F449345

General Info

Members Datasets Scaffolds Average Seq Length
464 269 928 152

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_2101012|Ga0466967_2101012_45_500
Length 151
Sequence MPDLRPILLVEDNPRDVELTLAALARCQLANEIVVARDGAEALDLLLGQGASHNRPLVPAVVLLDLKLPKIDGLEVLEKVKSDPKRSHIPVVMLTSSREERDLIRSYDLGVNAFVVKPVDFSDFFAAIQDLGMFWAVLNEPAPEARSTDDT

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
84 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
85 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
86 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
87 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
119 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
124 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
125 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
134 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
135 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
138 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
145 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
150 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
151 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
154 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
155 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
160 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
176 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
179 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
182 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
183 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
200 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
205 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
206 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
207 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
208 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
209 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
210 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
211 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
212 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
213 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
214 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
215 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
216 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
217 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
218 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
219 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
220 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
221 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
222 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
223 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
224 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
225 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
226 2643221558 Rhizobium sp. Root149 Isolate Unclassified
227 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
228 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
229 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
230 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
231 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
232 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
233 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
234 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
235 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
236 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
237 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
238 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
239 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
240 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
241 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
242 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
243 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
244 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
245 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
246 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
247 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
248 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
249 2919085039 Luteibacter sp. 1214 Isolate Unclassified
250 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
251 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
252 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
253 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
254 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
255 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
256 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
257 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
258 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
259 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
260 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
261 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
262 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
263 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
264 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
265 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
266 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
267 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
268 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
269 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.01
Metatranscriptomes 0.22
Isolates 10.78

Biome Distribution

Category Percentage (%)
Aerial Root 1.08
Bulb 0
Endosphere 26.51
Nodule 4.09
Rhizoplane 4.09
Rhizosphere 38.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_2101012 3300045976 Bacteria 561
2 JGI24739J22299_10160645 3300001989 Bacteria 663
3 JGI25158J39367_1000044 3300002739 Bacteria 28385
4 JGI25157J39369_1015824 3300002741 Bacteria 927
5 JGI25152J39213_1000303 3300002773 Bacteria 31868
6 JGI25152J39213_1000307 3300002773 Bacteria 31606
7 JGI25150J39212_1000215 3300002774 Bacteria 31515
8 JGI25159J45721_1000067 3300002987 Bacteria 51228
9 JGI25159J45721_1028823 3300002987 Bacteria 922
10 JGI25151J46595_10000068 3300003187 Bacteria 140039
11 JGI25153J46596_10000051 3300003215 Bacteria 140039
12 JGI25153J46596_10000245 3300003215 Bacteria 45345
13 rootH1_10004706 3300003316 Bacteria 2304
14 rootH2_10030123 3300003320 Bacteria 7134
15 rootH2_10095370 3300003320 Bacteria 2997
16 rootH2_10098947 3300003320 Bacteria 3744
17 rootL2_10066715 3300003322 Bacteria 2476
18 rootH1_10216064 3300003323 Bacteria 2586
19 JGI25160J50197_1000297 3300003354 Bacteria 35620
20 JGI25161J50226_1000045 3300003374 Bacteria 116781
21 Ga0006562J51391_1018820 3300003578 Bacteria 761
22 Ga0055526_1000824 3300003771 Bacteria 23130
23 Ga0055526_1001795 3300003771 Bacteria 14858
24 Ga0055537_1000252 3300003773 Bacteria 39046
25 Ga0055524_1000902 3300003775 Bacteria 19233
26 Ga0055524_1047974 3300003775 Bacteria 1001
27 Ga0055536_1002980 3300003781 Bacteria 9271
28 Ga0055534_1000075 3300003784 Bacteria 77072
29 Ga0055528_1000271 3300003790 Bacteria 43963
30 Ga0055528_1003154 3300003790 Bacteria 8446
31 Ga0055528_1043905 3300003790 Bacteria 967
32 Ga0055530_10000771 3300003791 Bacteria 26703
33 Ga0055530_10000810 3300003791 Bacteria 25993
34 Ga0055540_1001005 3300003792 Bacteria 18208
35 Ga0055531_10013004 3300003794 Bacteria 3870
36 Ga0055531_10027771 3300003794 Bacteria 1974
37 Ga0055531_10041179 3300003794 Bacteria 1342
38 Ga0058692_1000044 3300003856 Bacteria 115648
39 Ga0058692_1003142 3300003856 Bacteria 5237
40 Ga0055543_1000142 3300004625 Bacteria 59886
41 Ga0065165_1000456 3300005262 Bacteria 64217
42 Ga0065165_1006668 3300005262 Bacteria 5956
43 Ga0065165_1084230 3300005262 Bacteria 820
44 Ga0065165_1115965 3300005262 Bacteria 654
45 Ga0070670_100000246 3300005331 Bacteria 48778
46 Ga0070677_10101269 3300005333 Bacteria 1270
47 Ga0070666_10057638 3300005335 Bacteria 2625
48 Ga0070666_10364830 3300005335 Bacteria 1035
49 Ga0070682_100023654 3300005337 Bacteria 3649
50 Ga0070668_100001369 3300005347 Bacteria 17469
51 Ga0070668_100349331 3300005347 Bacteria 1251
52 Ga0070669_100829183 3300005353 Bacteria 787
53 Ga0070667_100000206 3300005367 Bacteria 69487
54 Ga0070694_100658405 3300005444 Bacteria 848
55 Ga0070685_10009822 3300005466 Bacteria 4962
56 Ga0070665_100002062 3300005548 Bacteria 22580
57 Ga0070665_100019103 3300005548 Bacteria 6876
58 Ga0070665_100046804 3300005548 Bacteria 4342
59 Ga0070665_100125502 3300005548 Bacteria 2569
60 Ga0070665_101014516 3300005548 Bacteria 842
61 Ga0070665_101541522 3300005548 Bacteria 673
62 Ga0070664_100795442 3300005564 Bacteria 884
63 Ga0068857_100382471 3300005577 Bacteria 1307
64 Ga0068856_100968775 3300005614 Bacteria 869
65 Ga0068859_100163742 3300005617 Bacteria 2303
66 Ga0068864_100000167 3300005618 Bacteria 60640
67 Ga0068864_100082128 3300005618 Bacteria 2827
68 Ga0068861_100655471 3300005719 Bacteria 970
69 Ga0068863_100000562 3300005841 Bacteria 37687
70 Ga0068863_102450535 3300005841 Bacteria 531
71 Ga0068858_100026687 3300005842 Bacteria 5365
72 Ga0068860_100000851 3300005843 Bacteria 34076
73 Ga0068862_100000445 3300005844 Bacteria 44965
74 Ga0081540_1002610 3300005983 Bacteria 14645
75 Ga0081540_1160956 3300005983 Bacteria 871
76 Ga0081539_10084810 3300005985 Bacteria 1654
77 Ga0075365_10009640 3300006038 Bacteria 5571
78 Ga0075365_10016388 3300006038 Bacteria 4507
79 Ga0075368_10003410 3300006042 Bacteria 5304
80 Ga0075368_10318568 3300006042 Bacteria 673
81 Ga0075363_100011210 3300006048 Bacteria 4287
82 Ga0075364_10002070 3300006051 Bacteria 11202
83 Ga0075364_10030037 3300006051 Bacteria 3487
84 Ga0075364_10120601 3300006051 Bacteria 1755
85 Ga0075364_10524637 3300006051 Bacteria 810
86 Ga0075364_10773248 3300006051 Bacteria 655
87 Ga0075367_10013316 3300006178 Bacteria 4417
88 Ga0075367_10028106 3300006178 Bacteria 3206
89 Ga0075367_10181087 3300006178 Bacteria 1314
90 Ga0075369_10000346 3300006186 Bacteria 13807
91 Ga0075369_10023370 3300006186 Bacteria 2555
92 Ga0075369_10230920 3300006186 Bacteria 857
93 Ga0075369_10252502 3300006186 Bacteria 819
94 Ga0075366_10106349 3300006195 Bacteria 1687
95 Ga0075370_10014175 3300006353 Bacteria 4247
96 Ga0097620_100163742 3300006931 Bacteria 2303
97 Ga0099826_10000098 3300006948 Bacteria 41270
98 Ga0099826_10118639 3300006948 Bacteria 1562
99 Ga0105251_10021575 3300009011 Bacteria 3360
100 Ga0105244_10068168 3300009036 Bacteria 1778
101 Ga0105248_10049361 3300009177 Bacteria 4720
102 Ga0105237_10413434 3300009545 Bacteria 1354
103 Ga0105237_10738604 3300009545 Bacteria 991
104 Ga0105238_10056430 3300009551 Bacteria 3940
105 Ga0105249_10000581 3300009553 Bacteria 33426
106 Ga0105239_10045424 3300010375 Bacteria 4814
107 Ga0157373_10017517 3300013100 Bacteria 5217
108 Ga0157373_10034090 3300013100 Bacteria 3657
109 Ga0157373_10831934 3300013100 Bacteria 682
110 Ga0157371_10000206 3300013102 Bacteria 86320
111 Ga0157371_10182641 3300013102 Bacteria 1500
112 Ga0157371_10500472 3300013102 Bacteria 897
113 Ga0157370_10001495 3300013104 Bacteria 28921
114 Ga0157370_10007589 3300013104 Bacteria 11783
115 Ga0157370_10138120 3300013104 Bacteria 2271
116 Ga0157369_10021447 3300013105 Bacteria 7226
117 Ga0157378_10801448 3300013297 Bacteria 968
118 Ga0163162_10059767 3300013306 Bacteria 3844
119 Ga0163162_10305446 3300013306 Bacteria 1723
120 Ga0157372_12142582 3300013307 Bacteria 642
121 Ga0163163_11393526 3300014325 Bacteria 763
122 Ga0182008_10000051 3300014497 Bacteria 103398
123 Ga0182008_10061597 3300014497 Bacteria 1850
124 Ga0182008_10074802 3300014497 Bacteria 1667
125 Ga0157379_11889148 3300014968 Bacteria 588
126 Ga0182006_1010535 3300015261 Bacteria 4109
127 Ga0182006_1024073 3300015261 Bacteria 2515
128 Ga0182006_1045751 3300015261 Bacteria 1702
129 Ga0182006_1071515 3300015261 Bacteria 1285
130 Ga0182007_10000061 3300015262 Bacteria 88102
131 Ga0182007_10048750 3300015262 Bacteria 1400
132 Ga0182005_1000019 3300015265 Bacteria 296232
133 Ga0182005_1001189 3300015265 Bacteria 10758
134 Ga0163161_10001084 3300017792 Bacteria 20622
135 Ga0163161_10014285 3300017792 Bacteria 5528
136 Ga0163161_10016445 3300017792 Bacteria 5163
137 Ga0163161_10085080 3300017792 Bacteria 2333
138 Ga0163161_10364652 3300017792 Bacteria 1151
139 Ga0163161_10808475 3300017792 Bacteria 788
140 Ga0213876_10007385 3300021384 Bacteria 5978
141 Ga0213876_10041053 3300021384 Bacteria 2445
142 Ga0213876_10166090 3300021384 Bacteria 1174
143 Ga0209436_100001 3300025208 Bacteria 304543
144 Ga0209436_100003 3300025208 Bacteria 220530
145 Ga0207425_1000011 3300025245 Bacteria 550735
146 Ga0207425_1000815 3300025245 Bacteria 15613
147 Ga0209026_1000674 3300025250 Bacteria 20578
148 Ga0209129_1000031 3300025258 Bacteria 383039
149 Ga0209129_1000405 3300025258 Bacteria 34205
150 Ga0209565_1000050 3300025263 Bacteria 213856
151 Ga0209673_1000199 3300025273 Bacteria 120904
152 Ga0209673_1000397 3300025273 Bacteria 77638
153 Ga0209673_1034855 3300025273 Bacteria 1514
154 Ga0209130_1000049 3300025284 Bacteria 226841
155 Ga0209130_1007297 3300025284 Bacteria 3432
156 Ga0209675_1000007 3300025291 Bacteria 683430
157 Ga0209675_1006525 3300025291 Bacteria 4659
158 Ga0209676_1000018 3300025292 Bacteria 631385
159 Ga0209676_1000075 3300025292 Bacteria 303609
160 Ga0209025_1000012 3300025294 Bacteria 924362
161 Ga0209025_1000416 3300025294 Bacteria 85510
162 Ga0209564_1000061 3300025295 Bacteria 322795
163 Ga0209564_1001168 3300025295 Bacteria 30545
164 Ga0209564_1009339 3300025295 Bacteria 4682
165 Ga0209758_1000018 3300025297 Bacteria 753320
166 Ga0209758_1000175 3300025297 Bacteria 145649
167 Ga0209758_1002975 3300025297 Bacteria 16245
168 Ga0209758_1018578 3300025297 Bacteria 3398
169 Ga0209050_1000424 3300025298 Bacteria 77803
170 Ga0209050_1000610 3300025298 Bacteria 56686
171 Ga0209050_1028962 3300025298 Bacteria 1784
172 Ga0209256_1000379 3300025299 Bacteria 71301
173 Ga0209256_1004229 3300025299 Bacteria 9203
174 Ga0209256_1004926 3300025299 Bacteria 8008
175 Ga0209256_1024872 3300025299 Bacteria 1755
176 Ga0207426_1000043 3300025302 Bacteria 432827
177 Ga0209051_1002213 3300025303 Bacteria 14360
178 Ga0209051_1134098 3300025303 Bacteria 607
179 Ga0209257_1000035 3300025304 Bacteria 631463
180 Ga0209257_1000667 3300025304 Bacteria 53711
181 Ga0209257_1004768 3300025304 Bacteria 10123
182 Ga0209257_1015854 3300025304 Bacteria 3095
183 Ga0209257_1016638 3300025304 Bacteria 2960
184 Ga0207697_10466025 3300025315 Bacteria 559
185 Ga0207713_1020455 3300025735 Bacteria 3205
186 Ga0207682_10171542 3300025893 Bacteria 987
187 Ga0207710_10066447 3300025900 Bacteria 1645
188 Ga0207680_10003381 3300025903 Bacteria 7515
189 Ga0207680_10186258 3300025903 Bacteria 1407
190 Ga0207671_10875835 3300025914 Bacteria 710
191 Ga0207694_10220182 3300025924 Bacteria 1548
192 Ga0207650_10000031 3300025925 Bacteria 230128
193 Ga0207711_10040259 3300025941 Bacteria 3975
194 Ga0207712_10002141 3300025961 Bacteria 12909
195 Ga0207668_10000978 3300025972 Bacteria 17178
196 Ga0207668_11364482 3300025972 Bacteria 639
197 Ga0207658_10000581 3300025986 Bacteria 32905
198 Ga0207703_10007540 3300026035 Bacteria 8631
199 Ga0207702_10805112 3300026078 Bacteria 929
200 Ga0207641_10000697 3300026088 Bacteria 36201
201 Ga0207641_12130053 3300026088 Bacteria 561
202 Ga0207676_10002092 3300026095 Bacteria 14460
203 Ga0207676_10015718 3300026095 Bacteria 5469
204 Ga0207675_100626578 3300026118 Bacteria 1080
205 Ga0209371_1000003 3300027312 Bacteria 1122971
206 Ga0209371_1000023 3300027312 Bacteria 519553
207 Ga0209282_1000147 3300027666 Bacteria 41275
208 Ga0209813_10024786 3300027866 Bacteria 1719
209 Ga0268266_10006655 3300028379 Bacteria 10545
210 Ga0268266_10039994 3300028379 Bacteria 3995
211 Ga0268266_10047537 3300028379 Bacteria 3677
212 Ga0268266_10064957 3300028379 Bacteria 3154
213 Ga0268266_10135160 3300028379 Bacteria 2208
214 Ga0268266_10934245 3300028379 Bacteria 839
215 Ga0268265_10000923 3300028380 Bacteria 27194
216 Ga0268264_10000361 3300028381 Bacteria 67632
217 Ga0268256_1000004 3300030500 Bacteria 1122967
218 Ga0268256_1000023 3300030500 Bacteria 519631
219 Ga0316176_1191301 3300030732 Bacteria 6552
220 Ga0316181_1262216 3300030744 Bacteria 4714
221 Ga0307412_10296001 3300031911 Bacteria 1277
222 Ga0307409_100294857 3300031995 Bacteria 1505
223 Ga0307411_10500415 3300032005 Bacteria 1027
224 Ga0307411_10931762 3300032005 Bacteria 774
225 Ga0307415_102419805 3300032126 Bacteria 516
226 Ga0436364_1485238 3300037853 Bacteria 535
227 Ga0237819_00003 3300038705 Bacteria 86904
228 Ga0436365_0752820 3300039437 Bacteria 2471
229 Ga0436365_1668047 3300039437 Bacteria 6951
230 Ga0436365_1786926 3300039437 Bacteria 1495
231 Ga0436365_1921538 3300039437 Bacteria 1833
232 Ga0439465_0000189 3300041413 Bacteria 16012
233 Ga0451837_1623979 3300041494 Bacteria 645
234 Ga0451841_0961763 3300041498 Bacteria 636
235 Ga0451853_2511842 3300041512 Bacteria 658
236 Ga0439432_002062 3300042006 Bacteria 7592
237 Ga0466965_0040153 3300044683 Bacteria 2303
238 Ga0466965_0107437 3300044683 Bacteria 1432
239 Ga0466963_0129720 3300044694 Bacteria 1741
240 Ga0466963_1156503 3300044694 Bacteria 544
241 Ga0466968_0015022 3300044735 Bacteria 3067
242 Ga0466968_0040051 3300044735 Bacteria 1975
243 Ga0466970_0288579 3300044765 Bacteria 924
244 Ga0466957_0281907 3300044842 Bacteria 1112
245 Ga0466959_1186808 3300045049 Bacteria 507
246 Ga0495627_001035 3300046453 Bacteria 18603
247 Ga0495591_006879 3300046458 Bacteria 4934
248 Ga0495638_0000409 3300046460 Bacteria 52476
249 Ga0495650_0024418 3300046471 Bacteria 2855
250 Ga0495594_0036449 3300046499 Bacteria 2682
251 Ga0495610_0001846 3300046512 Bacteria 18362
252 Ga0495610_0309036 3300046512 Bacteria 607
253 Ga0495620_0190053 3300046515 Bacteria 792
254 Ga0495631_0000377 3300046518 Bacteria 30621
255 Ga0495643_0000599 3300046522 Bacteria 43638
256 Ga0495648_0000068 3300046524 Bacteria 138518
257 Ga0495654_0000655 3300046530 Bacteria 27305
258 Ga0495633_0035410 3300046558 Bacteria 2397
259 Ga0495668_0113258 3300046616 Bacteria 1484
260 Ga0495625_0012191 3300046660 Bacteria 6972
261 Ga0495625_0030042 3300046660 Bacteria 4057
262 Ga0495581_0047506 3300047315 Bacteria 2481
263 Ga0495672_0000417 3300047320 Bacteria 51409
264 Ga0495672_0046219 3300047320 Bacteria 2598
265 Ga0495673_0000191 3300047469 Bacteria 96817
266 Ga0495686_0005207 3300047472 Bacteria 10346
267 Ga0495686_0007423 3300047472 Bacteria 8222
268 Ga0495686_0322687 3300047472 Bacteria 846
269 Ga0496100_0556200 3300048903 Bacteria 888
270 Ga0496101_0288731 3300048904 Bacteria 1283
271 Ga0496102_0015254 3300048905 Bacteria 6690
272 Ga0496102_0335492 3300048905 Bacteria 1424
273 Ga0496102_1021933 3300048905 Bacteria 747
274 Ga0496103_0569845 3300048906 Bacteria 722
275 Ga0496104_0006605 3300048907 Bacteria 10201
276 Ga0496105_0038051 3300048908 Bacteria 3963
277 Ga0496106_0589371 3300048909 Bacteria 891
278 Ga0496107_1349692 3300048910 Bacteria 509
279 Ga0496108_0087045 3300048911 Bacteria 2653
280 Ga0496109_0562075 3300048912 Bacteria 1076
281 Ga0496110_0165068 3300048913 Bacteria 2008
282 Ga0496111_0000414 3300048914 Bacteria 21472
283 Ga0496115_0227309 3300048918 Bacteria 1539
284 Ga0496116_0001793 3300048919 Bacteria 23337
285 Ga0496116_0005203 3300048919 Bacteria 12186
286 Ga0496116_0057114 3300048919 Bacteria 2553
287 Ga0496116_0083453 3300048919 Bacteria 1972
288 Ga0496116_0111482 3300048919 Bacteria 1607
289 Ga0496117_0000437 3300048920 Bacteria 69398
290 Ga0496117_0001193 3300048920 Bacteria 39104
291 Ga0496117_0001821 3300048920 Bacteria 28933
292 Ga0496117_0005990 3300048920 Bacteria 12527
293 Ga0496117_0033430 3300048920 Bacteria 3888
294 Ga0496117_0128323 3300048920 Bacteria 1542
295 Ga0496117_0426858 3300048920 Bacteria 661
296 Ga0496118_0000430 3300048921 Bacteria 69608
297 Ga0496118_0000500 3300048921 Bacteria 64878
298 Ga0496118_0003117 3300048921 Bacteria 21240
299 Ga0496118_0004086 3300048921 Bacteria 17697
300 Ga0496118_0048330 3300048921 Bacteria 3288
301 Ga0496118_0117800 3300048921 Bacteria 1741
302 Ga0496118_0212184 3300048921 Bacteria 1135
303 Ga0496119_0000209 3300048922 Bacteria 83605
304 Ga0496119_0000450 3300048922 Bacteria 56283
305 Ga0496120_0000271 3300048923 Bacteria 86589
306 Ga0496120_0191252 3300048923 Bacteria 997
307 Ga0496121_0000710 3300048924 Bacteria 61765
308 Ga0496121_0002335 3300048924 Bacteria 29284
309 Ga0496121_0016520 3300048924 Bacteria 7614
310 Ga0496121_0105183 3300048924 Bacteria 2167
311 Ga0496121_0207165 3300048924 Bacteria 1392
312 Ga0496121_0352190 3300048924 Bacteria 980
313 Ga0496121_0475430 3300048924 Bacteria 799
314 Ga0496122_0000266 3300048925 Bacteria 117021
315 Ga0496122_0000559 3300048925 Bacteria 76330
316 Ga0496122_0000967 3300048925 Bacteria 51549
317 Ga0496122_0004676 3300048925 Bacteria 16809
318 Ga0496122_0005071 3300048925 Bacteria 15906
319 Ga0496122_0022132 3300048925 Bacteria 5662
320 Ga0496122_0055577 3300048925 Bacteria 2960
321 Ga0496122_0072967 3300048925 Bacteria 2437
322 Ga0496122_0243238 3300048925 Bacteria 1012
323 Ga0496123_0000018 3300048926 Bacteria 404553
324 Ga0496123_0000435 3300048926 Bacteria 75306
325 Ga0496123_0002356 3300048926 Bacteria 23697
326 Ga0496123_0003353 3300048926 Bacteria 18121
327 Ga0496123_0007663 3300048926 Bacteria 10098
328 Ga0496123_0009885 3300048926 Bacteria 8513
329 Ga0496123_0051032 3300048926 Bacteria 2758
330 Ga0496123_0117724 3300048926 Bacteria 1502
331 Ga0496123_0170288 3300048926 Bacteria 1150
332 Ga0496124_0000125 3300048927 Bacteria 159942
333 Ga0496124_0000343 3300048927 Bacteria 85220
334 Ga0496124_0000584 3300048927 Bacteria 61524
335 Ga0496124_0001573 3300048927 Bacteria 32965
336 Ga0496124_0001983 3300048927 Bacteria 27904
337 Ga0496124_0002387 3300048927 Bacteria 24716
338 Ga0496124_0002508 3300048927 Bacteria 23884
339 Ga0496124_0002696 3300048927 Bacteria 22707
340 Ga0496124_0002972 3300048927 Bacteria 21248
341 Ga0496124_0005756 3300048927 Bacteria 13798
342 Ga0496124_0007613 3300048927 Bacteria 11478
343 Ga0496124_0018972 3300048927 Bacteria 6420
344 Ga0496124_0038845 3300048927 Bacteria 4130
345 Ga0496124_0052758 3300048927 Bacteria 3453
346 Ga0496124_0087178 3300048927 Bacteria 2553
347 Ga0496124_0273991 3300048927 Bacteria 1234
348 Ga0496124_0402548 3300048927 Bacteria 949
349 Ga0496124_0611769 3300048927 Bacteria 707
350 Ga0496125_0000144 3300048928 Bacteria 156270
351 Ga0496125_0000249 3300048928 Bacteria 110627
352 Ga0496125_0001175 3300048928 Bacteria 39654
353 Ga0496125_0012454 3300048928 Bacteria 8441
354 Ga0496125_0017178 3300048928 Bacteria 6915
355 Ga0496125_0023652 3300048928 Bacteria 5666
356 Ga0496125_0030949 3300048928 Bacteria 4778
357 Ga0496125_0040872 3300048928 Bacteria 3972
358 Ga0496125_0171183 3300048928 Bacteria 1459
359 Ga0496126_0000795 3300048929 Bacteria 56626
360 Ga0496126_0001062 3300048929 Bacteria 46308
361 Ga0496126_0020866 3300048929 Bacteria 6414
362 Ga0496126_0037511 3300048929 Bacteria 4521
363 Ga0496126_0055230 3300048929 Bacteria 3594
364 Ga0496126_0075455 3300048929 Bacteria 2992
365 Ga0496126_0123734 3300048929 Bacteria 2240
366 Ga0496126_0718993 3300048929 Bacteria 774
367 Ga0501031_0182255 3300049568 Bacteria 1372
368 Ga0501033_0269361 3300049570 Bacteria 1204
369 Ga0501034_0016860 3300049571 Bacteria 7490
370 Ga0501034_0233353 3300049571 Bacteria 1788
371 Ga0501034_0723862 3300049571 Bacteria 892
372 Ga0501036_0027347 3300049572 Bacteria 4820
373 Ga0501038_0115651 3300049574 Bacteria 2217
374 Ga0501043_0033130 3300049579 Bacteria 4064
375 Ga0501043_0675005 3300049579 Bacteria 757
376 Ga0501046_0227003 3300049580 Bacteria 1381
377 Ga0501047_0123822 3300049581 Bacteria 2466
378 Ga0501069_0402772 3300049585 Bacteria 810
379 Ga0501072_0072408 3300049588 Bacteria 2724
380 Ga0501238_004074 3300049671 Bacteria 1815
381 Ga0501035_0146667 3300049822 Bacteria 2049
382 Ga0501035_0846324 3300049822 Bacteria 728
383 Ga0501044_0514478 3300049823 Bacteria 1097
384 nmdc:mga03683_76904_c1 3300050489 Bacteria 1435
385 nmdc:mga03n38_58882_c1 3300050490 Bacteria 1742
386 nmdc:mga00v17_11616_c1 3300050491 Bacteria 4842
387 nmdc:mga00v17_151698_c1 3300050491 Bacteria 1489
388 nmdc:mga00v17_36504_c1 3300050491 Bacteria 2929
389 nmdc:mga00v17_64825_c1 3300050491 Bacteria 2252
390 nmdc:mga00v17_96272_c1 3300050491 Bacteria 1864
391 nmdc:mga0yw44_2514_c1 3300050492 Bacteria 7850
392 nmdc:mga0yw44_3839_c2 3300050492 Bacteria 6454
393 nmdc:mga0k408_95091_c1 3300050493 Bacteria 1753
394 nmdc:mga06z11_201392_c1 3300050494 Bacteria 1157
395 nmdc:mga06z11_54500_c1 3300050494 Bacteria 2061
396 nmdc:mga04h51_1708_c2 3300050495 Bacteria 2638
397 nmdc:mga0sz30_28709_c1 3300050516 Bacteria 2290
398 nmdc:mga0sz30_9661_c1 3300050516 Bacteria 3677
399 Ga0500643_047649 3300053087 Bacteria 1234
400 Ga0500644_0000126 3300053088 Bacteria 47091
401 Ga0500562_000357 3300053108 Bacteria 11000
402 Ga0500572_028440 3300053111 Bacteria 1539
403 Ga0500594_0013912 3300053118 Bacteria 1920
404 Ga0500618_000175 3300053125 Bacteria 53230
405 Ga0500618_000271 3300053125 Bacteria 39933
406 Ga0500564_000018 3300053138 Bacteria 52235
407 Ga0500568_0005312 3300053139 Bacteria 6690
408 Ga0500568_0009166 3300053139 Bacteria 4718
409 Ga0500589_099692 3300053147 Bacteria 1264
410 Ga0500616_0115592 3300053153 Bacteria 1289
411 Ga0500622_0000744 3300053156 Bacteria 28423
412 Ga0500622_0000802 3300053156 Bacteria 27018
413 Ga0500565_027847 3300053734 Bacteria 725
414 Ga0500661_031952 3300055283 Bacteria 929
415 2513877001 2513237139 Bacteria 8737671
416 2547501320 2547132130 Bacteria 4660562
417 2599601546 2599185210 Bacteria 5624189
418 2600375790 2600254933 Bacteria 4750527
419 2601610190 2600255279 Bacteria 5605316
420 2601746964 2600255308 Bacteria 5611129
421 2643814007 2643221558 Bacteria 5460675
422 2747949785 2747842428 Bacteria 4689383
423 2765579173 2765235840 Bacteria 4663337
424 2793065108 2791355196 Bacteria 7323613
425 2793283564 2791355253 Bacteria 5171699
426 2816517118 2816332141 Bacteria 4436036
427 2819557124 2818991439 Bacteria 6907412
428 2824698298 2824696289 Bacteria 8335049
429 2838675890 2838675328 Bacteria 4909118
430 2838714772 2838714209 Bacteria 5525906
431 2838721427 2838719591 Bacteria 5523910
432 2838725532 2838724970 Bacteria 4908691
433 2842130785 2842130223 Bacteria 4909145
434 2842154045 2842152218 Bacteria 4908957
435 2842171016 2842170452 Bacteria 5525737
436 2842177665 2842175837 Bacteria 4908771
437 2842187881 2842187318 Bacteria 5524014
438 2842212192 2842211629 Bacteria 5523832
439 2842226189 2842224351 Bacteria 5524473
440 2842392284 2842391507 Bacteria 4486072
441 2852650394 2852649853 Bacteria 4036942
442 2891376799 2891373044 Bacteria 5202277
443 2899796171 2899792073 Bacteria 4926588
444 2919088589 2919085039 Bacteria 4532964
445 2919114863 2919114240 Bacteria 5700270
446 2919136008 2919134579 Bacteria 4480386
447 2926755827 2926754445 Bacteria 5964435
448 2933008690 2933006813 Bacteria 4912075
449 2933596709 2933594066 Bacteria 5594265
450 2939589944 2939589442 Bacteria 4214238
451 2941476239 2941475908 Bacteria 4145589
452 2961067255 2961064222 Bacteria 4749990
453 2974307511 2974307012 Bacteria 4172388
454 2977248224 2977247770 Bacteria 4160543
455 2979102155 2979100975 Bacteria 5423623
456 2984509896 2984509177 Bacteria 5274802
457 2984517286 2984514374 Bacteria 4172479
458 2984519406 2984518228 Bacteria 5277463
459 2984538236 2984537506 Bacteria 5277481
460 2984604989 2984601300 Bacteria 5455244
461 2989351195 2989349275 Bacteria 6349068
462 8003575392 8003570095 Bacteria 5747666
463 8018152893 8018150411 Bacteria 5549903
464 8056879752 8056875544 Bacteria 4355797
465 Ga0466967_2101012
466 JGI24739J22299_10160645
467 JGI25158J39367_1000044
468 JGI25157J39369_1015824
469 JGI25152J39213_1000303
470 JGI25152J39213_1000307
471 JGI25150J39212_1000215
472 JGI25159J45721_1000067
473 JGI25159J45721_1028823
474 JGI25151J46595_10000068
475 JGI25153J46596_10000051
476 JGI25153J46596_10000245
477 rootH1_10004706
478 rootH2_10030123
479 rootH2_10095370
480 rootH2_10098947
481 rootL2_10066715
482 rootH1_10216064
483 JGI25160J50197_1000297
484 JGI25161J50226_1000045
485 Ga0006562J51391_1018820
486 Ga0055526_1000824
487 Ga0055526_1001795
488 Ga0055537_1000252
489 Ga0055524_1000902
490 Ga0055524_1047974
491 Ga0055536_1002980
492 Ga0055534_1000075
493 Ga0055528_1000271
494 Ga0055528_1003154
495 Ga0055528_1043905
496 Ga0055530_10000771
497 Ga0055530_10000810
498 Ga0055540_1001005
499 Ga0055531_10013004
500 Ga0055531_10027771
501 Ga0055531_10041179
502 Ga0058692_1000044
503 Ga0058692_1003142
504 Ga0055543_1000142
505 Ga0065165_1000456
506 Ga0065165_1006668
507 Ga0065165_1084230
508 Ga0065165_1115965
509 Ga0070670_100000246
510 Ga0070677_10101269
511 Ga0070666_10057638
512 Ga0070666_10364830
513 Ga0070682_100023654
514 Ga0070668_100001369
515 Ga0070668_100349331
516 Ga0070669_100829183
517 Ga0070667_100000206
518 Ga0070694_100658405
519 Ga0070685_10009822
520 Ga0070665_100002062
521 Ga0070665_100019103
522 Ga0070665_100046804
523 Ga0070665_100125502
524 Ga0070665_101014516
525 Ga0070665_101541522
526 Ga0070664_100795442
527 Ga0068857_100382471
528 Ga0068856_100968775
529 Ga0068859_100163742
530 Ga0068864_100000167
531 Ga0068864_100082128
532 Ga0068861_100655471
533 Ga0068863_100000562
534 Ga0068863_102450535
535 Ga0068858_100026687
536 Ga0068860_100000851
537 Ga0068862_100000445
538 Ga0081540_1002610
539 Ga0081540_1160956
540 Ga0081539_10084810
541 Ga0075365_10009640
542 Ga0075365_10016388
543 Ga0075368_10003410
544 Ga0075368_10318568
545 Ga0075363_100011210
546 Ga0075364_10002070
547 Ga0075364_10030037
548 Ga0075364_10120601
549 Ga0075364_10524637
550 Ga0075364_10773248
551 Ga0075367_10013316
552 Ga0075367_10028106
553 Ga0075367_10181087
554 Ga0075369_10000346
555 Ga0075369_10023370
556 Ga0075369_10230920
557 Ga0075369_10252502
558 Ga0075366_10106349
559 Ga0075370_10014175
560 Ga0097620_100163742
561 Ga0099826_10000098
562 Ga0099826_10118639
563 Ga0105251_10021575
564 Ga0105244_10068168
565 Ga0105248_10049361
566 Ga0105237_10413434
567 Ga0105237_10738604
568 Ga0105238_10056430
569 Ga0105249_10000581
570 Ga0105239_10045424
571 Ga0157373_10017517
572 Ga0157373_10034090
573 Ga0157373_10831934
574 Ga0157371_10000206
575 Ga0157371_10182641
576 Ga0157371_10500472
577 Ga0157370_10001495
578 Ga0157370_10007589
579 Ga0157370_10138120
580 Ga0157369_10021447
581 Ga0157378_10801448
582 Ga0163162_10059767
583 Ga0163162_10305446
584 Ga0157372_12142582
585 Ga0163163_11393526
586 Ga0182008_10000051
587 Ga0182008_10061597
588 Ga0182008_10074802
589 Ga0157379_11889148
590 Ga0182006_1010535
591 Ga0182006_1024073
592 Ga0182006_1045751
593 Ga0182006_1071515
594 Ga0182007_10000061
595 Ga0182007_10048750
596 Ga0182005_1000019
597 Ga0182005_1001189
598 Ga0163161_10001084
599 Ga0163161_10014285
600 Ga0163161_10016445
601 Ga0163161_10085080
602 Ga0163161_10364652
603 Ga0163161_10808475
604 Ga0213876_10007385
605 Ga0213876_10041053
606 Ga0213876_10166090
607 Ga0209436_100001
608 Ga0209436_100003
609 Ga0207425_1000011
610 Ga0207425_1000815
611 Ga0209026_1000674
612 Ga0209129_1000031
613 Ga0209129_1000405
614 Ga0209565_1000050
615 Ga0209673_1000199
616 Ga0209673_1000397
617 Ga0209673_1034855
618 Ga0209130_1000049
619 Ga0209130_1007297
620 Ga0209675_1000007
621 Ga0209675_1006525
622 Ga0209676_1000018
623 Ga0209676_1000075
624 Ga0209025_1000012
625 Ga0209025_1000416
626 Ga0209564_1000061
627 Ga0209564_1001168
628 Ga0209564_1009339
629 Ga0209758_1000018
630 Ga0209758_1000175
631 Ga0209758_1002975
632 Ga0209758_1018578
633 Ga0209050_1000424
634 Ga0209050_1000610
635 Ga0209050_1028962
636 Ga0209256_1000379
637 Ga0209256_1004229
638 Ga0209256_1004926
639 Ga0209256_1024872
640 Ga0207426_1000043
641 Ga0209051_1002213
642 Ga0209051_1134098
643 Ga0209257_1000035
644 Ga0209257_1000667
645 Ga0209257_1004768
646 Ga0209257_1015854
647 Ga0209257_1016638
648 Ga0207697_10466025
649 Ga0207713_1020455
650 Ga0207682_10171542
651 Ga0207710_10066447
652 Ga0207680_10003381
653 Ga0207680_10186258
654 Ga0207671_10875835
655 Ga0207694_10220182
656 Ga0207650_10000031
657 Ga0207711_10040259
658 Ga0207712_10002141
659 Ga0207668_10000978
660 Ga0207668_11364482
661 Ga0207658_10000581
662 Ga0207703_10007540
663 Ga0207702_10805112
664 Ga0207641_10000697
665 Ga0207641_12130053
666 Ga0207676_10002092
667 Ga0207676_10015718
668 Ga0207675_100626578
669 Ga0209371_1000003
670 Ga0209371_1000023
671 Ga0209282_1000147
672 Ga0209813_10024786
673 Ga0268266_10006655
674 Ga0268266_10039994
675 Ga0268266_10047537
676 Ga0268266_10064957
677 Ga0268266_10135160
678 Ga0268266_10934245
679 Ga0268265_10000923
680 Ga0268264_10000361
681 Ga0268256_1000004
682 Ga0268256_1000023
683 Ga0316176_1191301
684 Ga0316181_1262216
685 Ga0307412_10296001
686 Ga0307409_100294857
687 Ga0307411_10500415
688 Ga0307411_10931762
689 Ga0307415_102419805
690 Ga0436364_1485238
691 Ga0237819_00003
692 Ga0436365_0752820
693 Ga0436365_1668047
694 Ga0436365_1786926
695 Ga0436365_1921538
696 Ga0439465_0000189
697 Ga0451837_1623979
698 Ga0451841_0961763
699 Ga0451853_2511842
700 Ga0439432_002062
701 Ga0466965_0040153
702 Ga0466965_0107437
703 Ga0466963_0129720
704 Ga0466963_1156503
705 Ga0466968_0015022
706 Ga0466968_0040051
707 Ga0466970_0288579
708 Ga0466957_0281907
709 Ga0466959_1186808
710 Ga0495627_001035
711 Ga0495591_006879
712 Ga0495638_0000409
713 Ga0495650_0024418
714 Ga0495594_0036449
715 Ga0495610_0001846
716 Ga0495610_0309036
717 Ga0495620_0190053
718 Ga0495631_0000377
719 Ga0495643_0000599
720 Ga0495648_0000068
721 Ga0495654_0000655
722 Ga0495633_0035410
723 Ga0495668_0113258
724 Ga0495625_0012191
725 Ga0495625_0030042
726 Ga0495581_0047506
727 Ga0495672_0000417
728 Ga0495672_0046219
729 Ga0495673_0000191
730 Ga0495686_0005207
731 Ga0495686_0007423
732 Ga0495686_0322687
733 Ga0496100_0556200
734 Ga0496101_0288731
735 Ga0496102_0015254
736 Ga0496102_0335492
737 Ga0496102_1021933
738 Ga0496103_0569845
739 Ga0496104_0006605
740 Ga0496105_0038051
741 Ga0496106_0589371
742 Ga0496107_1349692
743 Ga0496108_0087045
744 Ga0496109_0562075
745 Ga0496110_0165068
746 Ga0496111_0000414
747 Ga0496115_0227309
748 Ga0496116_0001793
749 Ga0496116_0005203
750 Ga0496116_0057114
751 Ga0496116_0083453
752 Ga0496116_0111482
753 Ga0496117_0000437
754 Ga0496117_0001193
755 Ga0496117_0001821
756 Ga0496117_0005990
757 Ga0496117_0033430
758 Ga0496117_0128323
759 Ga0496117_0426858
760 Ga0496118_0000430
761 Ga0496118_0000500
762 Ga0496118_0003117
763 Ga0496118_0004086
764 Ga0496118_0048330
765 Ga0496118_0117800
766 Ga0496118_0212184
767 Ga0496119_0000209
768 Ga0496119_0000450
769 Ga0496120_0000271
770 Ga0496120_0191252
771 Ga0496121_0000710
772 Ga0496121_0002335
773 Ga0496121_0016520
774 Ga0496121_0105183
775 Ga0496121_0207165
776 Ga0496121_0352190
777 Ga0496121_0475430
778 Ga0496122_0000266
779 Ga0496122_0000559
780 Ga0496122_0000967
781 Ga0496122_0004676
782 Ga0496122_0005071
783 Ga0496122_0022132
784 Ga0496122_0055577
785 Ga0496122_0072967
786 Ga0496122_0243238
787 Ga0496123_0000018
788 Ga0496123_0000435
789 Ga0496123_0002356
790 Ga0496123_0003353
791 Ga0496123_0007663
792 Ga0496123_0009885
793 Ga0496123_0051032
794 Ga0496123_0117724
795 Ga0496123_0170288
796 Ga0496124_0000125
797 Ga0496124_0000343
798 Ga0496124_0000584
799 Ga0496124_0001573
800 Ga0496124_0001983
801 Ga0496124_0002387
802 Ga0496124_0002508
803 Ga0496124_0002696
804 Ga0496124_0002972
805 Ga0496124_0005756
806 Ga0496124_0007613
807 Ga0496124_0018972
808 Ga0496124_0038845
809 Ga0496124_0052758
810 Ga0496124_0087178
811 Ga0496124_0273991
812 Ga0496124_0402548
813 Ga0496124_0611769
814 Ga0496125_0000144
815 Ga0496125_0000249
816 Ga0496125_0001175
817 Ga0496125_0012454
818 Ga0496125_0017178
819 Ga0496125_0023652
820 Ga0496125_0030949
821 Ga0496125_0040872
822 Ga0496125_0171183
823 Ga0496126_0000795
824 Ga0496126_0001062
825 Ga0496126_0020866
826 Ga0496126_0037511
827 Ga0496126_0055230
828 Ga0496126_0075455
829 Ga0496126_0123734
830 Ga0496126_0718993
831 Ga0501031_0182255
832 Ga0501033_0269361
833 Ga0501034_0016860
834 Ga0501034_0233353
835 Ga0501034_0723862
836 Ga0501036_0027347
837 Ga0501038_0115651
838 Ga0501043_0033130
839 Ga0501043_0675005
840 Ga0501046_0227003
841 Ga0501047_0123822
842 Ga0501069_0402772
843 Ga0501072_0072408
844 Ga0501238_004074
845 Ga0501035_0146667
846 Ga0501035_0846324
847 Ga0501044_0514478
848 nmdc:mga03683_76904_c1
849 nmdc:mga03n38_58882_c1
850 nmdc:mga00v17_11616_c1
851 nmdc:mga00v17_151698_c1
852 nmdc:mga00v17_36504_c1
853 nmdc:mga00v17_64825_c1
854 nmdc:mga00v17_96272_c1
855 nmdc:mga0yw44_2514_c1
856 nmdc:mga0yw44_3839_c2
857 nmdc:mga0k408_95091_c1
858 nmdc:mga06z11_201392_c1
859 nmdc:mga06z11_54500_c1
860 nmdc:mga04h51_1708_c2
861 nmdc:mga0sz30_28709_c1
862 nmdc:mga0sz30_9661_c1
863 Ga0500643_047649
864 Ga0500644_0000126
865 Ga0500562_000357
866 Ga0500572_028440
867 Ga0500594_0013912
868 Ga0500618_000175
869 Ga0500618_000271
870 Ga0500564_000018
871 Ga0500568_0005312
872 Ga0500568_0009166
873 Ga0500589_099692
874 Ga0500616_0115592
875 Ga0500622_0000744
876 Ga0500622_0000802
877 Ga0500565_027847
878 Ga0500661_031952
879 2513877001
880 2547501320
881 2599601546
882 2600375790
883 2601610190
884 2601746964
885 2643814007
886 2747949785
887 2765579173
888 2793065108
889 2793283564
890 2816517118
891 2819557124
892 2824698298
893 2838675890
894 2838714772
895 2838721427
896 2838725532
897 2842130785
898 2842154045
899 2842171016
900 2842177665
901 2842187881
902 2842212192
903 2842226189
904 2842392284
905 2852650394
906 2891376799
907 2899796171
908 2919088589
909 2919114863
910 2919136008
911 2926755827
912 2933008690
913 2933596709
914 2939589944
915 2941476239
916 2961067255
917 2974307511
918 2977248224
919 2979102155
920 2984509896
921 2984517286
922 2984519406
923 2984538236
924 2984604989
925 2989351195
926 8003575392
927 8018152893
928 8056879752

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

7

129

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3to5-assembly1.cif.gz_A high resolution structure of chey3 from vibrio cholerae 0.9319 7 136
2id7-assembly1.cif.gz_A 1.75 a structure of t87i phosphono-chey 0.9315 7 136
4lx8-assembly1.cif.gz_A crystal structure (2.2a) of mg2+ bound chey3 of vibrio cholerae 0.9309 7 136
1ab5-assembly2.cif.gz_B structure of chey mutant f14n, v21t 0.929 6 136
1ab6-assembly2.cif.gz_B structure of chey mutant f14n, v86t 0.9266 6 136
ID Description Score Start End Superfamily
4jp1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9288 8 136 3.40.50.2300
5brjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9084 5 144 3.40.50.2300
af_Q0D3B6_62_211_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9076 9 136 3.40.50.2300
af_Q1JSA0_6_124_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9073 10 134 3.40.50.2300
af_K7LHH0_84_250_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9062 9 136 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2G4E2G8-F1-model_v4 Chemotaxis protein CheY 0.9863 7 111 GO:0000160
AF-A0A2N6A3I8-F1-model_v4 Response regulatory domain-containing protein 0.9597 7 140 GO:0000160
AF-A0A2G4E2G8-F1-model_v4 Chemotaxis protein CheY 0.9591 7 111 GO:0000160
AF-A0A2V8A4Z5-F1-model_v4 Two-component system response regulator 0.954 5 120 GO:0000160
AF-J8V183-F1-model_v4 deleted 0.9479 7 105

Map