria 6957
207 Ga0451795_1563686 3300041456 Bacteria 711
208 Ga0439456_075418 3300042013 Bacteria 750
209 Ga0439459_0025307 3300042438 Bacteria 1171
210 Ga0439460_0071482 3300042461 Bacteria 1076
211 Ga0451577_0508578 3300042876 Bacteria 1094
212 Ga0466969_0319956 3300044656 Bacteria 702
213 Ga0466972_0183753 3300044658 Bacteria 980
214 Ga0466965_0170480 3300044683 Bacteria 1145
215 Ga0466966_0007789 3300044684 Bacteria 7094
216 Ga0466966_0041313 3300044684 Bacteria 2963
217 Ga0466966_0041732 3300044684 Bacteria 2947
218 Ga0466961_0016634 3300044693 Bacteria 4729
219 Ga0466961_0165230 3300044693 Bacteria 1378
220 Ga0466963_0002598 3300044694 Bacteria 10133
221 Ga0466963_0093775 3300044694 Bacteria 2047
222 Ga0466963_0601952 3300044694 Bacteria 776
223 Ga0466963_0607569 3300044694 Bacteria 772
224 Ga0466963_1235789 3300044694 Bacteria 525
225 Ga0466964_0660878 3300044706 Bacteria 579
226 Ga0466971_0042345 3300044719 Bacteria 2046
227 Ga0466968_0053290 3300044735 Bacteria 1732
228 Ga0466968_0090748 3300044735 Bacteria 1353
229 Ga0466968_0211337 3300044735 Bacteria 912
230 Ga0466968_0558859 3300044735 Bacteria 575
231 Ga0466957_0151498 3300044842 Bacteria 1500
232 Ga0466957_0153252 3300044842 Bacteria 1492
233 Ga0466957_0178946 3300044842 Bacteria 1384
234 Ga0466957_0497689 3300044842 Bacteria 845
235 Ga0466957_0799620 3300044842 Bacteria 670
236 Ga0466959_0002669 3300045049 Bacteria 11447
237 Ga0466959_0087589 3300045049 Bacteria 2239
238 Ga0466959_0342589 3300045049 Bacteria 1020
239 Ga0451576_1132348 3300045051 Bacteria 818
240 Ga0466958_0021182 3300045836 Bacteria 3796
241 Ga0466958_0056558 3300045836 Bacteria 2383
242 Ga0466958_0094016 3300045836 Bacteria 1857
243 Ga0466958_0110417 3300045836 Bacteria 1716
244 Ga0466958_0149354 3300045836 Unclassified 1474
245 Ga0466958_0373591 3300045836 Bacteria 919
246 Ga0466967_0000153 3300045976 Bacteria 27291
247 Ga0466967_0033941 3300045976 Bacteria 4324
248 Ga0466967_0054541 3300045976 Bacteria 3518
249 Ga0466967_0086295 3300045976 Bacteria 2843
250 Ga0466967_0161138 3300045976 Bacteria 2105
251 Ga0466967_0205843 3300045976 Bacteria 1865
252 Ga0466967_0911403 3300045976 Bacteria 874
253 Ga0466967_1508679 3300045976 Bacteria 669
254 Ga0466967_1565110 3300045976 Bacteria 656
255 Ga0495592_0041625 3300046454 Bacteria 3442
256 Ga0495592_0439504 3300046454 Bacteria 819
257 Ga0495603_0263527 3300046455 Bacteria 992
258 Ga0495629_0159714 3300046459 Bacteria 1566
259 Ga0495641_0008429 3300046461 Bacteria 6286
260 Ga0495641_0392599 3300046461 Bacteria 629
261 Ga0495651_0099870 3300046462 Bacteria 2163
262 Ga0495653_0028915 3300046463 Bacteria 4431
263 Ga0495582_0624298 3300046473 Bacteria 624
264 Ga0495608_0176979 3300046511 Bacteria 1351
265 Ga0495608_0391242 3300046511 Bacteria 851
266 Ga0495618_0370454 3300046514 Bacteria 880
267 Ga0495628_0112456 3300046516 Bacteria 2093
268 Ga0495628_0433330 3300046516 Bacteria 957
269 Ga0495630_0201418 3300046517 Bacteria 1519
270 Ga0495630_1082224 3300046517 Bacteria 608
271 Ga0495652_0260226 3300046529 Bacteria 1281
272 Ga0495586_0006586 3300046535 Bacteria 6207
273 Ga0495645_0179706 3300046543 Bacteria 1450
274 Ga0495667_0353297 3300046559 Bacteria 928
275 Ga0495667_0444076 3300046559 Bacteria 815
276 Ga0495656_0153758 3300046615 Bacteria 1113
277 Ga0495634_0106384 3300046642 Bacteria 1808
278 Ga0495635_0517562 3300046663 Bacteria 784
279 Ga0495657_0136477 3300046675 Bacteria 1532
280 Ga0495599_0010726 3300046678 Bacteria 5611
281 Ga0495646_0088341 3300046680 Bacteria 1795
282 Ga0495646_0151267 3300046680 Bacteria 1291
283 Ga0495658_0189390 3300046683 Bacteria 1278
284 Ga0495658_0285870 3300046683 Bacteria 1041
285 Ga0495613_0087077 3300046689 Bacteria 2264
286 Ga0495624_0262851 3300046690 Bacteria 1043
287 Ga0495624_0401067 3300046690 Bacteria 823
288 Ga0495600_0062650 3300046809 Bacteria 2430
289 Ga0495600_0096324 3300046809 Bacteria 1929
290 Ga0495674_0107820 3300047319 Bacteria 2364
291 Ga0495674_0544244 3300047319 Bacteria 925
292 Ga0495676_0445087 3300047321 Unclassified 855
293 Ga0495602_0027786 3300048088 Bacteria 5429
294 Ga0495602_1086710 3300048088 Bacteria 525
295 Ga0496100_0085337 3300048903 Bacteria 2143
296 Ga0496101_0020033 3300048904 Bacteria 4573
297 Ga0496102_0076686 3300048905 Bacteria 3075
298 Ga0496102_0103001 3300048905 Bacteria 2654
299 Ga0496102_0112125 3300048905 Bacteria 2543
300 Ga0496103_0020716 3300048906 Bacteria 3953
301 Ga0496103_0040179 3300048906 Bacteria 2875
302 Ga0496104_0231060 3300048907 Bacteria 1761
303 Ga0496104_1310825 3300048907 Bacteria 627
304 Ga0496105_0093671 3300048908 Bacteria 2480
305 Ga0496105_1340420 3300048908 Bacteria 521
306 Ga0496106_0018533 3300048909 Bacteria 5148
307 Ga0496106_0037663 3300048909 Bacteria 3618
308 Ga0496107_0104224 3300048910 Bacteria 2081
309 Ga0496107_0156874 3300048910 Bacteria 1685
310 Ga0496109_0118681 3300048912 Bacteria 2462
311 Ga0496109_0298840 3300048912 Bacteria 1518
312 Ga0496110_0013745 3300048913 Bacteria 6708
313 Ga0496111_0112857 3300048914 Bacteria 2002
314 Ga0496111_0312252 3300048914 Bacteria 1165
315 Ga0496112_0011692 3300048915 Bacteria 8030
316 Ga0496112_0034303 3300048915 Bacteria 4938
317 Ga0496112_0044782 3300048915 Bacteria 4336
318 Ga0496112_0085062 3300048915 Bacteria 3129
319 Ga0496112_0105788 3300048915 Bacteria 2783
320 Ga0496112_0776579 3300048915 Bacteria 883
321 Ga0496113_0039372 3300048916 Bacteria 3479
322 Ga0496113_0047186 3300048916 Bacteria 3201
323 Ga0496113_0066684 3300048916 Bacteria 2727
324 Ga0496114_0006948 3300048917 Bacteria 8916
325 Ga0496114_0767382 3300048917 Bacteria 842
326 Ga0501031_0000214 3300049568 Bacteria 33045
327 Ga0501031_0000304 3300049568 Bacteria 28124
328 Ga0501031_0255185 3300049568 Bacteria 1139
329 Ga0501031_0779276 3300049568 Bacteria 613
330 Ga0501032_0018981 3300049569 Bacteria 4810
331 Ga0501033_0000428 3300049570 Bacteria 40234
332 Ga0501033_0020323 3300049570 Bacteria 5016
333 Ga0501033_0135975 3300049570 Bacteria 1778
334 Ga0501033_0290725 3300049570 Bacteria 1152
335 Ga0501034_0083327 3300049571 Bacteria 3199
336 Ga0501034_0328610 3300049571 Bacteria 1461
337 Ga0501036_0183734 3300049572 Bacteria 1760
338 Ga0501037_0051956 3300049573 Bacteria 2997
339 Ga0501037_0265804 3300049573 Bacteria 1198
340 Ga0501038_0000273 3300049574 Bacteria 43671
341 Ga0501038_0095671 3300049574 Bacteria 2480
342 Ga0501038_0115211 3300049574 Bacteria 2222
343 Ga0501039_0000436 3300049575 Bacteria 30160
344 Ga0501039_0054109 3300049575 Bacteria 3106
345 Ga0501039_0261797 3300049575 Bacteria 1359
346 Ga0501039_0907183 3300049575 Bacteria 686
347 Ga0501040_0000284 3300049576 Bacteria 29552
348 Ga0501040_0000350 3300049576 Bacteria 27112
349 Ga0501040_0007884 3300049576 Bacteria 6903
350 Ga0501040_0013075 3300049576 Bacteria 5458
351 Ga0501040_0071056 3300049576 Bacteria 2403
352 Ga0501040_1399640 3300049576 Bacteria 508
353 Ga0501041_0001099 3300049577 Bacteria 14814
354 Ga0501041_0001452 3300049577 Bacteria 13097
355 Ga0501041_0034777 3300049577 Bacteria 3051
356 Ga0501041_0091546 3300049577 Bacteria 1877
357 Ga0501041_0721221 3300049577 Bacteria 638
358 Ga0501041_0763334 3300049577 Bacteria 619
359 Ga0501042_0000498 3300049578 Bacteria 20401
360 Ga0501042_0000810 3300049578 Bacteria 17244
361 Ga0501042_0854372 3300049578 Bacteria 663
362 Ga0501042_0952109 3300049578 Bacteria 625
363 Ga0501043_0011225 3300049579 Bacteria 7016
364 Ga0501043_0717594 3300049579 Bacteria 729
365 Ga0501046_0001706 3300049580 Bacteria 20988
366 Ga0501046_0020198 3300049580 Bacteria 5513
367 Ga0501046_0269900 3300049580 Bacteria 1248
368 Ga0501046_0514281 3300049580 Bacteria 856
369 Ga0501047_0001281 3300049581 Bacteria 24843
370 Ga0501048_0003889 3300049582 Bacteria 11363
371 Ga0501048_0018266 3300049582 Bacteria 5158
372 Ga0501048_0023806 3300049582 Bacteria 4472
373 Ga0501048_0856288 3300049582 Bacteria 653
374 Ga0501067_0027526 3300049583 Bacteria 3150
375 Ga0501067_0160272 3300049583 Bacteria 1253
376 Ga0501067_0300130 3300049583 Bacteria 894
377 Ga0501068_0001331 3300049584 Bacteria 13096
378 Ga0501068_0005687 3300049584 Bacteria 6825
379 Ga0501068_0067593 3300049584 Bacteria 2178
380 Ga0501068_1007832 3300049584 Bacteria 550
381 Ga0501069_0006981 3300049585 Bacteria 5907
382 Ga0501069_0069535 3300049585 Bacteria 1971
383 Ga0501069_0115967 3300049585 Bacteria 1528
384 Ga0501069_0206133 3300049585 Bacteria 1140
385 Ga0501070_0004591 3300049586 Bacteria 11836
386 Ga0501070_0015606 3300049586 Bacteria 6387
387 Ga0501070_0415310 3300049586 Bacteria 1087
388 Ga0501070_0461158 3300049586 Bacteria 1024
389 Ga0501071_0000091 3300049587 Bacteria 33638
390 Ga0501071_0002769 3300049587 Bacteria 10770
391 Ga0501071_0084646 3300049587 Bacteria 2324
392 Ga0501071_0860758 3300049587 Bacteria 699
393 Ga0501072_0003281 3300049588 Bacteria 12161
394 Ga0501072_0280819 3300049588 Bacteria 1324
395 Ga0501072_0400781 3300049588 Bacteria 1088
396 Ga0501073_0070247 3300049589 Bacteria 2440
397 Ga0501074_0004681 3300049590 Bacteria 9795
398 Ga0501074_0134808 3300049590 Bacteria 1766
399 Ga0501075_0001784 3300049591 Bacteria 14160
400 Ga0501075_0008806 3300049591 Bacteria 7034
401 Ga0501075_0015237 3300049591 Bacteria 5513
402 Ga0501075_0103183 3300049591 Bacteria 2166
403 Ga0501076_0000296 3300049592 Bacteria 30968
404 Ga0501076_0001903 3300049592 Bacteria 14244
405 Ga0501076_0002239 3300049592 Bacteria 13245
406 Ga0501076_0310764 3300049592 Bacteria 1292
407 Ga0501076_0908548 3300049592 Bacteria 726
408 Ga0501077_0003088 3300049593 Bacteria 10012
409 Ga0501077_0010331 3300049593 Bacteria 5809
410 Ga0501077_0013136 3300049593 Bacteria 5189
411 Ga0501077_0106567 3300049593 Bacteria 1776
412 Ga0501077_0197047 3300049593 Bacteria 1279
413 Ga0501079_0000904 3300049741 Bacteria 20340
414 Ga0501079_0001871 3300049741 Bacteria 15095
415 Ga0501079_0018440 3300049741 Bacteria 5332
416 Ga0501079_0103129 3300049741 Bacteria 2212
417 Ga0501079_0250447 3300049741 Bacteria 1384
418 Ga0501079_0253015 3300049741 Bacteria 1377
419 Ga0501080_0039004 3300049742 Bacteria 4432
420 Ga0501080_0056534 3300049742 Bacteria 3653
421 Ga0501080_0543505 3300049742 Bacteria 1035
422 Ga0501080_1408734 3300049742 Bacteria 594
423 Ga0501081_0000099 3300049743 Bacteria 36039
424 Ga0501081_0007971 3300049743 Bacteria 6872
425 Ga0501081_0030852 3300049743 Bacteria 3631
426 Ga0501081_0432546 3300049743 Bacteria 976
427 Ga0501083_0001273 3300049744 Bacteria 17067
428 Ga0501083_0130904 3300049744 Bacteria 1644
429 Ga0501035_0004160 3300049822 Bacteria 13754
430 Ga0501035_0022334 3300049822 Bacteria 5809
431 Ga0501035_0406956 3300049822 Bacteria 1131
432 Ga0501044_0007728 3300049823 Bacteria 11823
433 Ga0501044_0067724 3300049823 Bacteria 3637
434 Ga0501045_0000770 3300049824 Bacteria 20566
435 Ga0501045_0003529 3300049824 Bacteria 10721
436 Ga0501045_0010199 3300049824 Bacteria 6576
437 Ga0501045_0543929 3300049824 Bacteria 861
438 nmdc:mga05p37_2024_c1 3300050507 Bacteria 23640
439 nmdc:mga09592_9117_c1 3300050508 Bacteria 8069
440 nmdc:mga0qj67_145734_c1 3300050509 Bacteria 1920
441 nmdc:mga0qj67_186279_c1 3300050509 Bacteria 1686
442 nmdc:mga0qj67_40372_c1 3300050509 Bacteria 3668
443 nmdc:mga06r32_231221_c1 3300050510 Bacteria 1837
444 nmdc:mga0a205_1143665_c1 3300050515 Bacteria 626
445 Ga0495601_0026886 3300053077 Bacteria 3555
446 Ga0495595_0087143 3300053084 Bacteria 1494
447 Ga0495619_0015432 3300053085 Bacteria 4833
448 Ga0501084_0001310 3300054114 Bacteria 19574
449 Ga0501084_0005992 3300054114 Bacteria 10000
450 Ga0501084_0086426 3300054114 Bacteria 2633
451 Ga0501084_0117368 3300054114 Bacteria 2237
452 Ga0501084_0205080 3300054114 Bacteria 1664
453 Ga0501084_0223956 3300054114 Bacteria 1587
454 Ga0501082_0001487 3300060353 Bacteria 20624
455 Ga0501082_0005780 3300060353 Bacteria 10736
456 Ga0501082_0083630 3300060353 Bacteria 2753
457 Ga0501082_0164688 3300060353 Bacteria 1927
458 Ga0501082_0301571 3300060353 Bacteria 1395
459 Ga0530510_0000824 3300061734 Bacteria 20340
460 Ga0530510_0003958 3300061734 Bacteria 10217
461 Ga0530510_0012147 3300061734 Bacteria 6045
462 Ga0530510_0059603 3300061734 Bacteria 2761
463 Ga0530510_0652986 3300061734 Bacteria 801
464 Ga0530510_0847215 3300061734 Bacteria 698

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046454 Ga0495592_0439504 Ga0495592_0439504_26_418 130
2 3300046461 Ga0495641_0392599 Ga0495641_0392599_223_615 130
3 3300046516 Ga0495628_0433330 Ga0495628_0433330_251_703 144
4 3300047319 Ga0495674_0544244 Ga0495674_0544244_456_908 144
5 3300048088 Ga0495602_1086710 Ga0495602_1086710_16_468 144
6 3300035171 Ga0373946_0328785 Ga0373946_0328785_26_493 148
7 3300045836 Ga0466958_0021182 Ga0466958_0021182_200_667 148
8 3300045976 Ga0466967_0033941 Ga0466967_0033941_89_556 148
9 3300046461 Ga0495641_0008429 Ga0495641_0008429_348_815 148
10 3300049580 Ga0501046_0269900 Ga0501046_0269900_201_653 148
11 3300021441 Ga0213871_10008275 Ga0213871_100082753 149
12 3300039438 Ga0436360_1011977 Ga0436360_1011977_919_1371 149
13 3300044684 Ga0466966_0041313 Ga0466966_0041313_1870_2319 149
14 3300044719 Ga0466971_0042345 Ga0466971_0042345_28_477 149
15 3300044842 Ga0466957_0178946 Ga0466957_0178946_117_566 149
16 3300045836 Ga0466958_0056558 Ga0466958_0056558_80_529 149
17 3300005327 Ga0070658_10046223 Ga0070658_100462236 150
18 3300005329 Ga0070683_101321265 Ga0070683_1013212651 150
19 3300005336 Ga0070680_100174085 Ga0070680_1001740852 150
20 3300005337 Ga0070682_100094162 Ga0070682_1000941622 150
21 3300005339 Ga0070660_100009622 Ga0070660_1000096222 150
22 3300005339 Ga0070660_100027532 Ga0070660_1000275325 150
23 3300005339 Ga0070660_100244549 Ga0070660_1002445493 150
24 3300005344 Ga0070661_100116702 Ga0070661_1001167023 150
25 3300005366 Ga0070659_100384164 Ga0070659_1003841642 150
26 3300005435 Ga0070714_100168255 Ga0070714_1001682552 150
27 3300005444 Ga0070694_100033647 Ga0070694_1000336472 150
28 3300005458 Ga0070681_10227932 Ga0070681_102279322 150
29 3300005468 Ga0070707_100122895 Ga0070707_1001228953 150
30 3300005530 Ga0070679_100028071 Ga0070679_1000280716 150
31 3300005530 Ga0070679_100093186 Ga0070679_1000931863 150
32 3300005530 Ga0070679_100150653 Ga0070679_1001506532 150
33 3300005563 Ga0068855_100067821 Ga0068855_1000678214 150
34 3300005563 Ga0068855_100306062 Ga0068855_1003060622 150
35 3300005614 Ga0068856_100363415 Ga0068856_1003634152 150
36 3300005616 Ga0068852_100085284 Ga0068852_1000852844 150
37 3300009093 Ga0105240_10110154 Ga0105240_101101544 150
38 3300009174 Ga0105241_10096462 Ga0105241_100964623 150
39 3300009551 Ga0105238_10354487 Ga0105238_103544873 150
40 3300013100 Ga0157373_10162348 Ga0157373_101623482 150
41 3300013102 Ga0157371_10072094 Ga0157371_100720942 150
42 3300013104 Ga0157370_10029792 Ga0157370_100297927 150
43 3300013104 Ga0157370_10587161 Ga0157370_105871611 150
44 3300013105 Ga0157369_10034321 Ga0157369_100343216 150
45 3300013105 Ga0157369_10081681 Ga0157369_100816814 150
46 3300020070 Ga0206356_11318110 Ga0206356_113181104 150
47 3300020081 Ga0206354_11248895 Ga0206354_112488954 150
48 3300020082 Ga0206353_10829062 Ga0206353_108290622 150
49 3300025909 Ga0207705_10161142 Ga0207705_101611423 150
50 3300025911 Ga0207654_10225113 Ga0207654_102251132 150
51 3300025912 Ga0207707_10232791 Ga0207707_102327912 150
52 3300025913 Ga0207695_10302506 Ga0207695_103025063 150
53 3300025917 Ga0207660_10597043 Ga0207660_105970431 150
54 3300025919 Ga0207657_10024058 Ga0207657_100240582 150
55 3300025919 Ga0207657_10087820 Ga0207657_100878202 150
56 3300025919 Ga0207657_10175451 Ga0207657_101754512 150
57 3300025920 Ga0207649_10071062 Ga0207649_100710624 150
58 3300025921 Ga0207652_10153587 Ga0207652_101535872 150
59 3300025921 Ga0207652_10229982 Ga0207652_102299824 150
60 3300025922 Ga0207646_10073448 Ga0207646_100734483 150
61 3300025924 Ga0207694_10734503 Ga0207694_107345031 150
62 3300025929 Ga0207664_10343346 Ga0207664_103433462 150
63 3300025932 Ga0207690_11062141 Ga0207690_110621411 150
64 3300025944 Ga0207661_11268329 Ga0207661_112683291 150
65 3300025949 Ga0207667_10104427 Ga0207667_101044273 150
66 3300025981 Ga0207640_10032513 Ga0207640_100325134 150
67 3300026078 Ga0207702_10333012 Ga0207702_103330122 150
68 3300026142 Ga0207698_10089227 Ga0207698_100892272 150
69 3300028800 Ga0265338_10086777 Ga0265338_100867773 150
70 3300028800 Ga0265338_10599854 Ga0265338_105998542 150
71 3300035725 Ga0373947_0249685 Ga0373947_0249685_564_1016 150
72 3300037312 Ga0395899_0103937 Ga0395899_0103937_875_1327 150
73 3300037471 Ga0395905_0109537 Ga0395905_0109537_72_524 150
74 3300038443 Ga0395901_0492761 Ga0395901_0492761_215_667 150
75 3300038443 Ga0395901_1208796 Ga0395901_1208796_123_575 150
76 3300044694 Ga0466963_0002598 Ga0466963_0002598_506_958 150
77 3300044842 Ga0466957_0497689 Ga0466957_0497689_62_514 150
78 3300045976 Ga0466967_0911403 Ga0466967_0911403_243_695 150
79 3300046455 Ga0495603_0263527 Ga0495603_0263527_486_938 150
80 3300048905 Ga0496102_0112125 Ga0496102_0112125_550_1002 150
81 3300048907 Ga0496104_1310825 Ga0496104_1310825_26_478 150
82 3300048908 Ga0496105_1340420 Ga0496105_1340420_17_469 150
83 3300048915 Ga0496112_0011692 Ga0496112_0011692_4768_5220 150
84 3300048915 Ga0496112_0105788 Ga0496112_0105788_1322_1774 150
85 3300048916 Ga0496113_0066684 Ga0496113_0066684_2050_2502 150
86 3300048917 Ga0496114_0767382 Ga0496114_0767382_276_728 150
87 3300005327 Ga0070658_10213436 Ga0070658_102134362 151
88 3300005337 Ga0070682_100158887 Ga0070682_1001588872 151
89 3300005355 Ga0070671_100063051 Ga0070671_1000630513 151
90 3300005435 Ga0070714_100505678 Ga0070714_1005056781 151
91 3300005435 Ga0070714_101234004 Ga0070714_1012340042 151
92 3300005436 Ga0070713_100054997 Ga0070713_1000549973 151
93 3300005437 Ga0070710_10043347 Ga0070710_100433472 151
94 3300005439 Ga0070711_100050255 Ga0070711_1000502553 151
95 3300005468 Ga0070707_100497613 Ga0070707_1004976132 151
96 3300005535 Ga0070684_100251485 Ga0070684_1002514852 151
97 3300005539 Ga0068853_100584454 Ga0068853_1005844541 151
98 3300005617 Ga0068859_101255521 Ga0068859_1012555212 151
99 3300005937 Ga0081455_10040418 Ga0081455_100404184 151
100 3300006028 Ga0070717_10016012 Ga0070717_100160124 151
101 3300006163 Ga0070715_10009602 Ga0070715_100096024 151
102 3300006173 Ga0070716_100037561 Ga0070716_1000375614 151
103 3300006175 Ga0070712_100034028 Ga0070712_1000340283 151
104 3300006237 Ga0097621_100185375 Ga0097621_1001853753 151
105 3300006358 Ga0068871_100927447 Ga0068871_1009274471 151
106 3300006931 Ga0097620_101255547 Ga0097620_1012555472 151
107 3300009011 Ga0105251_10100170 Ga0105251_101001702 151
108 3300009101 Ga0105247_10497604 Ga0105247_104976041 151
109 3300009174 Ga0105241_10283371 Ga0105241_102833713 151
110 3300009551 Ga0105238_10898615 Ga0105238_108986152 151
111 3300013296 Ga0157374_10023100 Ga0157374_100231005 151
112 3300014325 Ga0163163_11154400 Ga0163163_111544002 151
113 3300014497 Ga0182008_10006843 Ga0182008_100068436 151
114 3300014968 Ga0157379_10287856 Ga0157379_102878563 151
115 3300015261 Ga0182006_1010744 Ga0182006_10107443 151
116 3300015262 Ga0182007_10007092 Ga0182007_100070922 151
117 3300020081 Ga0206354_10516362 Ga0206354_105163622 151
118 3300025905 Ga0207685_10015949 Ga0207685_100159492 151
119 3300025906 Ga0207699_10040090 Ga0207699_100400903 151
120 3300025909 Ga0207705_10169397 Ga0207705_101693973 151
121 3300025915 Ga0207693_10002992 Ga0207693_1000299216 151
122 3300025916 Ga0207663_10017338 Ga0207663_100173383 151
123 3300025921 Ga0207652_10089285 Ga0207652_100892853 151
124 3300025927 Ga0207687_10186918 Ga0207687_101869182 151
125 3300025928 Ga0207700_10439855 Ga0207700_104398552 151
126 3300025929 Ga0207664_10262062 Ga0207664_102620623 151
127 3300025931 Ga0207644_10053950 Ga0207644_100539503 151
128 3300025939 Ga0207665_10000070 Ga0207665_100000703 151
129 3300025944 Ga0207661_10165185 Ga0207661_101651852 151
130 3300025945 Ga0207679_10678371 Ga0207679_106783711 151
131 3300026041 Ga0207639_10524777 Ga0207639_105247772 151
132 3300035088 Ga0373940_0045866 Ga0373940_0045866_258_713 151
133 3300035114 Ga0373939_0395465 Ga0373939_0395465_63_518 151
134 3300037312 Ga0395899_0013856 Ga0395899_0013856_434_889 151
135 3300037466 Ga0395898_0488403 Ga0395898_0488403_37_492 151
136 3300037466 Ga0395898_0636229 Ga0395898_0636229_197_652 151
137 3300037466 Ga0395898_1593195 Ga0395898_1593195_71_526 151
138 3300037471 Ga0395905_0017747 Ga0395905_0017747_5129_5584 151
139 3300044684 Ga0466966_0041732 Ga0466966_0041732_2293_2748 151
140 3300044693 Ga0466961_0165230 Ga0466961_0165230_818_1273 151
141 3300044694 Ga0466963_0093775 Ga0466963_0093775_864_1319 151
142 3300044706 Ga0466964_0660878 Ga0466964_0660878_60_515 151
143 3300044735 Ga0466968_0211337 Ga0466968_0211337_349_804 151
144 3300044842 Ga0466957_0151498 Ga0466957_0151498_553_1008 151
145 3300044842 Ga0466957_0153252 Ga0466957_0153252_137_592 151
146 3300045049 Ga0466959_0087589 Ga0466959_0087589_785_1240 151
147 3300045836 Ga0466958_0110417 Ga0466958_0110417_1026_1481 151
148 3300045836 Ga0466958_0373591 Ga0466958_0373591_184_639 151
149 3300045976 Ga0466967_0054541 Ga0466967_0054541_1872_2327 151
150 3300045976 Ga0466967_0205843 Ga0466967_0205843_463_918 151
151 3300045976 Ga0466967_1508679 Ga0466967_1508679_181_636 151
152 3300046473 Ga0495582_0624298 Ga0495582_0624298_84_539 151
153 3300046680 Ga0495646_0151267 Ga0495646_0151267_436_891 151
154 3300046690 Ga0495624_0401067 Ga0495624_0401067_184_639 151
155 3300047321 Ga0495676_0445087 Ga0495676_0445087_355_810 151
156 3300048903 Ga0496100_0085337 Ga0496100_0085337_1644_2099 151
157 3300048904 Ga0496101_0020033 Ga0496101_0020033_2546_3001 151
158 3300048905 Ga0496102_0076686 Ga0496102_0076686_1528_1983 151
159 3300048906 Ga0496103_0020716 Ga0496103_0020716_2262_2717 151
160 3300048907 Ga0496104_0231060 Ga0496104_0231060_186_641 151
161 3300048908 Ga0496105_0093671 Ga0496105_0093671_173_628 151
162 3300048909 Ga0496106_0037663 Ga0496106_0037663_1394_1849 151
163 3300048910 Ga0496107_0156874 Ga0496107_0156874_371_826 151
164 3300048912 Ga0496109_0118681 Ga0496109_0118681_1095_1550 151
165 3300048913 Ga0496110_0013745 Ga0496110_0013745_5389_5844 151
166 3300048914 Ga0496111_0112857 Ga0496111_0112857_16_471 151
167 3300048914 Ga0496111_0312252 Ga0496111_0312252_15_470 151
168 3300048916 Ga0496113_0039372 Ga0496113_0039372_1095_1550 151
169 3300048917 Ga0496114_0006948 Ga0496114_0006948_1176_1631 151
170 3300049583 Ga0501067_0027526 Ga0501067_0027526_2244_2699 151
171 3300049583 Ga0501067_0300130 Ga0501067_0300130_123_578 151
172 3300049585 Ga0501069_0069535 Ga0501069_0069535_1002_1457 151
173 3300049586 Ga0501070_0461158 Ga0501070_0461158_293_748 151
174 3300005327 Ga0070658_10032587 Ga0070658_100325874 152
175 3300005337 Ga0070682_100014383 Ga0070682_1000143835 152
176 3300005344 Ga0070661_100628849 Ga0070661_1006288492 152
177 3300005366 Ga0070659_100363918 Ga0070659_1003639182 152
178 3300005434 Ga0070709_10811301 Ga0070709_108113012 152
179 3300005435 Ga0070714_100002979 Ga0070714_1000029799 152
180 3300005458 Ga0070681_10095974 Ga0070681_100959743 152
181 3300005458 Ga0070681_10137338 Ga0070681_101373382 152
182 3300005471 Ga0070698_100248240 Ga0070698_1002482403 152
183 3300005530 Ga0070679_100029662 Ga0070679_1000296625 152
184 3300005546 Ga0070696_100508752 Ga0070696_1005087522 152
185 3300009093 Ga0105240_10667708 Ga0105240_106677081 152
186 3300009545 Ga0105237_10795308 Ga0105237_107953082 152
187 3300013100 Ga0157373_10572786 Ga0157373_105727862 152
188 3300013104 Ga0157370_11251169 Ga0157370_112511691 152
189 3300013307 Ga0157372_12125899 Ga0157372_121258991 152
190 3300014497 Ga0182008_10676638 Ga0182008_106766382 152
191 3300020082 Ga0206353_10127145 Ga0206353_101271453 152
192 3300025906 Ga0207699_10269031 Ga0207699_102690313 152
193 3300025909 Ga0207705_10122858 Ga0207705_101228583 152
194 3300025912 Ga0207707_10047911 Ga0207707_100479115 152
195 3300025912 Ga0207707_10074774 Ga0207707_100747742 152
196 3300025912 Ga0207707_10178047 Ga0207707_101780472 152
197 3300025914 Ga0207671_10567436 Ga0207671_105674362 152
198 3300025916 Ga0207663_10532085 Ga0207663_105320852 152
199 3300025917 Ga0207660_10185621 Ga0207660_101856213 152
200 3300025919 Ga0207657_10009122 Ga0207657_100091226 152
201 3300025919 Ga0207657_10428155 Ga0207657_104281551 152
202 3300025921 Ga0207652_10006261 Ga0207652_100062611 152
203 3300025921 Ga0207652_10060270 Ga0207652_100602702 152
204 3300025921 Ga0207652_10949584 Ga0207652_109495841 152
205 3300025929 Ga0207664_10029811 Ga0207664_100298115 152
206 3300025929 Ga0207664_10572933 Ga0207664_105729331 152
207 3300025932 Ga0207690_10606471 Ga0207690_106064712 152
208 3300025949 Ga0207667_10999912 Ga0207667_109999122 152
209 3300026041 Ga0207639_10504756 Ga0207639_105047562 152
210 3300026041 Ga0207639_10775917 Ga0207639_107759171 152
211 3300026067 Ga0207678_10439040 Ga0207678_104390401 152
212 3300031901 Ga0307406_10607448 Ga0307406_106074482 152
213 3300037312 Ga0395899_0009475 Ga0395899_0009475_2840_3304 152
214 3300037312 Ga0395899_0042176 Ga0395899_0042176_1215_1676 152
215 3300037418 Ga0395900_0004419 Ga0395900_0004419_1561_2022 152
216 3300037418 Ga0395900_0909826 Ga0395900_0909826_287_751 152
217 3300037418 Ga0395900_1443815 Ga0395900_1443815_113_577 152
218 3300037466 Ga0395898_0056047 Ga0395898_0056047_1370_1831 152
219 3300037466 Ga0395898_0635530 Ga0395898_0635530_442_906 152
220 3300037466 Ga0395898_0829730 Ga0395898_0829730_342_806 152
221 3300037466 Ga0395898_1245920 Ga0395898_1245920_172_636 152
222 3300037471 Ga0395905_0025436 Ga0395905_0025436_1752_2213 152
223 3300038443 Ga0395901_0157219 Ga0395901_0157219_1179_1640 152
224 3300038996 Ga0242420_013647 Ga0242420_013647_798_1262 152
225 3300041456 Ga0451795_1563686 Ga0451795_1563686_57_521 152
226 3300042438 Ga0439459_0025307 Ga0439459_0025307_242_706 152
227 3300042876 Ga0451577_0508578 Ga0451577_0508578_512_976 152
228 3300044658 Ga0466972_0183753 Ga0466972_0183753_251_715 152
229 3300044694 Ga0466963_0601952 Ga0466963_0601952_242_706 152
230 3300044694 Ga0466963_0607569 Ga0466963_0607569_27_491 152
231 3300044694 Ga0466963_1235789 Ga0466963_1235789_13_477 152
232 3300044735 Ga0466968_0053290 Ga0466968_0053290_750_1214 152
233 3300044735 Ga0466968_0558859 Ga0466968_0558859_81_545 152
234 3300045049 Ga0466959_0342589 Ga0466959_0342589_515_979 152
235 3300045051 Ga0451576_1132348 Ga0451576_1132348_55_519 152
236 3300045836 Ga0466958_0094016 Ga0466958_0094016_1236_1700 152
237 3300045836 Ga0466958_0149354 Ga0466958_0149354_593_1057 152
238 3300045976 Ga0466967_0000153 Ga0466967_0000153_26267_26731 152
239 3300045976 Ga0466967_0086295 Ga0466967_0086295_1224_1688 152
240 3300045976 Ga0466967_0161138 Ga0466967_0161138_13_477 152
241 3300046459 Ga0495629_0159714 Ga0495629_0159714_941_1405 152
242 3300046463 Ga0495653_0028915 Ga0495653_0028915_3749_4213 152
243 3300046511 Ga0495608_0176979 Ga0495608_0176979_29_493 152
244 3300046514 Ga0495618_0370454 Ga0495618_0370454_212_676 152
245 3300046517 Ga0495630_0201418 Ga0495630_0201418_787_1251 152
246 3300046535 Ga0495586_0006586 Ga0495586_0006586_5131_5589 152
247 3300046559 Ga0495667_0444076 Ga0495667_0444076_318_782 152
248 3300046615 Ga0495656_0153758 Ga0495656_0153758_135_599 152
249 3300046642 Ga0495634_0106384 Ga0495634_0106384_99_563 152
250 3300046675 Ga0495657_0136477 Ga0495657_0136477_604_1068 152
251 3300046683 Ga0495658_0189390 Ga0495658_0189390_519_977 152
252 3300046683 Ga0495658_0285870 Ga0495658_0285870_161_625 152
253 3300046689 Ga0495613_0087077 Ga0495613_0087077_1591_2049 152
254 3300046690 Ga0495624_0262851 Ga0495624_0262851_247_714 152
255 3300046809 Ga0495600_0096324 Ga0495600_0096324_507_971 152
256 3300048905 Ga0496102_0103001 Ga0496102_0103001_1225_1689 152
257 3300048906 Ga0496103_0040179 Ga0496103_0040179_272_736 152
258 3300048909 Ga0496106_0018533 Ga0496106_0018533_1444_1908 152
259 3300048910 Ga0496107_0104224 Ga0496107_0104224_796_1260 152
260 3300048912 Ga0496109_0298840 Ga0496109_0298840_742_1206 152
261 3300048915 Ga0496112_0034303 Ga0496112_0034303_4118_4582 152
262 3300048915 Ga0496112_0044782 Ga0496112_0044782_1587_2051 152
263 3300048915 Ga0496112_0085062 Ga0496112_0085062_1759_2223 152
264 3300048915 Ga0496112_0776579 Ga0496112_0776579_325_789 152
265 3300048916 Ga0496113_0047186 Ga0496113_0047186_2342_2806 152
266 3300049568 Ga0501031_0779276 Ga0501031_0779276_116_574 152
267 3300049570 Ga0501033_0135975 Ga0501033_0135975_107_565 152
268 3300049576 Ga0501040_0007884 Ga0501040_0007884_2078_2536 152
269 3300049577 Ga0501041_0091546 Ga0501041_0091546_1287_1745 152
270 3300049577 Ga0501041_0721221 Ga0501041_0721221_46_510 152
271 3300049583 Ga0501067_0160272 Ga0501067_0160272_717_1181 152
272 3300049584 Ga0501068_0067593 Ga0501068_0067593_1697_2155 152
273 3300049585 Ga0501069_0206133 Ga0501069_0206133_611_1075 152
274 3300049591 Ga0501075_0008806 Ga0501075_0008806_1770_2228 152
275 3300049592 Ga0501076_0908548 Ga0501076_0908548_165_629 152
276 3300049593 Ga0501077_0013136 Ga0501077_0013136_4613_5071 152
277 3300049593 Ga0501077_0106567 Ga0501077_0106567_968_1432 152
278 3300049741 Ga0501079_0018440 Ga0501079_0018440_126_584 152
279 3300049741 Ga0501079_0253015 Ga0501079_0253015_115_579 152
280 3300049824 Ga0501045_0010199 Ga0501045_0010199_1417_1875 152
281 3300050515 nmdc:mga0a205_1143665_c1 nmdc:mga0a205_1143665_c1_102_566 152
282 3300053085 Ga0495619_0015432 Ga0495619_0015432_973_1437 152
283 3300054114 Ga0501084_0205080 Ga0501084_0205080_661_1125 152
284 3300060353 Ga0501082_0164688 Ga0501082_0164688_619_1083 152
285 3300005435 Ga0070714_100019455 Ga0070714_1000194553 153
286 3300005436 Ga0070713_100011606 Ga0070713_1000116064 153
287 3300005981 Ga0081538_10058135 Ga0081538_100581352 153
288 3300005981 Ga0081538_10059772 Ga0081538_100597722 153
289 3300006028 Ga0070717_10011023 Ga0070717_100110237 153
290 3300006844 Ga0075428_100218303 Ga0075428_1002183032 153
291 3300006846 Ga0075430_100041487 Ga0075430_1000414873 153
292 3300006880 Ga0075429_100137011 Ga0075429_1001370112 153
293 3300009147 Ga0114129_10005345 Ga0114129_1000534516 153
294 3300021441 Ga0213871_10017072 Ga0213871_100170722 153
295 3300025928 Ga0207700_10093252 Ga0207700_100932524 153
296 3300025929 Ga0207664_10091921 Ga0207664_100919214 153
297 3300025949 Ga0207667_10152589 Ga0207667_101525894 153
298 3300028563 Ga0265319_1084080 Ga0265319_10840801 153
299 3300028573 Ga0265334_10009863 Ga0265334_100098633 153
300 3300028573 Ga0265334_10129567 Ga0265334_101295671 153
301 3300028653 Ga0265323_10091445 Ga0265323_100914451 153
302 3300028800 Ga0265338_10011084 Ga0265338_100110842 153
303 3300028800 Ga0265338_10013886 Ga0265338_100138869 153
304 3300028800 Ga0265338_10678874 Ga0265338_106788741 153
305 3300028800 Ga0265338_10687470 Ga0265338_106874702 153
306 3300031235 Ga0265330_10069502 Ga0265330_100695022 153
307 3300031240 Ga0265320_10057262 Ga0265320_100572622 153
308 3300031241 Ga0265325_10052206 Ga0265325_100522062 153
309 3300031242 Ga0265329_10001736 Ga0265329_100017367 153
310 3300031251 Ga0265327_10020427 Ga0265327_100204275 153
311 3300031595 Ga0265313_10033218 Ga0265313_100332184 153
312 3300031712 Ga0265342_10479291 Ga0265342_104792911 153
313 3300035241 Ga0373961_0269934 Ga0373961_0269934_140_607 153
314 3300037068 Ga0373925_1466402 Ga0373925_1466402_53_520 153
315 3300039438 Ga0436360_0665838 Ga0436360_0665838_1405_1872 153
316 3300044656 Ga0466969_0319956 Ga0466969_0319956_88_555 153
317 3300044683 Ga0466965_0170480 Ga0466965_0170480_306_773 153
318 3300044684 Ga0466966_0007789 Ga0466966_0007789_3309_3776 153
319 3300044693 Ga0466961_0016634 Ga0466961_0016634_3112_3579 153
320 3300044735 Ga0466968_0090748 Ga0466968_0090748_800_1267 153
321 3300044842 Ga0466957_0799620 Ga0466957_0799620_50_520 153
322 3300045049 Ga0466959_0002669 Ga0466959_0002669_5718_6185 153
323 3300045976 Ga0466967_1565110 Ga0466967_1565110_167_637 153
324 3300046454 Ga0495592_0041625 Ga0495592_0041625_2478_2945 153
325 3300046462 Ga0495651_0099870 Ga0495651_0099870_1382_1849 153
326 3300046511 Ga0495608_0391242 Ga0495608_0391242_80_547 153
327 3300046516 Ga0495628_0112456 Ga0495628_0112456_108_575 153
328 3300046517 Ga0495630_1082224 Ga0495630_1082224_51_518 153
329 3300046529 Ga0495652_0260226 Ga0495652_0260226_25_492 153
330 3300046543 Ga0495645_0179706 Ga0495645_0179706_433_900 153
331 3300046559 Ga0495667_0353297 Ga0495667_0353297_326_793 153
332 3300046663 Ga0495635_0517562 Ga0495635_0517562_120_587 153
333 3300046678 Ga0495599_0010726 Ga0495599_0010726_197_664 153
334 3300046680 Ga0495646_0088341 Ga0495646_0088341_126_593 153
335 3300046809 Ga0495600_0062650 Ga0495600_0062650_1249_1716 153
336 3300047319 Ga0495674_0107820 Ga0495674_0107820_144_611 153
337 3300048088 Ga0495602_0027786 Ga0495602_0027786_27_494 153
338 3300049568 Ga0501031_0000304 Ga0501031_0000304_4607_5068 153
339 3300049570 Ga0501033_0020323 Ga0501033_0020323_241_702 153
340 3300049571 Ga0501034_0083327 Ga0501034_0083327_731_1192 153
341 3300049572 Ga0501036_0183734 Ga0501036_0183734_437_904 153
342 3300049573 Ga0501037_0265804 Ga0501037_0265804_573_1043 153
343 3300049574 Ga0501038_0095671 Ga0501038_0095671_731_1192 153
344 3300049575 Ga0501039_0054109 Ga0501039_0054109_2533_2994 153
345 3300049575 Ga0501039_0907183 Ga0501039_0907183_27_488 153
346 3300049576 Ga0501040_0000284 Ga0501040_0000284_28361_28822 153
347 3300049576 Ga0501040_1399640 Ga0501040_1399640_11_472 153
348 3300049577 Ga0501041_0001099 Ga0501041_0001099_13583_14044 153
349 3300049578 Ga0501042_0000810 Ga0501042_0000810_6171_6632 153
350 3300049578 Ga0501042_0854372 Ga0501042_0854372_143_604 153
351 3300049579 Ga0501043_0011225 Ga0501043_0011225_227_688 153
352 3300049580 Ga0501046_0020198 Ga0501046_0020198_4322_4783 153
353 3300049582 Ga0501048_0018266 Ga0501048_0018266_4457_4918 153
354 3300049584 Ga0501068_0005687 Ga0501068_0005687_241_702 153
355 3300049586 Ga0501070_0004591 Ga0501070_0004591_6791_7252 153
356 3300049586 Ga0501070_0415310 Ga0501070_0415310_15_485 153
357 3300049587 Ga0501071_0002769 Ga0501071_0002769_765_1226 153
358 3300049587 Ga0501071_0860758 Ga0501071_0860758_114_575 153
359 3300049588 Ga0501072_0003281 Ga0501072_0003281_731_1192 153
360 3300049591 Ga0501075_0015237 Ga0501075_0015237_4322_4783 153
361 3300049592 Ga0501076_0000296 Ga0501076_0000296_7440_7901 153
362 3300049593 Ga0501077_0010331 Ga0501077_0010331_731_1192 153
363 3300049741 Ga0501079_0000904 Ga0501079_0000904_19149_19610 153
364 3300049741 Ga0501079_0250447 Ga0501079_0250447_676_1137 153
365 3300049742 Ga0501080_0056534 Ga0501080_0056534_788_1249 153
366 3300049743 Ga0501081_0007971 Ga0501081_0007971_6171_6632 153
367 3300049743 Ga0501081_0432546 Ga0501081_0432546_271_732 153
368 3300049744 Ga0501083_0130904 Ga0501083_0130904_950_1411 153
369 3300049822 Ga0501035_0022334 Ga0501035_0022334_731_1192 153
370 3300049823 Ga0501044_0007728 Ga0501044_0007728_7041_7502 153
371 3300049824 Ga0501045_0000770 Ga0501045_0000770_771_1232 153
372 3300050507 nmdc:mga05p37_2024_c1 nmdc:mga05p37_2024_c1_8041_8502 153
373 3300050508 nmdc:mga09592_9117_c1 nmdc:mga09592_9117_c1_2380_2841 153
374 3300050509 nmdc:mga0qj67_145734_c1 nmdc:mga0qj67_145734_c1_1170_1631 153
375 3300050509 nmdc:mga0qj67_40372_c1 nmdc:mga0qj67_40372_c1_1297_1758 153
376 3300050510 nmdc:mga06r32_231221_c1 nmdc:mga06r32_231221_c1_1347_1808 153
377 3300053077 Ga0495601_0026886 Ga0495601_0026886_1323_1790 153
378 3300053084 Ga0495595_0087143 Ga0495595_0087143_799_1266 153
379 3300054114 Ga0501084_0001310 Ga0501084_0001310_18343_18804 153
380 3300060353 Ga0501082_0005780 Ga0501082_0005780_9545_10006 153
381 3300061734 Ga0530510_0000824 Ga0530510_0000824_19149_19610 153
382 3300061734 Ga0530510_0847215 Ga0530510_0847215_57_518 153
383 3300005937 Ga0081455_10097147 Ga0081455_100971472 154
384 3300005981 Ga0081538_10003176 Ga0081538_100031763 154
385 3300049568 Ga0501031_0000214 Ga0501031_0000214_3250_3717 154
386 3300049569 Ga0501032_0018981 Ga0501032_0018981_1561_2028 154
387 3300049570 Ga0501033_0000428 Ga0501033_0000428_32345_32812 154
388 3300049570 Ga0501033_0290725 Ga0501033_0290725_650_1141 154
389 3300049573 Ga0501037_0051956 Ga0501037_0051956_211_678 154
390 3300049574 Ga0501038_0000273 Ga0501038_0000273_12678_13145 154
391 3300049575 Ga0501039_0000436 Ga0501039_0000436_9947_10414 154
392 3300049576 Ga0501040_0000350 Ga0501040_0000350_16710_17177 154
393 3300049577 Ga0501041_0001452 Ga0501041_0001452_3230_3697 154
394 3300049578 Ga0501042_0000498 Ga0501042_0000498_16710_17177 154
395 3300049580 Ga0501046_0001706 Ga0501046_0001706_3942_4409 154
396 3300049581 Ga0501047_0001281 Ga0501047_0001281_7566_8033 154
397 3300049582 Ga0501048_0003889 Ga0501048_0003889_3250_3717 154
398 3300049584 Ga0501068_0001331 Ga0501068_0001331_8741_9208 154
399 3300049584 Ga0501068_1007832 Ga0501068_1007832_64_537 154
400 3300049585 Ga0501069_0006981 Ga0501069_0006981_4232_4699 154
401 3300049586 Ga0501070_0015606 Ga0501070_0015606_3250_3717 154
402 3300049587 Ga0501071_0000091 Ga0501071_0000091_3250_3717 154
403 3300049589 Ga0501073_0070247 Ga0501073_0070247_1357_1824 154
404 3300049590 Ga0501074_0004681 Ga0501074_0004681_5018_5485 154
405 3300049591 Ga0501075_0001784 Ga0501075_0001784_9401_9868 154
406 3300049592 Ga0501076_0002239 Ga0501076_0002239_3250_3717 154
407 3300049593 Ga0501077_0003088 Ga0501077_0003088_3250_3717 154
408 3300049741 Ga0501079_0001871 Ga0501079_0001871_9401_9868 154
409 3300049742 Ga0501080_0039004 Ga0501080_0039004_766_1233 154
410 3300049743 Ga0501081_0000099 Ga0501081_0000099_4164_4631 154
411 3300049744 Ga0501083_0001273 Ga0501083_0001273_4240_4707 154
412 3300049822 Ga0501035_0004160 Ga0501035_0004160_6992_7459 154
413 3300049823 Ga0501044_0067724 Ga0501044_0067724_3138_3605 154
414 3300049824 Ga0501045_0003529 Ga0501045_0003529_9487_9954 154
415 3300054114 Ga0501084_0005992 Ga0501084_0005992_133_600 154
416 3300060353 Ga0501082_0001487 Ga0501082_0001487_9401_9868 154
417 3300061734 Ga0530510_0003958 Ga0530510_0003958_1667_2134 154
418 3300049568 Ga0501031_0255185 Ga0501031_0255185_100_567 155
419 3300049571 Ga0501034_0328610 Ga0501034_0328610_354_821 155
420 3300049574 Ga0501038_0115211 Ga0501038_0115211_547_1014 155
421 3300049576 Ga0501040_0071056 Ga0501040_0071056_1148_1615 155
422 3300049577 Ga0501041_0034777 Ga0501041_0034777_1900_2367 155
423 3300049578 Ga0501042_0952109 Ga0501042_0952109_56_523 155
424 3300049579 Ga0501043_0717594 Ga0501043_0717594_20_487 155
425 3300049582 Ga0501048_0856288 Ga0501048_0856288_171_638 155
426 3300049585 Ga0501069_0115967 Ga0501069_0115967_875_1342 155
427 3300049587 Ga0501071_0084646 Ga0501071_0084646_1434_1901 155
428 3300049588 Ga0501072_0280819 Ga0501072_0280819_565_1032 155
429 3300049590 Ga0501074_0134808 Ga0501074_0134808_81_548 155
430 3300049591 Ga0501075_0103183 Ga0501075_0103183_1015_1482 155
431 3300049592 Ga0501076_0310764 Ga0501076_0310764_276_743 155
432 3300049742 Ga0501080_0543505 Ga0501080_0543505_519_986 155
433 3300049824 Ga0501045_0543929 Ga0501045_0543929_130_597 155
434 3300054114 Ga0501084_0086426 Ga0501084_0086426_1340_1807 155
435 3300054114 Ga0501084_0223956 Ga0501084_0223956_948_1415 155
436 3300060353 Ga0501082_0083630 Ga0501082_0083630_901_1368 155
437 3300060353 Ga0501082_0301571 Ga0501082_0301571_423_890 155
438 3300061734 Ga0530510_0059603 Ga0530510_0059603_1832_2299 155
439 3300061734 Ga0530510_0652986 Ga0530510_0652986_202_669 155
440 3300006844 Ga0075428_101145425 Ga0075428_1011454251 156
441 3300042461 Ga0439460_0071482 Ga0439460_0071482_345_815 156
442 3300050509 nmdc:mga0qj67_186279_c1 nmdc:mga0qj67_186279_c1_536_1006 156
443 3300003373 JGI25407J50210_10019775 JGI25407J50210_100197752 157
444 3300003373 JGI25407J50210_10043636 JGI25407J50210_100436361 157
445 3300005937 Ga0081455_10043286 Ga0081455_100432862 157
446 3300005981 Ga0081538_10000043 Ga0081538_10000043110 157
447 3300005981 Ga0081538_10008251 Ga0081538_1000825111 157
448 3300005981 Ga0081538_10014658 Ga0081538_100146582 157
449 3300005981 Ga0081538_10022360 Ga0081538_100223604 157
450 3300042013 Ga0439456_075418 Ga0439456_075418_100_585 157
451 3300049575 Ga0501039_0261797 Ga0501039_0261797_600_1100 157
452 3300049576 Ga0501040_0013075 Ga0501040_0013075_4532_5032 157
453 3300049577 Ga0501041_0763334 Ga0501041_0763334_52_552 157
454 3300049580 Ga0501046_0514281 Ga0501046_0514281_17_517 157
455 3300049582 Ga0501048_0023806 Ga0501048_0023806_642_1142 157
456 3300049588 Ga0501072_0400781 Ga0501072_0400781_560_1033 157
457 3300049592 Ga0501076_0001903 Ga0501076_0001903_11711_12211 157
458 3300049593 Ga0501077_0197047 Ga0501077_0197047_614_1114 157
459 3300049741 Ga0501079_0103129 Ga0501079_0103129_1639_2139 157
460 3300049742 Ga0501080_1408734 Ga0501080_1408734_17_517 157
461 3300049743 Ga0501081_0030852 Ga0501081_0030852_16_516 157
462 3300049822 Ga0501035_0406956 Ga0501035_0406956_612_1112 157
463 3300054114 Ga0501084_0117368 Ga0501084_0117368_622_1122 157
464 3300061734 Ga0530510_0012147 Ga0530510_0012147_4932_5432 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01668

SmpB

SmpB protein

10

147

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ob7-assembly1.cif.gz_B structure of tmrna-(smpb)2 complex as inferred from cryo-em 0.9599 8 131
1p6v-assembly2.cif.gz_C crystal structure of the trna domain of transfer-messenger rna in complex with smpb 0.9525 8 129
2ob7-assembly1.cif.gz_C structure of tmrna-(smpb)2 complex as inferred from cryo-em 0.9504 8 125
7ljp-assembly2.cif.gz_B structure of thermotoga maritima smpb 0.95 8 129
2ob7-assembly1.cif.gz_B structure of tmrna-(smpb)2 complex as inferred from cryo-em 0.9295 8 131
ID Description Score Start End Superfamily
af_P0A832_7_135_2.40.280.10 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.9608 5 129 2.40.280.10
2czjC00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.9301 13 129 2.40.280.10
af_P0A832_7_135_2.40.280.10 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.9244 5 129 2.40.280.10
2czjC00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.893 13 129 2.40.280.10
1j1hA00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.7139 9 129 2.40.280.10
ID Description Score Start End GO Terms
AF-A7L9H9-F1-model_v4 SmpB 0.9763 23 125 GO:0003723
GO:0005829
AF-A0A3C2C3N6-F1-model_v4 SsrA-binding protein 0.9737 8 120 GO:0003723
GO:0005829
AF-A0A660ZPQ7-F1-model_v4 SsrA-binding protein 0.9701 7 129 GO:0003723
GO:0005829
AF-A0A382PES5-F1-model_v4 SsrA-binding protein 0.9698 9 112 GO:0003723
GO:0005829
AF-A0A381Z638-F1-model_v4 SsrA-binding protein 0.969 5 129 GO:0003723
GO:0005829

Feature Viewer

pLDDT pTM Quality
80.95 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map