F449352

General Info

Members Datasets Scaffolds Average Seq Length
464 260 928 268

Family's Representative Sequence

Representative Sequence 3300046501|Ga0495607_0047587|Ga0495607_0047587_1466_2332
Length 288
Sequence MQSGTVDGLYYEVHGGPAADRATVILSAGLGGSGAFWAPQMDALLSRFRVVLYDHRGTGRSVRALPAGPYSVTAMGEDIVKVMDAVGLDRAHVVGHAAGGNAGLAMALDHPDRIGRLVVVNGWSRPDPHIKRCFDTRLALLNNTGIAAYVHAQPLFLYPADWLSANHARLEAEEVHHIHGFPDPEVMRARIQALLAFDIDADLERIACPVLVSASADDMLVPLACSRRLAERLPNAVLDIAPWGGHGFTVTAAEAFNSSLLSFLGGDLQRGNNPWKSASSFRSATTAG

Samples

Sample ID Description Type Environment
1 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
26 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
27 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
28 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
38 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
39 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
40 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
41 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
44 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
45 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
50 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
51 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
68 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
71 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
74 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
75 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
76 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
77 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
78 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
79 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
80 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
81 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
82 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
83 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
84 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
85 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
86 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
87 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
88 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
89 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
90 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
91 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
92 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
93 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
94 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
95 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
96 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
97 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
98 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
99 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
100 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
101 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
102 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
103 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
104 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
105 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
106 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
107 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
108 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
109 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
110 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
111 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
112 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
113 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
118 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
119 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
120 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
121 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
122 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
123 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
124 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
125 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
126 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
127 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
130 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
131 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
132 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
133 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
134 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
135 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
136 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
137 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
138 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
139 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
140 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
141 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
142 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
143 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
144 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
145 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
146 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
147 2506520008 Serratia plymuthica AS12 Isolate Unclassified
148 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
149 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
150 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
151 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
152 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
153 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
154 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
155 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
156 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
157 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
158 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
159 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
160 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
161 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
162 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
163 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
164 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
165 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
166 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
167 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
168 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
169 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
170 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
171 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
172 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
173 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
174 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
175 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
176 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
177 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
178 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
179 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
180 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
181 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
182 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
183 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
184 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
185 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
186 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
187 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
188 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
189 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
190 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
191 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
192 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
193 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
194 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
195 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
196 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
197 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
198 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
199 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
200 2636415599 Klebsiella variicola DX120E Isolate Unclassified
201 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
202 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
203 2643221583 Caulobacter sp. Root655 Isolate Unclassified
204 2643221584 Caulobacter sp. Root656 Isolate Unclassified
205 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
206 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
207 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
208 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
209 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
210 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
211 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
212 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
213 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
214 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
215 2751185917 Enterobacter sp. HK169 Isolate Unclassified
216 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
217 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
218 2775507074 Klebsiella sp. D5A Isolate Unclassified
219 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
220 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
221 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
222 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
223 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
224 2818991435 Caulobacter henricii 536 Isolate Unclassified
225 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
226 2821118458 Enterobacter asburiae 609 Isolate Unclassified
227 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
228 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
229 2847085930 Erwinia persicina B64 Isolate Bulb
230 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
231 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
232 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
233 2904504865 Serratia marcescens 1822 Isolate Unclassified
234 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
235 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
236 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
237 2919150387 Rahnella aceris 1817 Isolate Unclassified
238 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
239 2927143783 Rahnella sp. 2050 Isolate Unclassified
240 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
241 2937539931 Pantoea sp. LS15 Isolate Unclassified
242 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
243 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
244 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
245 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
246 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
247 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
248 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
249 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
250 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
251 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
252 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
253 640753048 Serratia proteamaculans 568 Isolate Endosphere
254 8018221730 Enterobacter sp. CM29 Isolate Unclassified
255 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
256 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
257 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
258 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
259 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
260 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.22
Metatranscriptomes 0
Isolates 24.78

Biome Distribution

Category Percentage (%)
Aerial Root 0.86
Bulb 0.22
Endosphere 12.5
Nodule 2.37
Rhizoplane 13.15
Rhizosphere 45.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495607_0047587 3300046501 Bacteria 2512
2 SwRhRL2b_contig_2705273 2162886007 Bacteria 4371
3 JGI24739J22299_10000821 3300001989 Bacteria 11396
4 JGI25162J39368_1000084 3300002737 Bacteria 108880
5 JGI25163J39215_1000095 3300002771 Bacteria 37243
6 JGI25163J39215_1000124 3300002771 Bacteria 31687
7 JGI25164J39214_1000062 3300002772 Bacteria 108882
8 rootH2_10059718 3300003320 Bacteria 15347
9 Ga0055538_1000060 3300003751 Bacteria 108880
10 Ga0055539_1000092 3300003752 Bacteria 108880
11 Ga0055533_1000101 3300003756 Bacteria 108880
12 Ga0055525_1000134 3300003759 Bacteria 108880
13 Ga0055537_1001438 3300003773 Bacteria 9292
14 Ga0055524_1015544 3300003775 Bacteria 2768
15 Ga0055524_1026756 3300003775 Bacteria 1772
16 Ga0055528_1008952 3300003790 Bacteria 4230
17 Ga0055531_10018802 3300003794 Bacteria 2832
18 Ga0055541_1000062 3300003841 Bacteria 108880
19 Ga0058692_1002831 3300003856 Bacteria 5682
20 Ga0058692_1003237 3300003856 Bacteria 5109
21 Ga0058692_1003615 3300003856 Bacteria 4742
22 Ga0065165_1000561 3300005262 Bacteria 55325
23 Ga0065704_10000664 3300005289 Bacteria 46630
24 Ga0065704_10000674 3300005289 Bacteria 55017
25 Ga0065704_10000722 3300005289 Bacteria 17520
26 Ga0065704_10004428 3300005289 Bacteria 5573
27 Ga0065704_10087996 3300005289 Bacteria 2976
28 Ga0070659_100101047 3300005366 Bacteria 2321
29 Ga0070665_100000446 3300005548 Bacteria 60094
30 Ga0068857_100001056 3300005577 Bacteria 21349
31 Ga0075364_10011159 3300006051 Bacteria 5453
32 Ga0075364_10013894 3300006051 Bacteria 4962
33 Ga0075366_10051047 3300006195 Bacteria 2457
34 Ga0075366_10135582 3300006195 Bacteria 1486
35 Ga0079104_1006009 3300006946 Bacteria 4700
36 Ga0079104_1011871 3300006946 Bacteria 2772
37 Ga0079104_1011876 3300006946 Bacteria 2771
38 Ga0079104_1012532 3300006946 Bacteria 2658
39 Ga0079104_1012627 3300006946 Bacteria 2642
40 Ga0105251_10000053 3300009011 Bacteria 106190
41 Ga0105251_10000465 3300009011 Bacteria 38667
42 Ga0105251_10000606 3300009011 Bacteria 32839
43 Ga0105251_10001506 3300009011 Bacteria 20010
44 Ga0105251_10001643 3300009011 Bacteria 18941
45 Ga0105251_10004673 3300009011 Bacteria 9209
46 Ga0105251_10010121 3300009011 Bacteria 5500
47 Ga0105251_10136348 3300009011 Bacteria 1111
48 Ga0105251_10144129 3300009011 Bacteria 1077
49 Ga0105244_10000569 3300009036 Bacteria 33031
50 Ga0105244_10000942 3300009036 Bacteria 24430
51 Ga0105244_10001226 3300009036 Bacteria 21039
52 Ga0105244_10001863 3300009036 Bacteria 16393
53 Ga0105244_10002704 3300009036 Bacteria 13254
54 Ga0105244_10009582 3300009036 Bacteria 5938
55 Ga0105244_10183973 3300009036 Bacteria 990
56 Ga0105250_10000003 3300009092 Bacteria 547770
57 Ga0105250_10000040 3300009092 Bacteria 133899
58 Ga0105250_10001600 3300009092 Bacteria 12132
59 Ga0105250_10005696 3300009092 Bacteria 5561
60 Ga0105250_10030172 3300009092 Bacteria 2180
61 Ga0105250_10032752 3300009092 Bacteria 2087
62 Ga0105250_10035634 3300009092 Bacteria 1997
63 Ga0105247_10000599 3300009101 Bacteria 29233
64 Ga0105243_10057395 3300009148 Bacteria 3099
65 Ga0105241_10000005 3300009174 Bacteria 384203
66 Ga0157373_10002016 3300013100 Bacteria 15393
67 Ga0157373_10036192 3300013100 Bacteria 3544
68 Ga0157373_10152814 3300013100 Bacteria 1624
69 Ga0157371_10000101 3300013102 Bacteria 129981
70 Ga0157371_10001776 3300013102 Bacteria 21809
71 Ga0157371_10116122 3300013102 Bacteria 1901
72 Ga0157371_10200358 3300013102 Bacteria 1431
73 Ga0157370_10000796 3300013104 Bacteria 39701
74 Ga0157370_10002997 3300013104 Bacteria 20058
75 Ga0157370_10033336 3300013104 Bacteria 5022
76 Ga0163162_10021821 3300013306 Bacteria 6308
77 Ga0157372_10023649 3300013307 Bacteria 6665
78 Ga0157372_10154077 3300013307 Bacteria 2654
79 Ga0182008_10004217 3300014497 Bacteria 8441
80 Ga0183366_1001 3300015679 Bacteria 2743932
81 Ga0183370_1001 3300015680 Bacteria 2743932
82 Ga0183369_1001 3300015685 Bacteria 2743932
83 Ga0183368_1001 3300015687 Bacteria 2743932
84 Ga0163161_10000001 3300017792 Bacteria 2041488
85 Ga0213876_10000016 3300021384 Bacteria 300175
86 Ga0209760_100001 3300025207 Bacteria 348781
87 Ga0209784_100001 3300025224 Bacteria 3600592
88 Ga0209566_100001 3300025225 Bacteria 3600765
89 Ga0209674_100002 3300025226 Bacteria 3600592
90 Ga0209563_100008 3300025230 Bacteria 1554545
91 Ga0207427_100002 3300025231 Bacteria 1355321
92 Ga0209437_100007 3300025233 Bacteria 938377
93 Ga0209677_100004 3300025253 Bacteria 1554545
94 Ga0209565_1000140 3300025263 Bacteria 101561
95 Ga0209565_1027198 3300025263 Bacteria 1140
96 Ga0209673_1000630 3300025273 Bacteria 53635
97 Ga0209675_1006367 3300025291 Bacteria 4747
98 Ga0209564_1007509 3300025295 Bacteria 5617
99 Ga0209564_1035222 3300025295 Bacteria 1453
100 Ga0209564_1039265 3300025295 Bacteria 1303
101 Ga0209758_1024518 3300025297 Bacteria 2685
102 Ga0209758_1056441 3300025297 Bacteria 1326
103 Ga0209050_1017250 3300025298 Bacteria 2893
104 Ga0209256_1001549 3300025299 Bacteria 22921
105 Ga0209256_1003734 3300025299 Bacteria 10305
106 Ga0209257_1000200 3300025304 Bacteria 147538
107 Ga0207696_1000001 3300025711 Bacteria 2579611
108 Ga0207696_1000004 3300025711 Bacteria 671626
109 Ga0207696_1000077 3300025711 Bacteria 209611
110 Ga0207696_1001271 3300025711 Bacteria 14110
111 Ga0207696_1007868 3300025711 Bacteria 4133
112 Ga0207696_1020677 3300025711 Bacteria 2118
113 Ga0207655_1000001 3300025728 Bacteria 1866413
114 Ga0207655_1000009 3300025728 Bacteria 664676
115 Ga0207655_1000060 3300025728 Bacteria 260572
116 Ga0207655_1000888 3300025728 Bacteria 31658
117 Ga0207655_1002461 3300025728 Bacteria 14998
118 Ga0207655_1003361 3300025728 Bacteria 11973
119 Ga0207655_1010499 3300025728 Bacteria 5606
120 Ga0207713_1000040 3300025735 Bacteria 245322
121 Ga0207713_1000119 3300025735 Bacteria 123810
122 Ga0207713_1000147 3300025735 Bacteria 106198
123 Ga0207713_1000153 3300025735 Bacteria 103510
124 Ga0207713_1000993 3300025735 Bacteria 24885
125 Ga0207713_1004074 3300025735 Bacteria 9634
126 Ga0207713_1009123 3300025735 Bacteria 5627
127 Ga0207713_1021167 3300025735 Bacteria 3125
128 Ga0207713_1051234 3300025735 Bacteria 1642
129 Ga0207713_1054877 3300025735 Bacteria 1559
130 Ga0207713_1094916 3300025735 Bacteria 1040
131 Ga0207710_10000236 3300025900 Bacteria 47574
132 Ga0207654_10000007 3300025911 Bacteria 384211
133 Ga0207709_10183174 3300025935 Bacteria 1481
134 Ga0207674_10000970 3300026116 Bacteria 37542
135 Ga0209281_1000027 3300027111 Bacteria 463409
136 Ga0209281_1000267 3300027111 Bacteria 100564
137 Ga0209281_1000288 3300027111 Bacteria 93347
138 Ga0209281_1000759 3300027111 Bacteria 31002
139 Ga0209281_1001716 3300027111 Bacteria 11311
140 Ga0209281_1002279 3300027111 Bacteria 8087
141 Ga0209371_1000001 3300027312 Bacteria 2771503
142 Ga0209371_1000081 3300027312 Bacteria 185440
143 Ga0209371_1000772 3300027312 Bacteria 26570
144 Ga0209371_1002497 3300027312 Bacteria 10207
145 Ga0209371_1002941 3300027312 Bacteria 8883
146 Ga0209371_1011106 3300027312 Bacteria 2701
147 Ga0268266_10001611 3300028379 Bacteria 26347
148 Ga0307515_10181835 3300028794 Bacteria 2049
149 Ga0268256_1000001 3300030500 Bacteria 2771065
150 Ga0268256_1000136 3300030500 Bacteria 101369
151 Ga0268256_1000180 3300030500 Bacteria 74594
152 Ga0268256_1002218 3300030500 Bacteria 10219
153 Ga0268256_1012017 3300030500 Bacteria 2701
154 Ga0268256_1019075 3300030500 Bacteria 1886
155 Ga0436365_1910565 3300039437 Bacteria 475219
156 Ga0439438_002824 3300041405 Bacteria 7248
157 Ga0439438_004107 3300041405 Bacteria 5685
158 Ga0439447_006056 3300041407 Bacteria 3966
159 Ga0451853_0501298 3300041512 Bacteria 1378
160 Ga0439432_018800 3300042006 Bacteria 2305
161 Ga0439452_000021 3300042010 Bacteria 274062
162 Ga0439452_000286 3300042010 Bacteria 32655
163 Ga0439452_000396 3300042010 Bacteria 25865
164 Ga0450900_002265 3300042136 Bacteria 2018
165 Ga0439446_0008014 3300042156 Bacteria 2792
166 Ga0439464_0002813 3300042439 Bacteria 4323
167 Ga0466981_0000039 3300044669 Bacteria 47011
168 Ga0495627_000126 3300046453 Bacteria 93150
169 Ga0495627_003139 3300046453 Bacteria 7471
170 Ga0495591_000513 3300046458 Bacteria 30422
171 Ga0495591_001159 3300046458 Bacteria 17260
172 Ga0495638_0001144 3300046460 Bacteria 25617
173 Ga0495638_0001341 3300046460 Bacteria 22588
174 Ga0495638_0016193 3300046460 Bacteria 4997
175 Ga0495638_0030323 3300046460 Bacteria 3482
176 Ga0495650_0000016 3300046471 Bacteria 554693
177 Ga0495650_0000021 3300046471 Bacteria 531242
178 Ga0495650_0000032 3300046471 Bacteria 425389
179 Ga0495650_0000217 3300046471 Bacteria 120688
180 Ga0495650_0013229 3300046471 Bacteria 4379
181 Ga0495650_0089898 3300046471 Bacteria 1170
182 Ga0495605_0062590 3300046474 Bacteria 1777
183 Ga0495584_0006356 3300046491 Bacteria 6189
184 Ga0495583_0000002 3300046506 Bacteria 782521
185 Ga0495606_0000483 3300046507 Bacteria 65224
186 Ga0495606_0005689 3300046507 Bacteria 11799
187 Ga0495610_0000157 3300046512 Bacteria 75701
188 Ga0495610_0021139 3300046512 Bacteria 3585
189 Ga0495616_0000286 3300046513 Bacteria 40792
190 Ga0495616_0021460 3300046513 Bacteria 3498
191 Ga0495620_0112578 3300046515 Bacteria 1077
192 Ga0495632_0002577 3300046519 Bacteria 13693
193 Ga0495632_0175359 3300046519 Bacteria 983
194 Ga0495643_0217073 3300046522 Bacteria 909
195 Ga0495648_0032483 3300046524 Bacteria 3423
196 Ga0495648_0136667 3300046524 Bacteria 1295
197 Ga0495663_0024138 3300046525 Bacteria 1766
198 Ga0495654_0000042 3300046530 Bacteria 164346
199 Ga0495654_0000052 3300046530 Bacteria 145382
200 Ga0495654_0000543 3300046530 Bacteria 30408
201 Ga0495654_0011634 3300046530 Bacteria 4754
202 Ga0495654_0015302 3300046530 Bacteria 4075
203 Ga0495597_0000352 3300046542 Bacteria 41199
204 Ga0495668_0005552 3300046616 Bacteria 8491
205 Ga0495668_0021368 3300046616 Bacteria 3712
206 Ga0495625_0000170 3300046660 Bacteria 102224
207 Ga0495625_0001751 3300046660 Bacteria 25108
208 Ga0495625_0004619 3300046660 Bacteria 12943
209 Ga0495625_0040066 3300046660 Bacteria 3419
210 Ga0495625_0044377 3300046660 Bacteria 3218
211 Ga0495625_0127721 3300046660 Bacteria 1725
212 Ga0495625_0149393 3300046660 Bacteria 1571
213 Ga0495671_0008541 3300046692 Bacteria 5755
214 Ga0495649_0012666 3300046694 Bacteria 4894
215 Ga0495589_0000004 3300046794 Bacteria 439891
216 Ga0495589_0065031 3300046794 Bacteria 1788
217 Ga0495660_0000007 3300046810 Bacteria 485295
218 Ga0495660_0000021 3300046810 Bacteria 293250
219 Ga0495660_0010784 3300046810 Bacteria 5307
220 Ga0495672_0000002 3300047320 Bacteria 740116
221 Ga0495672_0000199 3300047320 Bacteria 85658
222 Ga0495672_0001289 3300047320 Bacteria 24996
223 Ga0495683_0068165 3300047323 Bacteria 1750
224 Ga0495679_000020 3300047446 Bacteria 228413
225 Ga0495679_008134 3300047446 Bacteria 4293
226 Ga0495679_036007 3300047446 Bacteria 1565
227 Ga0495673_0000095 3300047469 Bacteria 183429
228 Ga0495673_0000147 3300047469 Bacteria 125742
229 Ga0495673_0000542 3300047469 Bacteria 38769
230 Ga0495673_0002053 3300047469 Bacteria 14740
231 Ga0495681_0015367 3300047470 Bacteria 4334
232 Ga0495681_0025691 3300047470 Bacteria 3077
233 Ga0495686_0121980 3300047472 Bacteria 1552
234 Ga0496100_0070052 3300048903 Bacteria 2337
235 Ga0496101_0066600 3300048904 Bacteria 2628
236 Ga0496103_0081389 3300048906 Bacteria 2037
237 Ga0496104_0000585 3300048907 Bacteria 31096
238 Ga0496104_0002514 3300048907 Bacteria 15791
239 Ga0496104_0089486 3300048907 Bacteria 2941
240 Ga0496104_0298427 3300048907 Bacteria 1523
241 Ga0496106_0051231 3300048909 Bacteria 3113
242 Ga0496107_0000042 3300048910 Bacteria 75015
243 Ga0496115_0096769 3300048918 Bacteria 2417
244 Ga0496116_0000001 3300048919 Bacteria 1501681
245 Ga0496116_0000127 3300048919 Bacteria 158773
246 Ga0496116_0000145 3300048919 Bacteria 145993
247 Ga0496116_0000392 3300048919 Bacteria 64036
248 Ga0496116_0001074 3300048919 Bacteria 32910
249 Ga0496116_0003411 3300048919 Bacteria 15717
250 Ga0496116_0009633 3300048919 Bacteria 8217
251 Ga0496116_0010592 3300048919 Bacteria 7711
252 Ga0496116_0011095 3300048919 Bacteria 7493
253 Ga0496116_0024207 3300048919 Bacteria 4496
254 Ga0496117_0000436 3300048920 Bacteria 69452
255 Ga0496117_0000608 3300048920 Bacteria 58353
256 Ga0496117_0001974 3300048920 Bacteria 27271
257 Ga0496117_0005286 3300048920 Bacteria 13679
258 Ga0496117_0009686 3300048920 Bacteria 8908
259 Ga0496117_0137123 3300048920 Bacteria 1472
260 Ga0496118_0000464 3300048921 Bacteria 67368
261 Ga0496118_0000650 3300048921 Bacteria 56685
262 Ga0496118_0006588 3300048921 Bacteria 12684
263 Ga0496118_0006856 3300048921 Bacteria 12349
264 Ga0496118_0007432 3300048921 Bacteria 11614
265 Ga0496118_0025762 3300048921 Bacteria 5031
266 Ga0496118_0029505 3300048921 Bacteria 4597
267 Ga0496118_0056962 3300048921 Bacteria 2933
268 Ga0496118_0263025 3300048921 Bacteria 972
269 Ga0496119_0000080 3300048922 Bacteria 139962
270 Ga0496119_0001227 3300048922 Bacteria 31931
271 Ga0496119_0002777 3300048922 Bacteria 18799
272 Ga0496119_0006765 3300048922 Bacteria 10514
273 Ga0496119_0020686 3300048922 Bacteria 4786
274 Ga0496119_0038452 3300048922 Bacteria 3091
275 Ga0496119_0065507 3300048922 Bacteria 2151
276 Ga0496119_0101107 3300048922 Bacteria 1618
277 Ga0496120_0000075 3300048923 Bacteria 163540
278 Ga0496120_0000128 3300048923 Bacteria 127855
279 Ga0496120_0002252 3300048923 Bacteria 20156
280 Ga0496120_0005088 3300048923 Bacteria 10642
281 Ga0496120_0021517 3300048923 Bacteria 4075
282 Ga0496120_0051487 3300048923 Bacteria 2351
283 Ga0496120_0101362 3300048923 Bacteria 1520
284 Ga0496120_0117802 3300048923 Bacteria 1377
285 Ga0496121_0000794 3300048924 Bacteria 57780
286 Ga0496121_0004945 3300048924 Bacteria 17485
287 Ga0496121_0005999 3300048924 Bacteria 15334
288 Ga0496121_0023459 3300048924 Bacteria 5940
289 Ga0496121_0026477 3300048924 Bacteria 5462
290 Ga0496121_0031468 3300048924 Bacteria 4846
291 Ga0496121_0046941 3300048924 Bacteria 3690
292 Ga0496121_0058378 3300048924 Bacteria 3190
293 Ga0496121_0089815 3300048924 Bacteria 2403
294 Ga0496121_0246489 3300048924 Bacteria 1241
295 Ga0496122_0000013 3300048925 Bacteria 501039
296 Ga0496122_0000211 3300048925 Bacteria 130145
297 Ga0496122_0000356 3300048925 Bacteria 98548
298 Ga0496122_0002599 3300048925 Bacteria 25300
299 Ga0496122_0004795 3300048925 Bacteria 16537
300 Ga0496122_0007725 3300048925 Bacteria 11838
301 Ga0496122_0088576 3300048925 Bacteria 2120
302 Ga0496122_0090127 3300048925 Bacteria 2094
303 Ga0496123_0000010 3300048926 Bacteria 501039
304 Ga0496123_0000134 3300048926 Bacteria 153219
305 Ga0496123_0000309 3300048926 Bacteria 94366
306 Ga0496123_0000700 3300048926 Bacteria 54995
307 Ga0496123_0001890 3300048926 Bacteria 27331
308 Ga0496123_0007397 3300048926 Bacteria 10365
309 Ga0496123_0018854 3300048926 Bacteria 5464
310 Ga0496123_0035162 3300048926 Bacteria 3575
311 Ga0496123_0153004 3300048926 Bacteria 1241
312 Ga0496124_0000152 3300048927 Bacteria 140118
313 Ga0496124_0009609 3300048927 Bacteria 9911
314 Ga0496124_0093103 3300048927 Bacteria 2453
315 Ga0496124_0096042 3300048927 Bacteria 2408
316 Ga0496124_0146489 3300048927 Bacteria 1857
317 Ga0496124_0274489 3300048927 Bacteria 1232
318 Ga0496125_0000019 3300048928 Bacteria 474989
319 Ga0496125_0002790 3300048928 Bacteria 22082
320 Ga0496125_0006354 3300048928 Bacteria 12817
321 Ga0496125_0008230 3300048928 Bacteria 10962
322 Ga0496125_0088974 3300048928 Bacteria 2324
323 Ga0496126_0002540 3300048929 Bacteria 24417
324 Ga0496126_0003071 3300048929 Bacteria 21610
325 Ga0496126_0004794 3300048929 Bacteria 15896
326 Ga0496126_0016875 3300048929 Bacteria 7288
327 Ga0496126_0099053 3300048929 Bacteria 2553
328 Ga0496126_0124582 3300048929 Bacteria 2231
329 Ga0496126_0275972 3300048929 Bacteria 1394
330 Ga0496126_0307664 3300048929 Bacteria 1305
331 Ga0495678_000326 3300049459 Bacteria 50497
332 Ga0495682_0000015 3300049460 Bacteria 235048
333 nmdc:mga00v17_3690_c1 3300050491 Bacteria 7909
334 nmdc:mga00v17_6380_c1 3300050491 Bacteria 6257
335 nmdc:mga0k408_38189_c1 3300050493 Bacteria 2756
336 Ga0500554_004652 3300053102 Bacteria 2926
337 Ga0500555_026318 3300053103 Bacteria 1663
338 Ga0500556_0000568 3300053104 Bacteria 24516
339 Ga0500614_010536 3300053123 Bacteria 1987
340 Ga0500618_006218 3300053125 Bacteria 3526
341 Ga0500621_000001 3300053126 Bacteria 1049698
342 Ga0500658_0000384 3300053134 Bacteria 19452
343 Ga0500559_0000720 3300053136 Bacteria 21746
344 Ga0500559_0055393 3300053136 Bacteria 1758
345 Ga0500577_0005208 3300053142 Bacteria 3488
346 Ga0500627_0075858 3300053158 Bacteria 1494
347 Ga0500611_013272 3300053727 Bacteria 1410
348 Ga0500645_044513 3300053730 Bacteria 1305
349 Ga0500609_001502 3300053731 Bacteria 3409
350 2506577824 2506520007 Bacteria 5442880
351 2506582962 2506520008 Bacteria 5443009
352 2508851784 2508501071 Bacteria 5454741
353 2511123785 2510917020 Bacteria 5657507
354 2555260455 2554235234 Bacteria 5762085
355 2585152054 2582581280 Bacteria 5994497
356 2585194459 2582581293 Bacteria 5907401
357 2585830018 2585427591 Bacteria 5482980
358 2585832291 2585427592 Bacteria 5370892
359 2599411130 2599185169 Bacteria 5441380
360 2599929165 2599185299 Bacteria 4854625
361 2601523561 2600255254 Bacteria 5281859
362 2601528720 2600255255 Bacteria 5282785
363 2601536475 2600255256 Bacteria 5597742
364 2601541896 2600255257 Bacteria 5597196
365 2601615553 2600255280 Bacteria 5292309
366 2601620727 2600255281 Bacteria 5288753
367 2601643380 2600255287 Bacteria 5210468
368 2601649124 2600255288 Bacteria 5282738
369 2601653604 2600255289 Bacteria 5281907
370 2601659024 2600255290 Bacteria 5282218
371 2601663203 2600255291 Bacteria 5217298
372 2601696162 2600255298 Bacteria 5215185
373 2601700836 2600255299 Bacteria 5218662
374 2601707819 2600255300 Bacteria 5287774
375 2601712878 2600255301 Bacteria 5280532
376 2601716863 2600255302 Bacteria 5288235
377 2601721186 2600255303 Bacteria 5219315
378 2601724974 2600255304 Bacteria 5283973
379 2601732257 2600255305 Bacteria 5282329
380 2601737865 2600255306 Bacteria 5281613
381 2601744008 2600255307 Bacteria 5439064
382 2601753394 2600255309 Bacteria 5431045
383 2601760255 2600255310 Bacteria 5600903
384 2601765658 2600255311 Bacteria 5598766
385 2602022021 2600255392 Bacteria 5437392
386 2603638437 2602042046 Bacteria 5483348
387 2603642943 2602042047 Bacteria 4697674
388 2603660586 2602042052 Bacteria 5215873
389 2603665858 2602042053 Bacteria 5214361
390 2603699587 2602042066 Bacteria 4423871
391 2603703551 2602042067 Bacteria 4863713
392 2603839206 2602042103 Bacteria 5284714
393 2603844738 2602042104 Bacteria 5281639
394 2603849363 2602042105 Bacteria 5282303
395 2603854432 2602042106 Bacteria 5282744
396 2603867470 2602042109 Bacteria 5152801
397 2603870155 2602042110 Bacteria 5283285
398 2603875110 2602042111 Bacteria 5212080
399 2606047346 2603880178 Bacteria 5283018
400 2606070292 2603880184 Bacteria 5217896
401 2606146151 2603880202 Bacteria 5284684
402 2606177078 2603880211 Bacteria 5284226
403 2609910694 2609459761 Bacteria 5513740
404 2637226057 2636415599 Bacteria 5718434
405 2643748670 2643221545 Bacteria 5083237
406 2643782928 2643221552 Bacteria 5708754
407 2643924037 2643221583 Bacteria 5218014
408 2643928234 2643221584 Bacteria 5511711
409 2644510345 2643221691 Bacteria 5093099
410 2650899622 2648501693 Bacteria 5069560
411 2656278504 2654587920 Bacteria 5475511
412 2671103480 2667528172 Bacteria 5170840
413 2671108091 2667528173 Bacteria 5375747
414 2676407755 2675903046 Bacteria 5451247
415 2681995345 2681812866 Bacteria 4552357
416 2682007105 2681812869 Bacteria 5014465
417 2686355650 2684622997 Bacteria 4624240
418 2689444349 2687453601 Bacteria 5546041
419 2753855469 2751185917 Bacteria 4551186
420 2765588446 2765235842 Bacteria 4799256
421 2775542262 2775506706 Bacteria 4873073
422 2777020581 2775507074 Bacteria 5532402
423 2791925040 2791354903 Bacteria 4937680
424 2807177152 2806310673 Bacteria 4801221
425 2809126009 2808606414 Bacteria 4917181
426 2813729495 2811995292 Bacteria 5303342
427 2814696984 2814123068 Bacteria 5687681
428 2819539436 2818991435 Bacteria 5433759
429 2819647690 2818991454 Bacteria 5563326
430 2821119280 2821118458 Bacteria 4714306
431 2823374235 2823373977 Bacteria 4779415
432 2844427015 2844425489 Bacteria 4854065
433 2847088175 2847085930 Bacteria 5070450
434 2847802262 2847797336 Bacteria 5176640
435 2869553701 2869551831 Bacteria 5474685
436 2904475238 2904474040 Bacteria 5504324
437 2904505215 2904504865 Bacteria 5152820
438 2904517540 2904513164 Bacteria 5476410
439 2908670724 2908669403 Bacteria 5740494
440 2919112886 2919108558 Bacteria 5897419
441 2919151584 2919150387 Bacteria 5500879
442 2923638905 2923634449 Bacteria 4753480
443 2927146458 2927143783 Bacteria 5504251
444 2927834603 2927833300 Bacteria 4923934
445 2937543305 2937539931 Bacteria 4639830
446 2939568670 2939568625 Bacteria 4542555
447 2939607982 2939607340 Bacteria 4719256
448 2939644285 2939642701 Bacteria 4475280
449 2945878624 2945874760 Bacteria 5527237
450 2969083069 2969079654 Bacteria 5439582
451 2971824347 2971820967 Bacteria 5823634
452 2974312630 2974310843 Bacteria 4947816
453 2984494690 2984494565 Bacteria 5000175
454 2984560087 2984559226 Bacteria 5683096
455 2984598169 2984595703 Bacteria 5682994
456 2990265308 2990261002 Bacteria 4919493
457 640937352 640753048 Bacteria 5495657
458 8018225427 8018221730 Bacteria 4616064
459 8018407195 8018405270 Bacteria 4978981
460 8054844770 8054844752 Bacteria 4450330
461 8055088595 8055087960 Bacteria 4784273
462 8055094171 8055092621 Bacteria 4873875
463 8055099587 8055097453 Bacteria 4865496
464 8057162384 8057160832 Bacteria 3268302
465 Ga0495607_0047587
466 SwRhRL2b_contig_2705273
467 JGI24739J22299_10000821
468 JGI25162J39368_1000084
469 JGI25163J39215_1000095
470 JGI25163J39215_1000124
471 JGI25164J39214_1000062
472 rootH2_10059718
473 Ga0055538_1000060
474 Ga0055539_1000092
475 Ga0055533_1000101
476 Ga0055525_1000134
477 Ga0055537_1001438
478 Ga0055524_1015544
479 Ga0055524_1026756
480 Ga0055528_1008952
481 Ga0055531_10018802
482 Ga0055541_1000062
483 Ga0058692_1002831
484 Ga0058692_1003237
485 Ga0058692_1003615
486 Ga0065165_1000561
487 Ga0065704_10000664
488 Ga0065704_10000674
489 Ga0065704_10000722
490 Ga0065704_10004428
491 Ga0065704_10087996
492 Ga0070659_100101047
493 Ga0070665_100000446
494 Ga0068857_100001056
495 Ga0075364_10011159
496 Ga0075364_10013894
497 Ga0075366_10051047
498 Ga0075366_10135582
499 Ga0079104_1006009
500 Ga0079104_1011871
501 Ga0079104_1011876
502 Ga0079104_1012532
503 Ga0079104_1012627
504 Ga0105251_10000053
505 Ga0105251_10000465
506 Ga0105251_10000606
507 Ga0105251_10001506
508 Ga0105251_10001643
509 Ga0105251_10004673
510 Ga0105251_10010121
511 Ga0105251_10136348
512 Ga0105251_10144129
513 Ga0105244_10000569
514 Ga0105244_10000942
515 Ga0105244_10001226
516 Ga0105244_10001863
517 Ga0105244_10002704
518 Ga0105244_10009582
519 Ga0105244_10183973
520 Ga0105250_10000003
521 Ga0105250_10000040
522 Ga0105250_10001600
523 Ga0105250_10005696
524 Ga0105250_10030172
525 Ga0105250_10032752
526 Ga0105250_10035634
527 Ga0105247_10000599
528 Ga0105243_10057395
529 Ga0105241_10000005
530 Ga0157373_10002016
531 Ga0157373_10036192
532 Ga0157373_10152814
533 Ga0157371_10000101
534 Ga0157371_10001776
535 Ga0157371_10116122
536 Ga0157371_10200358
537 Ga0157370_10000796
538 Ga0157370_10002997
539 Ga0157370_10033336
540 Ga0163162_10021821
541 Ga0157372_10023649
542 Ga0157372_10154077
543 Ga0182008_10004217
544 Ga0183366_1001
545 Ga0183370_1001
546 Ga0183369_1001
547 Ga0183368_1001
548 Ga0163161_10000001
549 Ga0213876_10000016
550 Ga0209760_100001
551 Ga0209784_100001
552 Ga0209566_100001
553 Ga0209674_100002
554 Ga0209563_100008
555 Ga0207427_100002
556 Ga0209437_100007
557 Ga0209677_100004
558 Ga0209565_1000140
559 Ga0209565_1027198
560 Ga0209673_1000630
561 Ga0209675_1006367
562 Ga0209564_1007509
563 Ga0209564_1035222
564 Ga0209564_1039265
565 Ga0209758_1024518
566 Ga0209758_1056441
567 Ga0209050_1017250
568 Ga0209256_1001549
569 Ga0209256_1003734
570 Ga0209257_1000200
571 Ga0207696_1000001
572 Ga0207696_1000004
573 Ga0207696_1000077
574 Ga0207696_1001271
575 Ga0207696_1007868
576 Ga0207696_1020677
577 Ga0207655_1000001
578 Ga0207655_1000009
579 Ga0207655_1000060
580 Ga0207655_1000888
581 Ga0207655_1002461
582 Ga0207655_1003361
583 Ga0207655_1010499
584 Ga0207713_1000040
585 Ga0207713_1000119
586 Ga0207713_1000147
587 Ga0207713_1000153
588 Ga0207713_1000993
589 Ga0207713_1004074
590 Ga0207713_1009123
591 Ga0207713_1021167
592 Ga0207713_1051234
593 Ga0207713_1054877
594 Ga0207713_1094916
595 Ga0207710_10000236
596 Ga0207654_10000007
597 Ga0207709_10183174
598 Ga0207674_10000970
599 Ga0209281_1000027
600 Ga0209281_1000267
601 Ga0209281_1000288
602 Ga0209281_1000759
603 Ga0209281_1001716
604 Ga0209281_1002279
605 Ga0209371_1000001
606 Ga0209371_1000081
607 Ga0209371_1000772
608 Ga0209371_1002497
609 Ga0209371_1002941
610 Ga0209371_1011106
611 Ga0268266_10001611
612 Ga0307515_10181835
613 Ga0268256_1000001
614 Ga0268256_1000136
615 Ga0268256_1000180
616 Ga0268256_1002218
617 Ga0268256_1012017
618 Ga0268256_1019075
619 Ga0436365_1910565
620 Ga0439438_002824
621 Ga0439438_004107
622 Ga0439447_006056
623 Ga0451853_0501298
624 Ga0439432_018800
625 Ga0439452_000021
626 Ga0439452_000286
627 Ga0439452_000396
628 Ga0450900_002265
629 Ga0439446_0008014
630 Ga0439464_0002813
631 Ga0466981_0000039
632 Ga0495627_000126
633 Ga0495627_003139
634 Ga0495591_000513
635 Ga0495591_001159
636 Ga0495638_0001144
637 Ga0495638_0001341
638 Ga0495638_0016193
639 Ga0495638_0030323
640 Ga0495650_0000016
641 Ga0495650_0000021
642 Ga0495650_0000032
643 Ga0495650_0000217
644 Ga0495650_0013229
645 Ga0495650_0089898
646 Ga0495605_0062590
647 Ga0495584_0006356
648 Ga0495583_0000002
649 Ga0495606_0000483
650 Ga0495606_0005689
651 Ga0495610_0000157
652 Ga0495610_0021139
653 Ga0495616_0000286
654 Ga0495616_0021460
655 Ga0495620_0112578
656 Ga0495632_0002577
657 Ga0495632_0175359
658 Ga0495643_0217073
659 Ga0495648_0032483
660 Ga0495648_0136667
661 Ga0495663_0024138
662 Ga0495654_0000042
663 Ga0495654_0000052
664 Ga0495654_0000543
665 Ga0495654_0011634
666 Ga0495654_0015302
667 Ga0495597_0000352
668 Ga0495668_0005552
669 Ga0495668_0021368
670 Ga0495625_0000170
671 Ga0495625_0001751
672 Ga0495625_0004619
673 Ga0495625_0040066
674 Ga0495625_0044377
675 Ga0495625_0127721
676 Ga0495625_0149393
677 Ga0495671_0008541
678 Ga0495649_0012666
679 Ga0495589_0000004
680 Ga0495589_0065031
681 Ga0495660_0000007
682 Ga0495660_0000021
683 Ga0495660_0010784
684 Ga0495672_0000002
685 Ga0495672_0000199
686 Ga0495672_0001289
687 Ga0495683_0068165
688 Ga0495679_000020
689 Ga0495679_008134
690 Ga0495679_036007
691 Ga0495673_0000095
692 Ga0495673_0000147
693 Ga0495673_0000542
694 Ga0495673_0002053
695 Ga0495681_0015367
696 Ga0495681_0025691
697 Ga0495686_0121980
698 Ga0496100_0070052
699 Ga0496101_0066600
700 Ga0496103_0081389
701 Ga0496104_0000585
702 Ga0496104_0002514
703 Ga0496104_0089486
704 Ga0496104_0298427
705 Ga0496106_0051231
706 Ga0496107_0000042
707 Ga0496115_0096769
708 Ga0496116_0000001
709 Ga0496116_0000127
710 Ga0496116_0000145
711 Ga0496116_0000392
712 Ga0496116_0001074
713 Ga0496116_0003411
714 Ga0496116_0009633
715 Ga0496116_0010592
716 Ga0496116_0011095
717 Ga0496116_0024207
718 Ga0496117_0000436
719 Ga0496117_0000608
720 Ga0496117_0001974
721 Ga0496117_0005286
722 Ga0496117_0009686
723 Ga0496117_0137123
724 Ga0496118_0000464
725 Ga0496118_0000650
726 Ga0496118_0006588
727 Ga0496118_0006856
728 Ga0496118_0007432
729 Ga0496118_0025762
730 Ga0496118_0029505
731 Ga0496118_0056962
732 Ga0496118_0263025
733 Ga0496119_0000080
734 Ga0496119_0001227
735 Ga0496119_0002777
736 Ga0496119_0006765
737 Ga0496119_0020686
738 Ga0496119_0038452
739 Ga0496119_0065507
740 Ga0496119_0101107
741 Ga0496120_0000075
742 Ga0496120_0000128
743 Ga0496120_0002252
744 Ga0496120_0005088
745 Ga0496120_0021517
746 Ga0496120_0051487
747 Ga0496120_0101362
748 Ga0496120_0117802
749 Ga0496121_0000794
750 Ga0496121_0004945
751 Ga0496121_0005999
752 Ga0496121_0023459
753 Ga0496121_0026477
754 Ga0496121_0031468
755 Ga0496121_0046941
756 Ga0496121_0058378
757 Ga0496121_0089815
758 Ga0496121_0246489
759 Ga0496122_0000013
760 Ga0496122_0000211
761 Ga0496122_0000356
762 Ga0496122_0002599
763 Ga0496122_0004795
764 Ga0496122_0007725
765 Ga0496122_0088576
766 Ga0496122_0090127
767 Ga0496123_0000010
768 Ga0496123_0000134
769 Ga0496123_0000309
770 Ga0496123_0000700
771 Ga0496123_0001890
772 Ga0496123_0007397
773 Ga0496123_0018854
774 Ga0496123_0035162
775 Ga0496123_0153004
776 Ga0496124_0000152
777 Ga0496124_0009609
778 Ga0496124_0093103
779 Ga0496124_0096042
780 Ga0496124_0146489
781 Ga0496124_0274489
782 Ga0496125_0000019
783 Ga0496125_0002790
784 Ga0496125_0006354
785 Ga0496125_0008230
786 Ga0496125_0088974
787 Ga0496126_0002540
788 Ga0496126_0003071
789 Ga0496126_0004794
790 Ga0496126_0016875
791 Ga0496126_0099053
792 Ga0496126_0124582
793 Ga0496126_0275972
794 Ga0496126_0307664
795 Ga0495678_000326
796 Ga0495682_0000015
797 nmdc:mga00v17_3690_c1
798 nmdc:mga00v17_6380_c1
799 nmdc:mga0k408_38189_c1
800 Ga0500554_004652
801 Ga0500555_026318
802 Ga0500556_0000568
803 Ga0500614_010536
804 Ga0500618_006218
805 Ga0500621_000001
806 Ga0500658_0000384
807 Ga0500559_0000720
808 Ga0500559_0055393
809 Ga0500577_0005208
810 Ga0500627_0075858
811 Ga0500611_013272
812 Ga0500645_044513
813 Ga0500609_001502
814 2506577824
815 2506582962
816 2508851784
817 2511123785
818 2555260455
819 2585152054
820 2585194459
821 2585830018
822 2585832291
823 2599411130
824 2599929165
825 2601523561
826 2601528720
827 2601536475
828 2601541896
829 2601615553
830 2601620727
831 2601643380
832 2601649124
833 2601653604
834 2601659024
835 2601663203
836 2601696162
837 2601700836
838 2601707819
839 2601712878
840 2601716863
841 2601721186
842 2601724974
843 2601732257
844 2601737865
845 2601744008
846 2601753394
847 2601760255
848 2601765658
849 2602022021
850 2603638437
851 2603642943
852 2603660586
853 2603665858
854 2603699587
855 2603703551
856 2603839206
857 2603844738
858 2603849363
859 2603854432
860 2603867470
861 2603870155
862 2603875110
863 2606047346
864 2606070292
865 2606146151
866 2606177078
867 2609910694
868 2637226057
869 2643748670
870 2643782928
871 2643924037
872 2643928234
873 2644510345
874 2650899622
875 2656278504
876 2671103480
877 2671108091
878 2676407755
879 2681995345
880 2682007105
881 2686355650
882 2689444349
883 2753855469
884 2765588446
885 2775542262
886 2777020581
887 2791925040
888 2807177152
889 2809126009
890 2813729495
891 2814696984
892 2819539436
893 2819647690
894 2821119280
895 2823374235
896 2844427015
897 2847088175
898 2847802262
899 2869553701
900 2904475238
901 2904505215
902 2904517540
903 2908670724
904 2919112886
905 2919151584
906 2923638905
907 2927146458
908 2927834603
909 2937543305
910 2939568670
911 2939607982
912 2939644285
913 2945878624
914 2969083069
915 2971824347
916 2974312630
917 2984494690
918 2984560087
919 2984598169
920 2990265308
921 640937352
922 8018225427
923 8018407195
924 8054844770
925 8055088595
926 8055094171
927 8055099587
928 8057162384

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

22

145

0.92

PF03096

Ndr

Ndr family

33

266

0.86

PF12146

Hydrolase_4

Serine aminopeptidase, S33

18

249

0.85

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

23

258

0.63

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v48-assembly1.cif.gz_B crystal structure of the putative alpha/beta hydrolase rutd from e.coli 0.9918 1 261
3v48-assembly1.cif.gz_B crystal structure of the putative alpha/beta hydrolase rutd from e.coli 0.9806 1 261
2xua-assembly1.cif.gz_A crystal structure of the enol-lactonase from burkholderia xenovorans lb400 0.9236 2 256
4q3l-assembly1.cif.gz_A crystal structure of mgs-m2, an alpha/beta hydrolase enzyme from a medee basin deep-sea metagenome library 0.9074 2 256
3om8-assembly1.cif.gz_B the crystal structure of a hydrolase from pseudomonas aeruginosa pa01 0.9066 3 255
ID Description Score Start End Superfamily
3v48A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9796 2 266 3.40.50.1820
3v48A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9685 2 266 3.40.50.1820
2xuaH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.919 2 256 3.40.50.1820
4q3lC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9057 3 256 3.40.50.1820
3om8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9018 3 255 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A376L6Q4-F1-model_v4 Putative carbamate hydrolase RutD (EC 3.5.1.-) (Aminohydrolase) 0.9937 1 258 GO:0006212
GO:0016020
GO:0016811
GO:0019740
AF-A0A377ATY6-F1-model_v4 Putative carbamate hydrolase RutD (EC 3.5.1.-) (Aminohydrolase) 0.9935 1 255 GO:0006212
GO:0016811
GO:0019740
AF-A0A6S4Y8C2-F1-model_v4 deleted 0.9933 1 259
AF-A0A377NAH8-F1-model_v4 Aminoacrylate hydrolase RutD (EC 3.5.1.-) 0.9932 36 253 GO:0006212
GO:0016811
AF-A0A2X2IES8-F1-model_v4 Putative carbamate hydrolase RutD (EC 3.5.1.-) (Aminohydrolase) 0.9922 1 224 GO:0006212
GO:0016020
GO:0016740
GO:0016811
GO:0019740
GO:0046464
GO:0047372

Map