F449361

General Info

Members Datasets Scaffolds Average Seq Length
464 211 450 236

Family's Representative Sequence

Representative Sequence 3300046558|Ga0495633_0000101|Ga0495633_0000101_88165_89010
Length 281
Sequence VGLFFYFIQTIFLKLYSTKNYIYPQVKCLHSKNKTYTNTMSNNIDKNEFRKYAVKHHRINSLFVDKYLGNFDSRRMPQGIATTVPTGMTPYIIEERQLNVAQMDVFSRLMMDRIIFLGDAIYENIANIIQAQLLFLQSADAKRDIQIYINSPGGSVYAGLGIYDTMQFISNDVATICTGMAASMGAVLLVAGTEGKRAALPHARVMIHQPSGGAQGQQSDIEITYHEITKLKKELYQIIADHSGASFEKVWDASDRDYWMIAEEAKEFGMVDEILRGNKGK

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
4 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
5 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
6 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
7 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
8 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
9 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
10 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
14 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
15 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
74 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
81 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
86 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
128 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
135 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
136 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
137 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
138 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
139 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
140 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
143 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
155 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
156 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
157 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
158 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
161 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
162 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
163 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
164 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
165 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
180 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
181 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
182 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
185 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
189 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
190 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
196 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
202 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
203 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
204 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
205 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
206 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
207 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
208 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
211 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.52
Metatranscriptomes 6.25
Isolates 3.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.41
Nodule 0
Rhizoplane 0.43
Rhizosphere 83.84
Stem 0
Stem Tuber 0
Unclassified 7.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1004490 3300001904 Bacteria 2381
2 JGI24737J22298_10009123 3300001990 Bacteria 3306
3 JGI24735J21928_10000006 3300002067 Bacteria 339303
4 JGI24735J21928_10000010 3300002067 Bacteria 237152
5 JGI24735J21928_10063456 3300002067 Bacteria 1060
6 JGI25162J39368_1000089 3300002737 Bacteria 104054
7 JGI25162J39368_1000183 3300002737 Bacteria 67086
8 JGI25157J39369_1003116 3300002741 Bacteria 3558
9 JGI25164J39214_1002272 3300002772 Bacteria 3117
10 rootH1_10016978 3300003316 Bacteria 25561
11 rootH1_10073454 3300003316 Bacteria 6341
12 rootH1_10073454 3300003323 Bacteria 16546
13 rootH2_10007103 3300003320 Bacteria 17081
14 rootH2_10019768 3300003320 Bacteria 3295
15 rootH2_10042549 3300003320 Bacteria 16252
16 rootL2_10030402 3300003322 Unclassified 2024
17 rootL2_10099137 3300003322 Bacteria 1998
18 rootL2_10164408 3300003322 Bacteria 1732
19 rootH1_10001388 3300003323 Bacteria 13030
20 rootH1_10138229 3300003323 Bacteria 2766
21 rootH1_10178156 3300003323 Bacteria 4609
22 Ga0058862_10004171 3300004803 Bacteria 2179
23 Ga0065714_10004364 3300005288 Bacteria 6013
24 Ga0065714_10007456 3300005288 Bacteria 2994
25 Ga0065714_10028023 3300005288 Bacteria 1294
26 Ga0065714_10067103 3300005288 Bacteria 5882
27 Ga0065714_10077211 3300005288 Bacteria 2711
28 Ga0065714_10132761 3300005288 Bacteria 1234
29 Ga0070658_10000014 3300005327 Bacteria 244978
30 Ga0070658_10000018 3300005327 Bacteria 200558
31 Ga0070658_10006003 3300005327 Bacteria 9849
32 Ga0070658_10207601 3300005327 Bacteria 1654
33 Ga0070676_10000846 3300005328 Bacteria 15151
34 Ga0070683_100006565 3300005329 Bacteria 9770
35 Ga0068868_100003017 3300005338 Bacteria 11709
36 Ga0068868_100369997 3300005338 Bacteria 1231
37 Ga0070660_100068098 3300005339 Bacteria 2774
38 Ga0070660_100091635 3300005339 Bacteria 2398
39 Ga0070673_100034709 3300005364 Bacteria 3819
40 Ga0070688_100185626 3300005365 Bacteria 1445
41 Ga0070659_100000383 3300005366 Bacteria 33558
42 Ga0070663_100004677 3300005455 Bacteria 8070
43 Ga0070678_100009861 3300005456 Bacteria 5806
44 Ga0070678_100040848 3300005456 Bacteria 3284
45 Ga0070678_100711909 3300005456 Bacteria 905
46 Ga0070662_100000225 3300005457 Bacteria 33224
47 Ga0070681_10008484 3300005458 Bacteria 10057
48 Ga0068867_100009474 3300005459 Bacteria 6867
49 Ga0070698_100419905 3300005471 Bacteria 1272
50 Ga0070679_100006892 3300005530 Bacteria 10596
51 Ga0070679_100109898 3300005530 Bacteria 2743
52 Ga0070679_100376147 3300005530 Bacteria 1367
53 Ga0068853_100043258 3300005539 Bacteria 3853
54 Ga0068853_100189439 3300005539 Bacteria 1868
55 Ga0070665_100000072 3300005548 Bacteria 198575
56 Ga0068855_100000019 3300005563 Bacteria 205963
57 Ga0068855_100004959 3300005563 Bacteria 16236
58 Ga0068855_100014155 3300005563 Bacteria 9609
59 Ga0068855_100016538 3300005563 Bacteria 8873
60 Ga0068855_100024658 3300005563 Bacteria 7195
61 Ga0068855_100169804 3300005563 Bacteria 2471
62 Ga0068855_100216830 3300005563 Bacteria 2148
63 Ga0068855_100362432 3300005563 Bacteria 1595
64 Ga0068855_100545614 3300005563 Bacteria 1255
65 Ga0068855_100642732 3300005563 Bacteria 1140
66 Ga0068857_100031653 3300005577 Bacteria 4675
67 Ga0068854_100063761 3300005578 Bacteria 2676
68 Ga0068856_100020757 3300005614 Bacteria 6383
69 Ga0068856_100030416 3300005614 Bacteria 5278
70 Ga0068856_100211627 3300005614 Bacteria 1954
71 Ga0068852_100021310 3300005616 Bacteria 5172
72 Ga0068852_100051838 3300005616 Bacteria 3524
73 Ga0068852_100176704 3300005616 Bacteria 2005
74 Ga0068852_100566828 3300005616 Bacteria 1137
75 Ga0068870_10245167 3300005840 Bacteria 1108
76 Ga0068862_100899142 3300005844 Bacteria 870
77 Ga0075366_10003099 3300006195 Bacteria 8689
78 Ga0075366_10004860 3300006195 Bacteria 7252
79 Ga0075366_10021868 3300006195 Bacteria 3719
80 Ga0097621_100010132 3300006237 Bacteria 6880
81 Ga0097621_100796832 3300006237 Bacteria 875
82 Ga0075370_10085779 3300006353 Bacteria 1813
83 Ga0068871_100001609 3300006358 Bacteria 15193
84 Ga0068865_100006397 3300006881 Bacteria 7179
85 Ga0105240_10000103 3300009093 Bacteria 172981
86 Ga0105240_10005142 3300009093 Bacteria 19583
87 Ga0105240_10134573 3300009093 Bacteria 2961
88 Ga0105240_10150139 3300009093 Bacteria 2776
89 Ga0105240_10235715 3300009093 Bacteria 2124
90 Ga0105240_10248916 3300009093 Bacteria 2056
91 Ga0105240_10366161 3300009093 Bacteria 1631
92 Ga0114129_10009940 3300009147 Bacteria 13561
93 Ga0105241_10001520 3300009174 Bacteria 17783
94 Ga0105241_10003168 3300009174 Bacteria 12246
95 Ga0105241_10025751 3300009174 Bacteria 4373
96 Ga0105241_10899054 3300009174 Bacteria 822
97 Ga0105242_10109931 3300009176 Bacteria 2347
98 Ga0105237_10001732 3300009545 Bacteria 28199
99 Ga0105237_10002542 3300009545 Bacteria 22567
100 Ga0105237_10007877 3300009545 Bacteria 11612
101 Ga0105237_10019239 3300009545 Bacteria 7056
102 Ga0105237_10062918 3300009545 Bacteria 3709
103 Ga0105237_10119128 3300009545 Bacteria 2634
104 Ga0105237_10137717 3300009545 Bacteria 2436
105 Ga0105237_10164972 3300009545 Bacteria 2214
106 Ga0105237_10379835 3300009545 Bacteria 1417
107 Ga0105237_10380889 3300009545 Bacteria 1415
108 Ga0105237_10450498 3300009545 Bacteria 1293
109 Ga0105237_10734012 3300009545 Bacteria 994
110 Ga0105238_10050190 3300009551 Bacteria 4200
111 Ga0105239_10000132 3300010375 Bacteria 105380
112 Ga0105239_10000280 3300010375 Bacteria 75222
113 Ga0105239_10001111 3300010375 Bacteria 37117
114 Ga0105239_10002156 3300010375 Bacteria 25330
115 Ga0105239_10002202 3300010375 Bacteria 25065
116 Ga0105239_10004736 3300010375 Bacteria 16155
117 Ga0105239_10005928 3300010375 Bacteria 14223
118 Ga0105239_10009733 3300010375 Bacteria 10805
119 Ga0105239_10021496 3300010375 Bacteria 7114
120 Ga0105239_10148231 3300010375 Bacteria 2618
121 Ga0105239_10522471 3300010375 Bacteria 1350
122 Ga0157373_10000523 3300013100 Bacteria 30125
123 Ga0157373_10016462 3300013100 Bacteria 5392
124 Ga0157371_10000251 3300013102 Bacteria 74986
125 Ga0157371_10003198 3300013102 Bacteria 15040
126 Ga0157371_10003584 3300013102 Bacteria 13992
127 Ga0157371_10012803 3300013102 Bacteria 6395
128 Ga0157371_10201098 3300013102 Bacteria 1428
129 Ga0157370_10070315 3300013104 Bacteria 3304
130 Ga0157370_10074388 3300013104 Bacteria 3204
131 Ga0157370_10395637 3300013104 Bacteria 1272
132 Ga0157370_10715730 3300013104 Bacteria 913
133 Ga0157369_10000940 3300013105 Bacteria 36995
134 Ga0157369_10003510 3300013105 Bacteria 18631
135 Ga0157369_10018366 3300013105 Bacteria 7842
136 Ga0157369_10178124 3300013105 Bacteria 2238
137 Ga0157369_10328614 3300013105 Bacteria 1589
138 Ga0157369_10425954 3300013105 Bacteria 1376
139 Ga0157369_10667719 3300013105 Bacteria 1071
140 Ga0157374_10000379 3300013296 Bacteria 40932
141 Ga0157374_10001744 3300013296 Bacteria 18253
142 Ga0157374_10069736 3300013296 Bacteria 3311
143 Ga0157378_10008719 3300013297 Bacteria 8826
144 Ga0157378_10055346 3300013297 Bacteria 3534
145 Ga0157378_10163014 3300013297 Bacteria 2086
146 Ga0163162_10000010 3300013306 Bacteria 302032
147 Ga0163162_10455527 3300013306 Bacteria 1411
148 Ga0157372_10000029 3300013307 Bacteria 180371
149 Ga0157372_10000050 3300013307 Bacteria 140381
150 Ga0157372_10000266 3300013307 Bacteria 57783
151 Ga0157372_10000428 3300013307 Bacteria 46270
152 Ga0157372_10001626 3300013307 Bacteria 24372
153 Ga0157372_10013281 3300013307 Bacteria 8790
154 Ga0157372_10028963 3300013307 Bacteria 6043
155 Ga0157372_10357443 3300013307 Bacteria 1702
156 Ga0157375_10020842 3300013308 Bacteria 5999
157 Ga0157375_10165781 3300013308 Bacteria 2354
158 Ga0157377_10038270 3300014745 Bacteria 2647
159 Ga0157379_10161841 3300014968 Bacteria 2020
160 Ga0163161_10038390 3300017792 Bacteria 3435
161 Ga0163161_10071991 3300017792 Bacteria 2531
162 Ga0197907_10578831 3300020069 Bacteria 1692
163 Ga0197907_11325599 3300020069 Bacteria 1058
164 Ga0206356_11639496 3300020070 Bacteria 1250
165 Ga0206356_11724153 3300020070 Bacteria 2140
166 Ga0206349_1787364 3300020075 Bacteria 1642
167 Ga0206355_1000653 3300020076 Bacteria 1960
168 Ga0206351_10137770 3300020077 Bacteria 4153
169 Ga0206351_10287394 3300020077 Bacteria 3472
170 Ga0206351_10729834 3300020077 Bacteria 2320
171 Ga0206352_11144798 3300020078 Bacteria 4142
172 Ga0206350_11566577 3300020080 Bacteria 2435
173 Ga0206350_11613328 3300020080 Bacteria 3445
174 Ga0206354_10800238 3300020081 Bacteria 3791
175 Ga0206354_11310547 3300020081 Bacteria 2186
176 Ga0206353_11955577 3300020082 Bacteria 1377
177 Ga0154015_1190472 3300020610 Bacteria 2816
178 Ga0154015_1344955 3300020610 Bacteria 2276
179 Ga0213872_10015047 3300021361 Bacteria 3599
180 Ga0224712_10004597 3300022467 Bacteria 3741
181 Ga0224712_10005032 3300022467 Bacteria 3635
182 Ga0224712_10009140 3300022467 Bacteria 2972
183 Ga0209563_109182 3300025230 Bacteria 1512
184 Ga0207427_100125 3300025231 Bacteria 96142
185 Ga0209437_100008 3300025233 Bacteria 921142
186 Ga0209437_100089 3300025233 Bacteria 250476
187 Ga0209437_100221 3300025233 Bacteria 104135
188 Ga0209026_1000542 3300025250 Bacteria 25955
189 Ga0209026_1001907 3300025250 Bacteria 8450
190 Ga0209026_1004842 3300025250 Bacteria 3830
191 Ga0209129_1009003 3300025258 Bacteria 2693
192 Ga0209129_1011979 3300025258 Bacteria 2029
193 Ga0209233_1000024 3300025261 Bacteria 695418
194 Ga0209455_1006473 3300025272 Bacteria 3450
195 Ga0207647_10000058 3300025904 Bacteria 84631
196 Ga0207647_10006410 3300025904 Bacteria 8553
197 Ga0207645_10005616 3300025907 Bacteria 9069
198 Ga0207643_10129134 3300025908 Bacteria 1502
199 Ga0207705_10000036 3300025909 Bacteria 200787
200 Ga0207705_10000107 3300025909 Bacteria 94984
201 Ga0207705_10059105 3300025909 Bacteria 2766
202 Ga0207705_10495167 3300025909 Bacteria 949
203 Ga0207654_10001520 3300025911 Bacteria 12206
204 Ga0207654_10021599 3300025911 Bacteria 3424
205 Ga0207654_10047065 3300025911 Bacteria 2463
206 Ga0207654_10287939 3300025911 Bacteria 1113
207 Ga0207654_10352497 3300025911 Bacteria 1014
208 Ga0207707_10011302 3300025912 Bacteria 7771
209 Ga0207695_10000019 3300025913 Bacteria 732137
210 Ga0207695_10000048 3300025913 Bacteria 421800
211 Ga0207695_10003855 3300025913 Bacteria 20759
212 Ga0207695_10004800 3300025913 Bacteria 18291
213 Ga0207695_10123216 3300025913 Bacteria 2558
214 Ga0207695_10166868 3300025913 Bacteria 2129
215 Ga0207695_10174376 3300025913 Bacteria 2074
216 Ga0207671_10000300 3300025914 Bacteria 73008
217 Ga0207671_10002295 3300025914 Bacteria 20672
218 Ga0207671_10003229 3300025914 Bacteria 16398
219 Ga0207671_10004414 3300025914 Bacteria 13477
220 Ga0207671_10012840 3300025914 Bacteria 6710
221 Ga0207671_10038750 3300025914 Bacteria 3532
222 Ga0207671_10042559 3300025914 Bacteria 3361
223 Ga0207671_10071774 3300025914 Bacteria 2583
224 Ga0207671_10082003 3300025914 Bacteria 2419
225 Ga0207671_10115992 3300025914 Bacteria 2042
226 Ga0207671_10187256 3300025914 Bacteria 1613
227 Ga0207657_10059885 3300025919 Bacteria 3269
228 Ga0207657_10073455 3300025919 Bacteria 2890
229 Ga0207652_10006998 3300025921 Bacteria 9090
230 Ga0207652_10182822 3300025921 Bacteria 1884
231 Ga0207652_10271108 3300025921 Bacteria 1531
232 Ga0207694_10007215 3300025924 Bacteria 8439
233 Ga0207694_10176074 3300025924 Bacteria 1733
234 Ga0207690_10003029 3300025932 Bacteria 10114
235 Ga0207690_10005836 3300025932 Bacteria 7284
236 Ga0207706_10000317 3300025933 Bacteria 52169
237 Ga0207706_10502005 3300025933 Bacteria 1047
238 Ga0207686_10393877 3300025934 Bacteria 1053
239 Ga0207704_10000044 3300025938 Bacteria 86753
240 Ga0207704_10011038 3300025938 Bacteria 4432
241 Ga0207691_10102139 3300025940 Bacteria 2558
242 Ga0207661_10232970 3300025944 Bacteria 1631
243 Ga0207667_10000020 3300025949 Bacteria 374770
244 Ga0207667_10005185 3300025949 Bacteria 15915
245 Ga0207667_10019703 3300025949 Bacteria 7521
246 Ga0207667_10030950 3300025949 Bacteria 5783
247 Ga0207667_10094118 3300025949 Bacteria 3094
248 Ga0207667_10094980 3300025949 Bacteria 3078
249 Ga0207667_10144159 3300025949 Bacteria 2452
250 Ga0207667_10306588 3300025949 Bacteria 1622
251 Ga0207667_10485483 3300025949 Bacteria 1254
252 Ga0207651_10016543 3300025960 Bacteria 4324
253 Ga0207640_10046812 3300025981 Bacteria 2786
254 Ga0207640_10050217 3300025981 Bacteria 2705
255 Ga0207677_10065272 3300026023 Bacteria 2539
256 Ga0207677_10184584 3300026023 Bacteria 1644
257 Ga0207639_10018238 3300026041 Bacteria 4985
258 Ga0207639_10111740 3300026041 Bacteria 2228
259 Ga0207678_10014560 3300026067 Bacteria 6920
260 Ga0207678_10020654 3300026067 Bacteria 5773
261 Ga0207702_10015770 3300026078 Bacteria 6255
262 Ga0207702_10036722 3300026078 Bacteria 4099
263 Ga0207702_10075607 3300026078 Bacteria 2910
264 Ga0207648_10012072 3300026089 Bacteria 8102
265 Ga0207674_10019805 3300026116 Bacteria 7282
266 Ga0207674_10041090 3300026116 Bacteria 4785
267 Ga0207683_10151608 3300026121 Bacteria 2092
268 Ga0207698_10033230 3300026142 Bacteria 3746
269 Ga0207698_10039561 3300026142 Bacteria 3495
270 Ga0207698_10592698 3300026142 Bacteria 1092
271 Ga0268266_10000089 3300028379 Bacteria 198566
272 Ga0307517_10005628 3300028786 Bacteria 18796
273 Ga0307517_10006738 3300028786 Bacteria 16906
274 Ga0307515_10000235 3300028794 Bacteria 136714
275 Ga0307515_10002819 3300028794 Bacteria 36978
276 Ga0307515_10003393 3300028794 Bacteria 33536
277 Ga0307515_10228727 3300028794 Bacteria 1658
278 Ga0307513_10034037 3300031456 Bacteria 5722
279 Ga0307513_10440993 3300031456 Bacteria 1028
280 Ga0307509_10013690 3300031507 Bacteria 9585
281 Ga0307408_100000524 3300031548 Bacteria 33130
282 Ga0307408_100001832 3300031548 Bacteria 15482
283 Ga0316576_10061988 3300031727 Bacteria 2742
284 Ga0307405_10404306 3300031731 Bacteria 1070
285 Ga0307412_10006747 3300031911 Bacteria 6508
286 Ga0307412_10010369 3300031911 Bacteria 5365
287 Ga0307414_10488083 3300032004 Bacteria 1088
288 Ga0307507_10001027 3300033179 Bacteria 62236
289 Ga0307507_10003315 3300033179 Bacteria 31576
290 Ga0307510_10002378 3300033180 Bacteria 21305
291 Ga0395899_0000001 3300037312 Bacteria 1750322
292 Ga0395899_0000024 3300037312 Bacteria 357402
293 Ga0395899_0000382 3300037312 Bacteria 52888
294 Ga0395899_0000532 3300037312 Bacteria 41711
295 Ga0395899_0056104 3300037312 Bacteria 2912
296 Ga0395899_0114841 3300037312 Bacteria 1933
297 Ga0395899_0191278 3300037312 Bacteria 1432
298 Ga0395900_0000181 3300037418 Bacteria 101531
299 Ga0395900_0000277 3300037418 Bacteria 77256
300 Ga0395900_0000285 3300037418 Bacteria 75772
301 Ga0395900_0009024 3300037418 Bacteria 10224
302 Ga0395900_0037900 3300037418 Bacteria 4970
303 Ga0395900_0086998 3300037418 Unclassified 3212
304 Ga0395898_0086002 3300037466 Bacteria 3031
305 Ga0395898_0103037 3300037466 Bacteria 2739
306 Ga0395898_0215292 3300037466 Bacteria 1832
307 Ga0395905_0000068 3300037471 Bacteria 177163
308 Ga0395905_0000716 3300037471 Bacteria 43859
309 Ga0395905_0000826 3300037471 Bacteria 40540
310 Ga0395901_0000136 3300038443 Bacteria 95382
311 Ga0395901_0021079 3300038443 Bacteria 6676
312 Ga0395901_0027635 3300038443 Bacteria 5831
313 Ga0395901_0137715 3300038443 Bacteria 2565
314 Ga0395901_0918921 3300038443 Bacteria 856
315 Ga0436361_1041094 3300039447 Bacteria 6213
316 Ga0439436_0000922 3300041404 Bacteria 8081
317 Ga0439439_0023008 3300041406 Bacteria 1560
318 Ga0451853_1966283 3300041512 Bacteria 943
319 Ga0439448_0004161 3300042005 Bacteria 4074
320 Ga0439457_010301 3300042014 Bacteria 2152
321 Ga0439462_0003565 3300042015 Bacteria 3744
322 Ga0451577_0038939 3300042876 Bacteria 4273
323 Ga0466969_0043635 3300044656 Bacteria 2234
324 Ga0466972_0000157 3300044658 Bacteria 54726
325 Ga0466966_0034758 3300044684 Bacteria 3258
326 Ga0466961_0104562 3300044693 Bacteria 1783
327 Ga0466964_0027711 3300044706 Bacteria 2226
328 Ga0453684_0000334 3300044712 Bacteria 196444
329 Ga0466971_0137529 3300044719 Bacteria 1137
330 Ga0466971_0160364 3300044719 Bacteria 1053
331 Ga0466968_0039524 3300044735 Bacteria 1987
332 Ga0466957_0184318 3300044842 Bacteria 1364
333 Ga0466959_0000005 3300045049 Bacteria 213958
334 Ga0466959_0018912 3300045049 Bacteria 5062
335 Ga0466958_0102623 3300045836 Bacteria 1780
336 Ga0495629_0167276 3300046459 Bacteria 1527
337 Ga0495650_0000025 3300046471 Bacteria 486001
338 Ga0495650_0000132 3300046471 Bacteria 174226
339 Ga0495650_0099648 3300046471 Bacteria 1093
340 Ga0495650_0134329 3300046471 Bacteria 900
341 Ga0495605_0023901 3300046474 Bacteria 3206
342 Ga0495585_0000399 3300046492 Bacteria 42055
343 Ga0495585_0003042 3300046492 Bacteria 11558
344 Ga0495585_0003830 3300046492 Bacteria 10012
345 Ga0495596_0042318 3300046500 Bacteria 1795
346 Ga0495583_0055536 3300046506 Bacteria 1789
347 Ga0495583_0108245 3300046506 Bacteria 1180
348 Ga0495606_0000100 3300046507 Bacteria 147592
349 Ga0495606_0012407 3300046507 Bacteria 6835
350 Ga0495606_0023883 3300046507 Bacteria 4420
351 Ga0495606_0054667 3300046507 Bacteria 2585
352 Ga0495606_0063668 3300046507 Bacteria 2350
353 Ga0495606_0113647 3300046507 Bacteria 1630
354 Ga0495606_0331529 3300046507 Bacteria 814
355 Ga0495610_0009003 3300046512 Bacteria 6374
356 Ga0495610_0030809 3300046512 Bacteria 2805
357 Ga0495616_0003417 3300046513 Bacteria 10176
358 Ga0495616_0015509 3300046513 Bacteria 4237
359 Ga0495631_0026209 3300046518 Bacteria 2679
360 Ga0495643_0217615 3300046522 Bacteria 908
361 Ga0495644_0029653 3300046523 Bacteria 2067
362 Ga0495648_0005651 3300046524 Bacteria 10349
363 Ga0495648_0007839 3300046524 Bacteria 8493
364 Ga0495648_0011090 3300046524 Bacteria 6823
365 Ga0495648_0041384 3300046524 Bacteria 2911
366 Ga0495652_0372357 3300046529 Bacteria 1018
367 Ga0495654_0039839 3300046530 Bacteria 2344
368 Ga0495609_0018191 3300046538 Bacteria 3258
369 Ga0495609_0052655 3300046538 Bacteria 1811
370 Ga0495622_0005679 3300046557 Bacteria 5785
371 Ga0495633_0000067 3300046558 Bacteria 139122
372 Ga0495633_0000101 3300046558 Bacteria 116147
373 Ga0495633_0000583 3300046558 Bacteria 35346
374 Ga0495668_0000010 3300046616 Bacteria 487308
375 Ga0495668_0000069 3300046616 Bacteria 174287
376 Ga0495668_0054631 3300046616 Bacteria 2207
377 Ga0495668_0123724 3300046616 Bacteria 1415
378 Ga0495625_0000036 3300046660 Bacteria 221680
379 Ga0495625_0000282 3300046660 Bacteria 79268
380 Ga0495625_0001618 3300046660 Bacteria 26556
381 Ga0495625_0003182 3300046660 Bacteria 16702
382 Ga0495625_0009053 3300046660 Bacteria 8404
383 Ga0495625_0024910 3300046660 Bacteria 4545
384 Ga0495625_0052495 3300046660 Bacteria 2919
385 Ga0495625_0094761 3300046660 Bacteria 2059
386 Ga0495661_0002095 3300046665 Bacteria 15654
387 Ga0495661_0032461 3300046665 Bacteria 3300
388 Ga0495661_0067169 3300046665 Bacteria 2107
389 Ga0495658_0022137 3300046683 Bacteria 3358
390 Ga0495658_0037901 3300046683 Bacteria 2667
391 Ga0495669_0067758 3300046684 Bacteria 1623
392 Ga0495670_0031141 3300046691 Bacteria 2651
393 Ga0495671_0025856 3300046692 Bacteria 3048
394 Ga0495649_0000017 3300046694 Bacteria 221685
395 Ga0495649_0032433 3300046694 Bacteria 2877
396 Ga0495660_0026050 3300046810 Bacteria 3317
397 Ga0495660_0080725 3300046810 Bacteria 1706
398 Ga0495683_0044496 3300047323 Bacteria 2233
399 Ga0495687_001329 3300047443 Bacteria 23054
400 Ga0495687_002159 3300047443 Bacteria 16416
401 Ga0495687_002329 3300047443 Bacteria 15450
402 Ga0495677_0111694 3300047445 Bacteria 1039
403 Ga0495686_0000283 3300047472 Bacteria 89298
404 Ga0495686_0002715 3300047472 Bacteria 16193
405 Ga0495686_0020915 3300047472 Bacteria 4357
406 Ga0495686_0142759 3300047472 Bacteria 1412
407 Ga0495686_0187894 3300047472 Bacteria 1192
408 Ga0495686_0213995 3300047472 Bacteria 1100
409 Ga0495614_0014811 3300048089 Bacteria 3409
410 Ga0501309_012540 3300049129 Bacteria 1117
411 Ga0501310_025132 3300049130 Bacteria 765
412 Ga0501305_019161 3300049161 Bacteria 996
413 Ga0501305_037983 3300049161 Bacteria 775
414 Ga0495678_069318 3300049459 Bacteria 1297
415 Ga0495682_0055251 3300049460 Bacteria 1440
416 Ga0501315_009425 3300049531 Bacteria 1154
417 Ga0501318_027078 3300049534 Bacteria 761
418 Ga0501321_000610 3300049537 Bacteria 2399
419 Ga0501321_007188 3300049537 Bacteria 1151
420 Ga0501034_0360511 3300049571 Bacteria 1381
421 Ga0501047_0131792 3300049581 Bacteria 2380
422 Ga0501047_0190219 3300049581 Bacteria 1916
423 Ga0501047_0252611 3300049581 Bacteria 1611
424 Ga0501225_0001638 3300049705 Bacteria 6999
425 Ga0501241_013947 3300049758 Bacteria 1460
426 Ga0501044_0001783 3300049823 Bacteria 25158
427 nmdc:mga0k408_150_c1 3300050493 Bacteria 35565
428 nmdc:mga0k408_328106_c1 3300050493 Bacteria 913
429 nmdc:mga0k408_4072_c1 3300050493 Bacteria 7760
430 nmdc:mga0k408_428891_c1 3300050493 Bacteria 786
431 nmdc:mga0k408_6991_c2 3300050493 Bacteria 3741
432 nmdc:mga0k408_959_c1 3300050493 Bacteria 15846
433 nmdc:mga0k408_96539_c1 3300050493 Bacteria 1740
434 nmdc:mga07m45_52870_c1 3300050496 Bacteria 2294
435 nmdc:mga05p37_8925_c1 3300050507 Bacteria 11850
436 Ga0500635_0001679 3300053080 Bacteria 5354
437 Ga0500578_0018367 3300053086 Bacteria 4494
438 Ga0500647_0172263 3300053091 Bacteria 998
439 Ga0500650_0106386 3300053098 Bacteria 1311
440 Ga0500608_000615 3300053122 Bacteria 13102
441 Ga0500608_027921 3300053122 Bacteria 2661
442 Ga0500614_002110 3300053123 Bacteria 4536
443 Ga0500618_000013 3300053125 Bacteria 183026
444 Ga0500618_000040 3300053125 Bacteria 112548
445 Ga0500573_0204981 3300053140 Bacteria 1044
446 Ga0500616_0104100 3300053153 Bacteria 1382
447 Ga0500622_0000768 3300053156 Bacteria 27944
448 Ga0500622_0103468 3300053156 Bacteria 1399
449 Ga0500624_000689 3300053157 Bacteria 8570
450 Ga0500624_001016 3300053157 Bacteria 5602

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041404 Ga0439436_0000922 Ga0439436_0000922_6215_6922 222
2 3300042015 Ga0439462_0003565 Ga0439462_0003565_1820_2527 222
3 3300013104 Ga0157370_10395637 Ga0157370_103956371 223
4 3300031727 Ga0316576_10061988 Ga0316576_100619882 224
5 iso_pu_bacteria 2852623160 2852624604 224
6 iso_pu_bacteria 2884933994 2884936511 224
7 3300003323 rootH1_10178156 rootH1_101781565 225
8 3300005539 Ga0068853_100189439 Ga0068853_1001894391 226
9 3300005844 Ga0068862_100899142 Ga0068862_1008991421 226
10 3300013306 Ga0163162_10000010 Ga0163162_1000001022 226
11 3300014968 Ga0157379_10161841 Ga0157379_101618412 226
12 3300026041 Ga0207639_10018238 Ga0207639_100182383 226
13 3300026078 Ga0207702_10015770 Ga0207702_100157707 226
14 iso_pu_bacteria 2599185184 2599481133 226
15 iso_pu_bacteria 2928078545 2928082993 226
16 iso_pu_bacteria 2928147474 2928150012 226
17 iso_pu_bacteria 2932082852 2932086832 226
18 3300002737 JGI25162J39368_1000183 JGI25162J39368_100018338 227
19 3300003320 rootH2_10042549 rootH2_100425493 227
20 3300005288 Ga0065714_10004364 Ga0065714_100043642 227
21 3300005456 Ga0070678_100040848 Ga0070678_1000408481 227
22 3300005563 Ga0068855_100545614 Ga0068855_1005456142 227
23 3300009093 Ga0105240_10000103 Ga0105240_1000010316 227
24 3300009093 Ga0105240_10150139 Ga0105240_101501391 227
25 3300009174 Ga0105241_10003168 Ga0105241_100031685 227
26 3300009545 Ga0105237_10002542 Ga0105237_1000254214 227
27 3300009545 Ga0105237_10062918 Ga0105237_100629185 227
28 3300009545 Ga0105237_10450498 Ga0105237_104504981 227
29 3300009545 Ga0105237_10734012 Ga0105237_107340122 227
30 3300010375 Ga0105239_10000280 Ga0105239_1000028014 227
31 3300010375 Ga0105239_10001111 Ga0105239_1000111120 227
32 3300010375 Ga0105239_10021496 Ga0105239_100214963 227
33 3300013296 Ga0157374_10000379 Ga0157374_1000037919 227
34 3300013308 Ga0157375_10020842 Ga0157375_100208427 227
35 3300013308 Ga0157375_10165781 Ga0157375_101657813 227
36 3300017792 Ga0163161_10071991 Ga0163161_100719911 227
37 3300025233 Ga0209437_100089 Ga0209437_100089102 227
38 3300025258 Ga0209129_1011979 Ga0209129_10119793 227
39 3300025911 Ga0207654_10287939 Ga0207654_102879392 227
40 3300025913 Ga0207695_10000019 Ga0207695_10000019571 227
41 3300025914 Ga0207671_10003229 Ga0207671_100032296 227
42 3300025914 Ga0207671_10004414 Ga0207671_1000441413 227
43 3300025914 Ga0207671_10038750 Ga0207671_100387506 227
44 3300025921 Ga0207652_10271108 Ga0207652_102711082 227
45 3300025924 Ga0207694_10007215 Ga0207694_100072158 227
46 3300025934 Ga0207686_10393877 Ga0207686_103938772 227
47 3300025938 Ga0207704_10011038 Ga0207704_100110383 227
48 3300025940 Ga0207691_10102139 Ga0207691_101021393 227
49 3300025949 Ga0207667_10019703 Ga0207667_100197036 227
50 3300025949 Ga0207667_10485483 Ga0207667_104854831 227
51 3300025981 Ga0207640_10046812 Ga0207640_100468122 227
52 3300026023 Ga0207677_10065272 Ga0207677_100652722 227
53 3300026121 Ga0207683_10151608 Ga0207683_101516083 227
54 3300028786 Ga0307517_10006738 Ga0307517_100067387 227
55 3300028794 Ga0307515_10002819 Ga0307515_100028196 227
56 3300033179 Ga0307507_10001027 Ga0307507_1000102727 227
57 3300037312 Ga0395899_0056104 Ga0395899_0056104_423_1106 227
58 3300037418 Ga0395900_0037900 Ga0395900_0037900_2086_2769 227
59 3300037466 Ga0395898_0103037 Ga0395898_0103037_1004_1687 227
60 3300037471 Ga0395905_0000716 Ga0395905_0000716_3845_4528 227
61 3300038443 Ga0395901_0137715 Ga0395901_0137715_630_1313 227
62 3300046492 Ga0495585_0003042 Ga0495585_0003042_8832_9515 227
63 3300046507 Ga0495606_0012407 Ga0495606_0012407_2461_3144 227
64 3300046507 Ga0495606_0331529 Ga0495606_0331529_56_739 227
65 3300046513 Ga0495616_0015509 Ga0495616_0015509_643_1326 227
66 3300046524 Ga0495648_0005651 Ga0495648_0005651_7819_8502 227
67 3300046524 Ga0495648_0011090 Ga0495648_0011090_3845_4528 227
68 3300046524 Ga0495648_0041384 Ga0495648_0041384_1744_2427 227
69 3300046530 Ga0495654_0039839 Ga0495654_0039839_650_1333 227
70 3300046538 Ga0495609_0018191 Ga0495609_0018191_305_988 227
71 3300046558 Ga0495633_0000067 Ga0495633_0000067_1222_1905 227
72 3300046616 Ga0495668_0000069 Ga0495668_0000069_79127_79810 227
73 3300046660 Ga0495625_0001618 Ga0495625_0001618_2955_3638 227
74 3300046660 Ga0495625_0003182 Ga0495625_0003182_15597_16280 227
75 3300046660 Ga0495625_0094761 Ga0495625_0094761_343_1026 227
76 3300046683 Ga0495658_0022137 Ga0495658_0022137_2189_2872 227
77 3300047443 Ga0495687_001329 Ga0495687_001329_3388_4071 227
78 3300047472 Ga0495686_0000283 Ga0495686_0000283_80837_81520 227
79 3300047472 Ga0495686_0142759 Ga0495686_0142759_56_739 227
80 3300048089 Ga0495614_0014811 Ga0495614_0014811_2340_3023 227
81 3300049459 Ga0495678_069318 Ga0495678_069318_358_1041 227
82 3300050493 nmdc:mga0k408_150_c1 nmdc:mga0k408_150_c1_9491_10174 227
83 3300053091 Ga0500647_0172263 Ga0500647_0172263_183_866 227
84 3300053125 Ga0500618_000040 Ga0500618_000040_95667_96350 227
85 3300053157 Ga0500624_000689 Ga0500624_000689_7792_8475 227
86 3300005288 Ga0065714_10007456 Ga0065714_100074561 228
87 3300005288 Ga0065714_10132761 Ga0065714_101327612 228
88 3300005327 Ga0070658_10000014 Ga0070658_10000014218 228
89 3300005456 Ga0070678_100711909 Ga0070678_1007119091 228
90 3300005563 Ga0068855_100024658 Ga0068855_1000246586 228
91 3300005563 Ga0068855_100362432 Ga0068855_1003624323 228
92 3300005614 Ga0068856_100030416 Ga0068856_1000304167 228
93 3300005616 Ga0068852_100566828 Ga0068852_1005668281 228
94 3300006237 Ga0097621_100796832 Ga0097621_1007968321 228
95 3300009093 Ga0105240_10366161 Ga0105240_103661613 228
96 3300025909 Ga0207705_10000107 Ga0207705_1000010775 228
97 3300025949 Ga0207667_10094118 Ga0207667_100941182 228
98 3300026078 Ga0207702_10075607 Ga0207702_100756072 228
99 3300037418 Ga0395900_0000285 Ga0395900_0000285_7964_8650 228
100 3300042876 Ga0451577_0038939 Ga0451577_0038939_376_1074 228
101 3300044712 Ga0453684_0000334 Ga0453684_0000334_185120_185818 228
102 3300049531 Ga0501315_009425 Ga0501315_009425_176_880 228
103 3300053080 Ga0500635_0001679 Ga0500635_0001679_640_1326 228
104 iso_pu_bacteria 2738541278 2738730375 228
105 3300003320 rootH2_10019768 rootH2_100197682 229
106 3300004803 Ga0058862_10004171 Ga0058862_100041713 229
107 3300005327 Ga0070658_10006003 Ga0070658_100060033 229
108 3300005458 Ga0070681_10008484 Ga0070681_1000848414 229
109 3300005530 Ga0070679_100006892 Ga0070679_10000689210 229
110 3300005616 Ga0068852_100051838 Ga0068852_1000518384 229
111 3300025912 Ga0207707_10011302 Ga0207707_1001130212 229
112 3300025921 Ga0207652_10006998 Ga0207652_1000699813 229
113 3300026142 Ga0207698_10039561 Ga0207698_100395614 229
114 3300028794 Ga0307515_10228727 Ga0307515_102287272 229
115 3300046471 Ga0495650_0134329 Ga0495650_0134329_78_770 229
116 3300046507 Ga0495606_0054667 Ga0495606_0054667_979_1671 229
117 3300046665 Ga0495661_0067169 Ga0495661_0067169_836_1549 229
118 3300046810 Ga0495660_0080725 Ga0495660_0080725_547_1239 229
119 3300049705 Ga0501225_0001638 Ga0501225_0001638_2656_3348 229
120 3300002067 JGI24735J21928_10000010 JGI24735J21928_10000010133 230
121 3300005563 Ga0068855_100169804 Ga0068855_1001698043 230
122 3300006195 Ga0075366_10021868 Ga0075366_100218682 230
123 3300009147 Ga0114129_10009940 Ga0114129_100099408 230
124 3300009545 Ga0105237_10137717 Ga0105237_101377174 230
125 3300010375 Ga0105239_10148231 Ga0105239_101482313 230
126 3300013102 Ga0157371_10003584 Ga0157371_100035847 230
127 3300013102 Ga0157371_10012803 Ga0157371_100128035 230
128 3300013104 Ga0157370_10070315 Ga0157370_100703152 230
129 3300013105 Ga0157369_10003510 Ga0157369_1000351014 230
130 3300013105 Ga0157369_10328614 Ga0157369_103286143 230
131 3300013307 Ga0157372_10000029 Ga0157372_1000002943 230
132 3300013307 Ga0157372_10001626 Ga0157372_1000162621 230
133 3300013307 Ga0157372_10357443 Ga0157372_103574432 230
134 3300020070 Ga0206356_11639496 Ga0206356_116394962 230
135 3300026067 Ga0207678_10020654 Ga0207678_100206546 230
136 3300031456 Ga0307513_10440993 Ga0307513_104409932 230
137 3300031548 Ga0307408_100000524 Ga0307408_10000052431 230
138 3300031731 Ga0307405_10404306 Ga0307405_104043061 230
139 3300037312 Ga0395899_0000024 Ga0395899_0000024_86040_86735 230
140 3300037312 Ga0395899_0191278 Ga0395899_0191278_145_852 230
141 3300037418 Ga0395900_0086998 Ga0395900_0086998_2113_2808 230
142 3300038443 Ga0395901_0918921 Ga0395901_0918921_96_791 230
143 3300042014 Ga0439457_010301 Ga0439457_010301_403_1098 230
144 3300046471 Ga0495650_0000025 Ga0495650_0000025_437678_438373 230
145 3300046512 Ga0495610_0030809 Ga0495610_0030809_1906_2601 230
146 3300049129 Ga0501309_012540 Ga0501309_012540_42_740 230
147 3300049130 Ga0501310_025132 Ga0501310_025132_37_735 230
148 3300049161 Ga0501305_037983 Ga0501305_037983_43_741 230
149 3300049534 Ga0501318_027078 Ga0501318_027078_20_718 230
150 3300049537 Ga0501321_007188 Ga0501321_007188_375_1073 230
151 3300050493 nmdc:mga0k408_428891_c1 nmdc:mga0k408_428891_c1_33_746 230
152 3300050493 nmdc:mga0k408_6991_c2 nmdc:mga0k408_6991_c2_1107_1802 230
153 3300050507 nmdc:mga05p37_8925_c1 nmdc:mga05p37_8925_c1_37_750 230
154 3300053098 Ga0500650_0106386 Ga0500650_0106386_555_1268 230
155 3300003316 rootH1_10073454 rootH1_100734547 231
156 3300003322 rootL2_10030402 rootL2_100304022 231
157 3300003322 rootL2_10164408 rootL2_101644082 231
158 3300013307 Ga0157372_10028963 Ga0157372_100289634 231
159 3300020069 Ga0197907_11325599 Ga0197907_113255991 231
160 3300020070 Ga0206356_11724153 Ga0206356_117241532 231
161 3300020075 Ga0206349_1787364 Ga0206349_17873642 231
162 3300020076 Ga0206355_1000653 Ga0206355_10006531 231
163 3300020077 Ga0206351_10287394 Ga0206351_102873942 231
164 3300020080 Ga0206350_11613328 Ga0206350_116133282 231
165 3300020081 Ga0206354_11310547 Ga0206354_113105472 231
166 3300020082 Ga0206353_11955577 Ga0206353_119555771 231
167 3300020610 Ga0154015_1190472 Ga0154015_11904722 231
168 3300022467 Ga0224712_10009140 Ga0224712_100091402 231
169 3300032004 Ga0307414_10488083 Ga0307414_104880831 231
170 3300041406 Ga0439439_0023008 Ga0439439_0023008_20_721 231
171 3300046471 Ga0495650_0099648 Ga0495650_0099648_53_751 231
172 3300046506 Ga0495583_0108245 Ga0495583_0108245_444_1142 231
173 3300053086 Ga0500578_0018367 Ga0500578_0018367_1695_2393 231
174 3300002741 JGI25157J39369_1003116 JGI25157J39369_10031162 232
175 3300005329 Ga0070683_100006565 Ga0070683_1000065657 232
176 3300005339 Ga0070660_100068098 Ga0070660_1000680982 232
177 3300005366 Ga0070659_100000383 Ga0070659_1000003835 232
178 3300005563 Ga0068855_100000019 Ga0068855_100000019131 232
179 3300005563 Ga0068855_100014155 Ga0068855_1000141558 232
180 3300005563 Ga0068855_100642732 Ga0068855_1006427321 232
181 3300005614 Ga0068856_100020757 Ga0068856_1000207576 232
182 3300005614 Ga0068856_100211627 Ga0068856_1002116272 232
183 3300005840 Ga0068870_10245167 Ga0068870_102451672 232
184 3300009093 Ga0105240_10005142 Ga0105240_1000514214 232
185 3300009174 Ga0105241_10025751 Ga0105241_100257515 232
186 3300009545 Ga0105237_10019239 Ga0105237_100192394 232
187 3300010375 Ga0105239_10002202 Ga0105239_100022029 232
188 3300013100 Ga0157373_10000523 Ga0157373_100005238 232
189 3300013297 Ga0157378_10163014 Ga0157378_101630142 232
190 3300013307 Ga0157372_10000428 Ga0157372_1000042840 232
191 3300025250 Ga0209026_1000542 Ga0209026_10005428 232
192 3300025908 Ga0207643_10129134 Ga0207643_101291342 232
193 3300025909 Ga0207705_10059105 Ga0207705_100591053 232
194 3300025913 Ga0207695_10003855 Ga0207695_1000385514 232
195 3300025914 Ga0207671_10042559 Ga0207671_100425596 232
196 3300025919 Ga0207657_10073455 Ga0207657_100734553 232
197 3300025932 Ga0207690_10005836 Ga0207690_100058366 232
198 3300025944 Ga0207661_10232970 Ga0207661_102329702 232
199 3300025949 Ga0207667_10000020 Ga0207667_1000002038 232
200 3300025949 Ga0207667_10094980 Ga0207667_100949806 232
201 3300025949 Ga0207667_10144159 Ga0207667_101441592 232
202 3300026078 Ga0207702_10036722 Ga0207702_100367222 232
203 3300026116 Ga0207674_10019805 Ga0207674_100198055 232
204 3300031911 Ga0307412_10006747 Ga0307412_100067478 232
205 3300044693 Ga0466961_0104562 Ga0466961_0104562_484_1188 232
206 3300044719 Ga0466971_0137529 Ga0466971_0137529_272_976 232
207 3300044719 Ga0466971_0160364 Ga0466971_0160364_115_825 232
208 3300049571 Ga0501034_0360511 Ga0501034_0360511_319_1020 232
209 3300049581 Ga0501047_0131792 Ga0501047_0131792_36_740 232
210 3300049581 Ga0501047_0190219 Ga0501047_0190219_330_1031 232
211 3300049581 Ga0501047_0252611 Ga0501047_0252611_728_1432 232
212 3300049823 Ga0501044_0001783 Ga0501044_0001783_15948_16649 232
213 3300003322 rootL2_10099137 rootL2_100991373 233
214 3300003323 rootH1_10001388 rootH1_1000138810 233
215 3300005455 Ga0070663_100004677 Ga0070663_1000046775 233
216 3300005471 Ga0070698_100419905 Ga0070698_1004199052 233
217 3300005563 Ga0068855_100004959 Ga0068855_1000049595 233
218 3300013102 Ga0157371_10003198 Ga0157371_100031987 233
219 3300013105 Ga0157369_10000940 Ga0157369_1000094020 233
220 3300013307 Ga0157372_10000050 Ga0157372_10000050137 233
221 3300020077 Ga0206351_10729834 Ga0206351_107298342 233
222 3300020610 Ga0154015_1344955 Ga0154015_13449552 233
223 3300022467 Ga0224712_10004597 Ga0224712_100045972 233
224 3300025949 Ga0207667_10005185 Ga0207667_100051859 233
225 3300026067 Ga0207678_10014560 Ga0207678_100145605 233
226 3300031456 Ga0307513_10034037 Ga0307513_100340378 233
227 3300031548 Ga0307408_100001832 Ga0307408_1000018322 233
228 3300037312 Ga0395899_0000382 Ga0395899_0000382_863_1564 233
229 3300041512 Ga0451853_1966283 Ga0451853_1966283_187_891 233
230 3300044656 Ga0466969_0043635 Ga0466969_0043635_296_997 233
231 3300044658 Ga0466972_0000157 Ga0466972_0000157_23465_24169 233
232 3300044684 Ga0466966_0034758 Ga0466966_0034758_2134_2835 233
233 3300044706 Ga0466964_0027711 Ga0466964_0027711_255_977 233
234 3300044735 Ga0466968_0039524 Ga0466968_0039524_460_1164 233
235 3300044842 Ga0466957_0184318 Ga0466957_0184318_481_1188 233
236 3300045049 Ga0466959_0018912 Ga0466959_0018912_3999_4700 233
237 3300045836 Ga0466958_0102623 Ga0466958_0102623_928_1629 233
238 3300046474 Ga0495605_0023901 Ga0495605_0023901_260_961 233
239 3300046665 Ga0495661_0002095 Ga0495661_0002095_13174_13875 233
240 3300046684 Ga0495669_0067758 Ga0495669_0067758_318_1019 233
241 3300049161 Ga0501305_019161 Ga0501305_019161_194_901 233
242 3300049537 Ga0501321_000610 Ga0501321_000610_1458_2165 233
243 3300050493 nmdc:mga0k408_96539_c1 nmdc:mga0k408_96539_c1_201_905 233
244 3300053140 Ga0500573_0204981 Ga0500573_0204981_224_928 233
245 3300005327 Ga0070658_10207601 Ga0070658_102076012 234
246 3300005530 Ga0070679_100376147 Ga0070679_1003761472 234
247 3300005548 Ga0070665_100000072 Ga0070665_100000072104 234
248 3300005616 Ga0068852_100176704 Ga0068852_1001767041 234
249 3300009093 Ga0105240_10235715 Ga0105240_102357151 234
250 3300013104 Ga0157370_10715730 Ga0157370_107157302 234
251 3300013306 Ga0163162_10455527 Ga0163162_104555271 234
252 3300025909 Ga0207705_10495167 Ga0207705_104951672 234
253 3300025913 Ga0207695_10166868 Ga0207695_101668682 234
254 3300026142 Ga0207698_10592698 Ga0207698_105926981 234
255 3300028379 Ga0268266_10000089 Ga0268266_10000089102 234
256 3300037312 Ga0395899_0000001 Ga0395899_0000001_958016_958720 234
257 3300037418 Ga0395900_0000181 Ga0395900_0000181_29925_30629 234
258 3300045049 Ga0466959_0000005 Ga0466959_0000005_116361_117146 234
259 3300046523 Ga0495644_0029653 Ga0495644_0029653_1130_1834 234
260 3300047445 Ga0495677_0111694 Ga0495677_0111694_110_814 234
261 3300003323 rootH1_10138229 rootH1_101382292 235
262 3300005328 Ga0070676_10000846 Ga0070676_100008467 235
263 3300005338 Ga0068868_100003017 Ga0068868_1000030173 235
264 3300005364 Ga0070673_100034709 Ga0070673_1000347094 235
265 3300005365 Ga0070688_100185626 Ga0070688_1001856262 235
266 3300005456 Ga0070678_100009861 Ga0070678_1000098614 235
267 3300005459 Ga0068867_100009474 Ga0068867_1000094743 235
268 3300005539 Ga0068853_100043258 Ga0068853_1000432581 235
269 3300005616 Ga0068852_100021310 Ga0068852_1000213104 235
270 3300006237 Ga0097621_100010132 Ga0097621_1000101326 235
271 3300006358 Ga0068871_100001609 Ga0068871_10000160912 235
272 3300006881 Ga0068865_100006397 Ga0068865_1000063973 235
273 3300009176 Ga0105242_10109931 Ga0105242_101099312 235
274 3300009545 Ga0105237_10001732 Ga0105237_1000173212 235
275 3300013296 Ga0157374_10001744 Ga0157374_1000174413 235
276 3300013297 Ga0157378_10008719 Ga0157378_100087194 235
277 3300013297 Ga0157378_10055346 Ga0157378_100553463 235
278 3300021361 Ga0213872_10015047 Ga0213872_100150472 235
279 3300025907 Ga0207645_10005616 Ga0207645_100056164 235
280 3300025911 Ga0207654_10021599 Ga0207654_100215992 235
281 3300025914 Ga0207671_10187256 Ga0207671_101872562 235
282 3300025924 Ga0207694_10176074 Ga0207694_101760742 235
283 3300025938 Ga0207704_10000044 Ga0207704_1000004413 235
284 3300025960 Ga0207651_10016543 Ga0207651_100165435 235
285 3300026023 Ga0207677_10184584 Ga0207677_101845842 235
286 3300026041 Ga0207639_10111740 Ga0207639_101117403 235
287 3300026089 Ga0207648_10012072 Ga0207648_100120726 235
288 3300026142 Ga0207698_10033230 Ga0207698_100332302 235
289 3300037312 Ga0395899_0000532 Ga0395899_0000532_26911_27618 235
290 3300037418 Ga0395900_0000277 Ga0395900_0000277_3998_4705 235
291 3300037466 Ga0395898_0215292 Ga0395898_0215292_912_1619 235
292 3300037471 Ga0395905_0000068 Ga0395905_0000068_86561_87268 235
293 3300038443 Ga0395901_0000136 Ga0395901_0000136_17568_18275 235
294 3300039447 Ga0436361_1041094 Ga0436361_1041094_4400_5107 235
295 3300042005 Ga0439448_0004161 Ga0439448_0004161_2779_3486 235
296 3300009174 Ga0105241_10899054 Ga0105241_108990541 236
297 3300009545 Ga0105237_10119128 Ga0105237_101191283 236
298 3300025272 Ga0209455_1006473 Ga0209455_10064733 236
299 3300025911 Ga0207654_10352497 Ga0207654_103524971 236
300 3300025913 Ga0207695_10174376 Ga0207695_101743762 236
301 3300025914 Ga0207671_10115992 Ga0207671_101159921 236
302 iso_pu_bacteria 2599185184 2599477095 236
303 iso_pu_bacteria 2928078545 2928079008 236
304 iso_pu_bacteria 2928147474 2928148621 236
305 iso_pu_bacteria 2932082852 2932085657 236
306 3300005327 Ga0070658_10000018 Ga0070658_10000018150 237
307 3300005563 Ga0068855_100016538 Ga0068855_1000165386 237
308 3300006195 Ga0075366_10004860 Ga0075366_100048604 237
309 3300025909 Ga0207705_10000036 Ga0207705_1000003645 237
310 3300025914 Ga0207671_10082003 Ga0207671_100820031 237
311 3300025949 Ga0207667_10030950 Ga0207667_100309502 237
312 3300031507 Ga0307509_10013690 Ga0307509_100136906 237
313 3300046507 Ga0495606_0023883 Ga0495606_0023883_843_1562 237
314 3300050493 nmdc:mga0k408_4072_c1 nmdc:mga0k408_4072_c1_4506_5219 237
315 iso_pu_bacteria 2852623160 2852626941 237
316 iso_pu_bacteria 2884933994 2884938007 237
317 iso_pu_bacteria 2919437846 2919442214 237
318 iso_pu_bacteria 2977232053 2977236142 237
319 3300005530 Ga0070679_100109898 Ga0070679_1001098982 238
320 3300005563 Ga0068855_100216830 Ga0068855_1002168302 238
321 3300013296 Ga0157374_10069736 Ga0157374_100697363 238
322 3300025921 Ga0207652_10182822 Ga0207652_101828222 238
323 3300005339 Ga0070660_100091635 Ga0070660_1000916352 239
324 3300025250 Ga0209026_1001907 Ga0209026_10019075 239
325 3300025919 Ga0207657_10059885 Ga0207657_100598853 239
326 3300037312 Ga0395899_0114841 Ga0395899_0114841_1134_1874 239
327 3300037418 Ga0395900_0009024 Ga0395900_0009024_3620_4360 239
328 3300037466 Ga0395898_0086002 Ga0395898_0086002_1856_2596 239
329 3300037471 Ga0395905_0000826 Ga0395905_0000826_17149_17889 239
330 3300038443 Ga0395901_0021079 Ga0395901_0021079_848_1588 239
331 3300047472 Ga0495686_0020915 Ga0495686_0020915_3359_4084 239
332 3300050493 nmdc:mga0k408_328106_c1 nmdc:mga0k408_328106_c1_43_765 239
333 3300053156 Ga0500622_0000768 Ga0500622_0000768_4237_4962 239
334 3300001990 JGI24737J22298_10009123 JGI24737J22298_100091232 240
335 3300002067 JGI24735J21928_10000006 JGI24735J21928_10000006287 240
336 3300003316 rootH1_10016978 rootH1_100169783 240
337 3300003320 rootH2_10007103 rootH2_100071032 240
338 3300005288 Ga0065714_10028023 Ga0065714_100280231 240
339 3300005338 Ga0068868_100369997 Ga0068868_1003699971 240
340 3300005457 Ga0070662_100000225 Ga0070662_10000022516 240
341 3300006195 Ga0075366_10003099 Ga0075366_100030994 240
342 3300006353 Ga0075370_10085779 Ga0075370_100857791 240
343 3300009093 Ga0105240_10248916 Ga0105240_102489162 240
344 3300009174 Ga0105241_10001520 Ga0105241_1000152014 240
345 3300009545 Ga0105237_10007877 Ga0105237_100078775 240
346 3300009545 Ga0105237_10164972 Ga0105237_101649722 240
347 3300009551 Ga0105238_10050190 Ga0105238_100501903 240
348 3300010375 Ga0105239_10005928 Ga0105239_100059281 240
349 3300010375 Ga0105239_10009733 Ga0105239_100097333 240
350 3300010375 Ga0105239_10522471 Ga0105239_105224712 240
351 3300013102 Ga0157371_10201098 Ga0157371_102010981 240
352 3300013105 Ga0157369_10018366 Ga0157369_100183664 240
353 3300013105 Ga0157369_10178124 Ga0157369_101781242 240
354 3300013105 Ga0157369_10667719 Ga0157369_106677191 240
355 3300013307 Ga0157372_10013281 Ga0157372_100132819 240
356 3300014745 Ga0157377_10038270 Ga0157377_100382703 240
357 3300020069 Ga0197907_10578831 Ga0197907_105788312 240
358 3300020077 Ga0206351_10137770 Ga0206351_101377702 240
359 3300020078 Ga0206352_11144798 Ga0206352_111447983 240
360 3300020080 Ga0206350_11566577 Ga0206350_115665772 240
361 3300020081 Ga0206354_10800238 Ga0206354_108002383 240
362 3300022467 Ga0224712_10005032 Ga0224712_100050322 240
363 3300025904 Ga0207647_10000058 Ga0207647_1000005870 240
364 3300025911 Ga0207654_10001520 Ga0207654_100015203 240
365 3300025911 Ga0207654_10047065 Ga0207654_100470652 240
366 3300025913 Ga0207695_10000048 Ga0207695_100000484 240
367 3300025913 Ga0207695_10004800 Ga0207695_1000480012 240
368 3300025913 Ga0207695_10123216 Ga0207695_101232163 240
369 3300025914 Ga0207671_10000300 Ga0207671_1000030064 240
370 3300025914 Ga0207671_10002295 Ga0207671_1000229514 240
371 3300025914 Ga0207671_10071774 Ga0207671_100717741 240
372 3300025933 Ga0207706_10000317 Ga0207706_1000031730 240
373 3300025933 Ga0207706_10502005 Ga0207706_105020052 240
374 3300028786 Ga0307517_10005628 Ga0307517_1000562814 240
375 3300028794 Ga0307515_10000235 Ga0307515_100002354 240
376 3300028794 Ga0307515_10003393 Ga0307515_100033939 240
377 3300031911 Ga0307412_10010369 Ga0307412_100103692 240
378 3300033179 Ga0307507_10003315 Ga0307507_1000331510 240
379 3300033180 Ga0307510_10002378 Ga0307510_100023783 240
380 3300046459 Ga0495629_0167276 Ga0495629_0167276_247_1011 240
381 3300046471 Ga0495650_0000132 Ga0495650_0000132_19018_19743 240
382 3300046492 Ga0495585_0000399 Ga0495585_0000399_9176_9901 240
383 3300046492 Ga0495585_0003830 Ga0495585_0003830_4132_4896 240
384 3300046500 Ga0495596_0042318 Ga0495596_0042318_620_1345 240
385 3300046506 Ga0495583_0055536 Ga0495583_0055536_666_1391 240
386 3300046507 Ga0495606_0000100 Ga0495606_0000100_13018_13743 240
387 3300046507 Ga0495606_0063668 Ga0495606_0063668_1362_2087 240
388 3300046512 Ga0495610_0009003 Ga0495610_0009003_2716_3441 240
389 3300046513 Ga0495616_0003417 Ga0495616_0003417_4570_5295 240
390 3300046518 Ga0495631_0026209 Ga0495631_0026209_691_1416 240
391 3300046522 Ga0495643_0217615 Ga0495643_0217615_78_803 240
392 3300046524 Ga0495648_0007839 Ga0495648_0007839_1539_2303 240
393 3300046538 Ga0495609_0052655 Ga0495609_0052655_234_959 240
394 3300046557 Ga0495622_0005679 Ga0495622_0005679_3757_4521 240
395 3300046558 Ga0495633_0000101 Ga0495633_0000101_88165_89010 240
396 3300046558 Ga0495633_0000583 Ga0495633_0000583_18905_19630 240
397 3300046616 Ga0495668_0000010 Ga0495668_0000010_161961_162725 240
398 3300046616 Ga0495668_0054631 Ga0495668_0054631_452_1177 240
399 3300046616 Ga0495668_0123724 Ga0495668_0123724_343_1068 240
400 3300046660 Ga0495625_0000036 Ga0495625_0000036_148670_149395 240
401 3300046660 Ga0495625_0000282 Ga0495625_0000282_44828_45592 240
402 3300046660 Ga0495625_0009053 Ga0495625_0009053_7058_7780 240
403 3300046665 Ga0495661_0032461 Ga0495661_0032461_47_772 240
404 3300046683 Ga0495658_0037901 Ga0495658_0037901_81_845 240
405 3300046691 Ga0495670_0031141 Ga0495670_0031141_66_830 240
406 3300046694 Ga0495649_0000017 Ga0495649_0000017_72321_73046 240
407 3300046694 Ga0495649_0032433 Ga0495649_0032433_602_1327 240
408 3300046810 Ga0495660_0026050 Ga0495660_0026050_1520_2245 240
409 3300047323 Ga0495683_0044496 Ga0495683_0044496_348_1073 240
410 3300047443 Ga0495687_002159 Ga0495687_002159_11216_11938 240
411 3300047443 Ga0495687_002329 Ga0495687_002329_6772_7497 240
412 3300047472 Ga0495686_0187894 Ga0495686_0187894_125_859 240
413 3300047472 Ga0495686_0213995 Ga0495686_0213995_147_872 240
414 3300049460 Ga0495682_0055251 Ga0495682_0055251_382_1146 240
415 3300050493 nmdc:mga0k408_959_c1 nmdc:mga0k408_959_c1_10448_11176 240
416 3300050496 nmdc:mga07m45_52870_c1 nmdc:mga07m45_52870_c1_1403_2131 240
417 3300053122 Ga0500608_000615 Ga0500608_000615_2411_3136 240
418 3300053122 Ga0500608_027921 Ga0500608_027921_359_1084 240
419 3300053123 Ga0500614_002110 Ga0500614_002110_2060_2824 240
420 3300053125 Ga0500618_000013 Ga0500618_000013_160053_160814 240
421 3300053156 Ga0500622_0103468 Ga0500622_0103468_42_767 240
422 3300002737 JGI25162J39368_1000089 JGI25162J39368_100008988 241
423 3300005288 Ga0065714_10067103 Ga0065714_100671031 241
424 3300005288 Ga0065714_10077211 Ga0065714_100772112 241
425 3300005578 Ga0068854_100063761 Ga0068854_1000637612 241
426 3300009545 Ga0105237_10379835 Ga0105237_103798352 241
427 3300009545 Ga0105237_10380889 Ga0105237_103808892 241
428 3300010375 Ga0105239_10000132 Ga0105239_1000013285 241
429 3300010375 Ga0105239_10002156 Ga0105239_1000215616 241
430 3300017792 Ga0163161_10038390 Ga0163161_100383902 241
431 3300025233 Ga0209437_100221 Ga0209437_10022119 241
432 3300025258 Ga0209129_1009003 Ga0209129_10090032 241
433 3300025914 Ga0207671_10012840 Ga0207671_100128407 241
434 3300025949 Ga0207667_10306588 Ga0207667_103065882 241
435 3300025981 Ga0207640_10050217 Ga0207640_100502172 241
436 3300046507 Ga0495606_0113647 Ga0495606_0113647_846_1574 241
437 3300046529 Ga0495652_0372357 Ga0495652_0372357_127_855 241
438 3300046660 Ga0495625_0024910 Ga0495625_0024910_415_1143 241
439 3300046660 Ga0495625_0052495 Ga0495625_0052495_1010_1741 241
440 3300046692 Ga0495671_0025856 Ga0495671_0025856_2239_2964 241
441 3300047472 Ga0495686_0002715 Ga0495686_0002715_13971_14696 241
442 3300049758 Ga0501241_013947 Ga0501241_013947_582_1316 241
443 3300053153 Ga0500616_0104100 Ga0500616_0104100_169_897 241
444 3300053157 Ga0500624_001016 Ga0500624_001016_1309_2034 241
445 3300001904 JGI24736J21556_1004490 JGI24736J21556_10044902 242
446 3300002067 JGI24735J21928_10063456 JGI24735J21928_100634561 242
447 3300002772 JGI25164J39214_1002272 JGI25164J39214_10022722 242
448 3300005577 Ga0068857_100031653 Ga0068857_1000316532 242
449 3300009093 Ga0105240_10134573 Ga0105240_101345732 242
450 3300010375 Ga0105239_10004736 Ga0105239_100047361 242
451 3300013100 Ga0157373_10016462 Ga0157373_100164623 242
452 3300013102 Ga0157371_10000251 Ga0157371_1000025122 242
453 3300013104 Ga0157370_10074388 Ga0157370_100743882 242
454 3300013105 Ga0157369_10425954 Ga0157369_104259541 242
455 3300013307 Ga0157372_10000266 Ga0157372_1000026613 242
456 3300025230 Ga0209563_109182 Ga0209563_1091822 242
457 3300025231 Ga0207427_100125 Ga0207427_1001252 242
458 3300025233 Ga0209437_100008 Ga0209437_100008534 242
459 3300025250 Ga0209026_1004842 Ga0209026_10048421 242
460 3300025261 Ga0209233_1000024 Ga0209233_1000024123 242
461 3300025904 Ga0207647_10006410 Ga0207647_100064102 242
462 3300025932 Ga0207690_10003029 Ga0207690_100030293 242
463 3300026116 Ga0207674_10041090 Ga0207674_100410903 242
464 3300038443 Ga0395901_0027635 Ga0395901_0027635_3683_4411 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00574

CLP_protease

Clp protease

96

278

0.98

Feature Viewer

pLDDT pTM Quality
59.64 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map