F449362

General Info

Members Datasets Scaffolds Average Seq Length
464 215 928 319

Family's Representative Sequence

Representative Sequence 3300046558|Ga0495633_0000103|Ga0495633_0000103_78607_79680
Length 357
Sequence MTKTGMTDFLILSSQHLYLHANTVMKKNISVKPVSLLACLFFCTVGTTTLSANNSSVDTTIYADSNPIIKHKYTADPAALVYNGKVYLYSGHDEAIPPKEGYVMHEWLCFSSSDMTTWTEHPSPLNVKAFSWAKDDAWASQVIHRNNKFYWYVAVQHNSIPGKAIGVAVSDSPTGPFKDARGSALITNDMTLDTKISWDDIDPTVFIDDNGQAYLYWGNTICYYAKLKENMTELDGPIHTVPLKDFTEAPWIHKHKNWYYLSYASSFPEKIVYAMSRSIEGPWEYKGILNEVAGNSNTNHQAIIDFKGKSYFIYHNGSIPTAGGSYRRSVCIDYLYYNPDGTMKRVVMTTEGVKTVK

Samples

Sample ID Description Type Environment
1 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
28 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
29 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
30 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
44 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
45 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
48 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
50 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
51 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
52 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
53 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
56 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
78 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
79 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
89 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
90 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
91 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
92 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
93 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
98 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
103 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
104 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
105 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
109 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
110 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
111 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
112 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
113 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
114 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
117 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
118 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
119 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
120 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
124 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
125 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
128 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
131 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
136 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
137 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
138 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
139 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
140 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
141 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
142 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
143 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
146 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
149 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
150 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
151 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
152 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
164 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
165 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
166 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
169 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
170 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
171 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
172 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
173 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
174 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
175 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
176 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
177 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
178 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
179 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
180 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
181 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
182 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
183 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
184 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
185 2643221556 Massilia sp. Root1485 Isolate Unclassified
186 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
187 2643221684 Massilia sp. Root133 Isolate Unclassified
188 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
189 2738541283 Pedobacter sp. OK701 Isolate Unclassified
190 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
191 2738541297 Duganella sp. GV083 Isolate Unclassified
192 2738541357 Duganella sp. GV053 Isolate Unclassified
193 2738543003 Duganella sp. GV066 Isolate Unclassified
194 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
195 2738543023 Pedobacter sp. OK628 Isolate Unclassified
196 2738543026 Duganella sp. GV089 Isolate Unclassified
197 2738543029 Duganella sp. GV039 Isolate Unclassified
198 2739367656 Pedobacter sp. CF523 Isolate Unclassified
199 2739367663 Pedobacter sp. YR510 Isolate Unclassified
200 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
201 2842711865 Duganella sp. R-73148 Isolate Unclassified
202 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
203 2857553236 Duganella sp. R-74557 Isolate Unclassified
204 2857564685 Duganella sp. R-74599 Isolate Unclassified
205 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
206 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
207 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
208 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
209 2904424332 Duganella sp. 1411 Isolate Rhizosphere
210 2914759650 Rhizosphaericola mali Isolate Rhizosphere
211 2919476304 Duganella sp. 3397 Isolate Unclassified
212 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
213 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
214 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
215 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.89
Metatranscriptomes 0
Isolates 7.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.34
Nodule 0.65
Rhizoplane 2.37
Rhizosphere 75
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495633_0000103 3300046558 Bacteria 114769
2 JGI25152J39213_1000123 3300002773 Bacteria 53207
3 JGI25150J39212_1000002 3300002774 Bacteria 537631
4 JGI25150J39212_1004020 3300002774 Bacteria 3338
5 JGI25151J46595_10000003 3300003187 Bacteria 715330
6 JGI25153J46596_10000003 3300003215 Bacteria 553253
7 JGI25153J46596_10044922 3300003215 Bacteria 1323
8 rootH1_10037490 3300003316 Bacteria 4070
9 rootH2_10070538 3300003320 Bacteria 2883
10 rootL2_10053663 3300003322 Bacteria 2134
11 rootH1_10012160 3300003323 Bacteria 5089
12 rootH1_10066160 3300003323 Bacteria 1182
13 rootH1_10372807 3300003323 Bacteria 1709
14 Ga0055525_1000006 3300003759 Bacteria 642912
15 Ga0055529_1000032 3300003763 Bacteria 255895
16 Ga0055526_1000018 3300003771 Bacteria 198838
17 Ga0055526_1000053 3300003771 Bacteria 114820
18 Ga0055524_1000117 3300003775 Bacteria 93643
19 Ga0055524_1010128 3300003775 Bacteria 3776
20 Ga0055531_10007937 3300003794 Bacteria 5691
21 Ga0065165_1001148 3300005262 Bacteria 30990
22 Ga0065714_10129780 3300005288 Bacteria 1261
23 Ga0070658_10194266 3300005327 Bacteria 1711
24 Ga0070658_10303088 3300005327 Bacteria 1362
25 Ga0070660_100021556 3300005339 Bacteria 4754
26 Ga0070660_100022811 3300005339 Bacteria 4635
27 Ga0070659_100000100 3300005366 Bacteria 63786
28 Ga0070659_100048416 3300005366 Bacteria 3339
29 Ga0068855_100046437 3300005563 Bacteria 5134
30 Ga0068855_100456097 3300005563 Bacteria 1394
31 Ga0068856_100039759 3300005614 Bacteria 4618
32 Ga0068852_100064530 3300005616 Bacteria 3192
33 Ga0097621_100011021 3300006237 Bacteria 6643
34 Ga0075370_10035845 3300006353 Bacteria 2786
35 Ga0068871_100061566 3300006358 Bacteria 3066
36 Ga0068865_100129450 3300006881 Bacteria 1889
37 Ga0099824_1042644 3300006942 Unclassified 1036
38 Ga0099823_1004640 3300006944 Bacteria 13498
39 Ga0079104_1012985 3300006946 Bacteria 2589
40 Ga0105244_10000054 3300009036 Bacteria 133715
41 Ga0105244_10002743 3300009036 Bacteria 13142
42 Ga0105244_10020002 3300009036 Bacteria 3722
43 Ga0105244_10032373 3300009036 Bacteria 2768
44 Ga0105243_10097085 3300009148 Bacteria 2439
45 Ga0105241_10045454 3300009174 Bacteria 3332
46 Ga0105242_10053440 3300009176 Bacteria 3298
47 Ga0105242_10093241 3300009176 Bacteria 2538
48 Ga0157319_1000026 3300012497 Bacteria 63349
49 Ga0157373_10002256 3300013100 Bacteria 14605
50 Ga0157371_10000014 3300013102 Bacteria 347490
51 Ga0157371_10182386 3300013102 Unclassified 1501
52 Ga0157370_10013430 3300013104 Bacteria 8436
53 Ga0157370_10014601 3300013104 Bacteria 8026
54 Ga0157369_10001134 3300013105 Bacteria 33314
55 Ga0157369_10206748 3300013105 Bacteria 2059
56 Ga0157378_10015102 3300013297 Bacteria 6760
57 Ga0163162_10396344 3300013306 Bacteria 1513
58 Ga0157372_10000099 3300013307 Bacteria 89946
59 Ga0157372_10082994 3300013307 Bacteria 3629
60 Ga0157372_10097316 3300013307 Bacteria 3356
61 Ga0182008_10015609 3300014497 Bacteria 3959
62 Ga0182006_1000007 3300015261 Bacteria 452190
63 Ga0182006_1000040 3300015261 Bacteria 209209
64 Ga0182006_1000080 3300015261 Bacteria 122163
65 Ga0182007_10000120 3300015262 Bacteria 54341
66 Ga0182005_1000010 3300015265 Bacteria 434103
67 Ga0182005_1000051 3300015265 Bacteria 114808
68 Ga0163161_10003856 3300017792 Bacteria 10514
69 Ga0163161_10009421 3300017792 Bacteria 6757
70 Ga0213872_10033396 3300021361 Bacteria 2357
71 Ga0209563_100022 3300025230 Bacteria 643318
72 Ga0209437_102557 3300025233 Bacteria 3502
73 Ga0207425_1000004 3300025245 Bacteria 1092421
74 Ga0207425_1000326 3300025245 Bacteria 33697
75 Ga0209646_1000051 3300025246 Bacteria 296525
76 Ga0209026_1000762 3300025250 Bacteria 18053
77 Ga0209677_107524 3300025253 Bacteria 2292
78 Ga0209148_1000678 3300025254 Bacteria 28482
79 Ga0209129_1000005 3300025258 Bacteria 777812
80 Ga0209455_1000043 3300025272 Bacteria 413928
81 Ga0209673_1003819 3300025273 Bacteria 8534
82 Ga0209673_1013141 3300025273 Bacteria 3288
83 Ga0209130_1000078 3300025284 Bacteria 169374
84 Ga0209025_1000009 3300025294 Bacteria 1092561
85 Ga0209025_1001273 3300025294 Bacteria 34682
86 Ga0209564_1000011 3300025295 Bacteria 822327
87 Ga0209564_1000068 3300025295 Bacteria 311171
88 Ga0209758_1000010 3300025297 Bacteria 1092782
89 Ga0209758_1000568 3300025297 Bacteria 57997
90 Ga0209256_1000075 3300025299 Bacteria 236149
91 Ga0209256_1000267 3300025299 Bacteria 92278
92 Ga0209256_1037285 3300025299 Bacteria 1268
93 Ga0209051_1004058 3300025303 Bacteria 9230
94 Ga0209257_1000244 3300025304 Bacteria 126098
95 Ga0209257_1003739 3300025304 Bacteria 12616
96 Ga0207655_1000003 3300025728 Bacteria 1081376
97 Ga0207655_1003729 3300025728 Bacteria 11186
98 Ga0207655_1018587 3300025728 Bacteria 3677
99 Ga0207655_1057721 3300025728 Bacteria 1522
100 Ga0207705_10005752 3300025909 Bacteria 9252
101 Ga0207705_10163296 3300025909 Bacteria 1674
102 Ga0207654_10118734 3300025911 Bacteria 1657
103 Ga0207657_10025414 3300025919 Bacteria 5462
104 Ga0207657_10029637 3300025919 Bacteria 4979
105 Ga0207657_10087231 3300025919 Bacteria 2611
106 Ga0207690_10000609 3300025932 Bacteria 23117
107 Ga0207690_10032662 3300025932 Bacteria 3341
108 Ga0207686_10086728 3300025934 Bacteria 2057
109 Ga0207709_10029114 3300025935 Bacteria 3199
110 Ga0207704_10109272 3300025938 Bacteria 1865
111 Ga0207689_10532341 3300025942 Bacteria 986
112 Ga0207667_10283647 3300025949 Bacteria 1692
113 Ga0207667_10413266 3300025949 Bacteria 1373
114 Ga0207648_10213590 3300026089 Bacteria 1713
115 Ga0207648_10368154 3300026089 Bacteria 1298
116 Ga0207698_10110500 3300026142 Bacteria 2303
117 Ga0307515_10000007 3300028794 Bacteria 719669
118 Ga0307515_10017272 3300028794 Bacteria 13154
119 Ga0316177_1157343 3300030731 Bacteria 6045
120 Ga0316182_1168160 3300030745 Bacteria 1617
121 Ga0307408_100001079 3300031548 Bacteria 20870
122 Ga0307414_10004089 3300032004 Bacteria 7870
123 Ga0307510_10006279 3300033180 Bacteria 14175
124 Ga0395899_0000001 3300037312 Bacteria 1750322
125 Ga0395899_0000245 3300037312 Bacteria 72304
126 Ga0395899_0000315 3300037312 Bacteria 61724
127 Ga0395900_0000202 3300037418 Bacteria 93773
128 Ga0395900_0001818 3300037418 Bacteria 24409
129 Ga0395900_0005977 3300037418 Bacteria 12708
130 Ga0395900_0090199 3300037418 Bacteria 3150
131 Ga0395900_0148981 3300037418 Bacteria 2391
132 Ga0395900_0149960 3300037418 Bacteria 2382
133 Ga0395900_0172989 3300037418 Bacteria 2197
134 Ga0395900_0293331 3300037418 Bacteria 1614
135 Ga0395898_0436524 3300037466 Bacteria 1247
136 Ga0395905_0014150 3300037471 Bacteria 7623
137 Ga0395905_0224537 3300037471 Bacteria 1757
138 Ga0395901_0000019 3300038443 Bacteria 317063
139 Ga0395901_0002353 3300038443 Bacteria 19225
140 Ga0395901_0350500 3300038443 Bacteria 1523
141 Ga0395901_0377931 3300038443 Bacteria 1459
142 Ga0395901_0508601 3300038443 Bacteria 1225
143 Ga0436361_0441859 3300039447 Bacteria 17533
144 Ga0439448_0003221 3300042005 Bacteria 4505
145 Ga0439450_022102 3300042008 Bacteria 1371
146 Ga0466969_0009972 3300044656 Bacteria 5037
147 Ga0466972_0000017 3300044658 Bacteria 199884
148 Ga0466965_0008650 3300044683 Bacteria 4710
149 Ga0466965_0054971 3300044683 Bacteria 1980
150 Ga0466965_0167181 3300044683 Bacteria 1155
151 Ga0466966_0026820 3300044684 Bacteria 3759
152 Ga0466966_0030013 3300044684 Bacteria 3534
153 Ga0466961_0006446 3300044693 Bacteria 7453
154 Ga0466961_0117053 3300044693 Bacteria 1674
155 Ga0466963_0012720 3300044694 Bacteria 5155
156 Ga0466964_0001250 3300044706 Bacteria 8632
157 Ga0466968_0000207 3300044735 Bacteria 18092
158 Ga0466957_0001749 3300044842 Bacteria 11419
159 Ga0466957_0073547 3300044842 Bacteria 2118
160 Ga0466959_0051216 3300045049 Bacteria 3029
161 Ga0466959_0162763 3300045049 Bacteria 1568
162 Ga0466959_0269149 3300045049 Bacteria 1171
163 Ga0466967_0147943 3300045976 Bacteria 2192
164 Ga0466967_0358367 3300045976 Bacteria 1413
165 Ga0495617_000003 3300046452 Bacteria 541914
166 Ga0495627_000008 3300046453 Bacteria 572150
167 Ga0495627_000011 3300046453 Bacteria 354522
168 Ga0495627_020416 3300046453 Bacteria 2208
169 Ga0495603_0033801 3300046455 Bacteria 3076
170 Ga0495590_0000001 3300046457 Bacteria 762984
171 Ga0495590_0000512 3300046457 Bacteria 18985
172 Ga0495590_0007095 3300046457 Bacteria 4337
173 Ga0495638_0000017 3300046460 Bacteria 391117
174 Ga0495638_0011980 3300046460 Bacteria 5961
175 Ga0495638_0038606 3300046460 Bacteria 3033
176 Ga0495638_0093266 3300046460 Bacteria 1811
177 Ga0495638_0119826 3300046460 Bacteria 1556
178 Ga0495653_0000002 3300046463 Bacteria 507262
179 Ga0495653_0054284 3300046463 Bacteria 3062
180 Ga0495650_0000001 3300046471 Bacteria 1085492
181 Ga0495650_0000072 3300046471 Bacteria 257886
182 Ga0495650_0000434 3300046471 Bacteria 67282
183 Ga0495650_0001400 3300046471 Bacteria 23592
184 Ga0495650_0005904 3300046471 Bacteria 7782
185 Ga0495650_0012300 3300046471 Bacteria 4611
186 Ga0495650_0014983 3300046471 Bacteria 4001
187 Ga0495605_0000065 3300046474 Bacteria 139441
188 Ga0495605_0000103 3300046474 Bacteria 105879
189 Ga0495605_0010428 3300046474 Bacteria 5198
190 Ga0495605_0014301 3300046474 Bacteria 4349
191 Ga0495605_0027683 3300046474 Bacteria 2935
192 Ga0495605_0053979 3300046474 Bacteria 1948
193 Ga0495584_0000182 3300046491 Bacteria 44393
194 Ga0495584_0000589 3300046491 Bacteria 24441
195 Ga0495584_0006047 3300046491 Bacteria 6375
196 Ga0495584_0007217 3300046491 Bacteria 5798
197 Ga0495584_0057690 3300046491 Bacteria 1953
198 Ga0495584_0102756 3300046491 Bacteria 1445
199 Ga0495585_0000154 3300046492 Bacteria 73681
200 Ga0495585_0001370 3300046492 Bacteria 19288
201 Ga0495585_0017794 3300046492 Bacteria 4102
202 Ga0495585_0037212 3300046492 Bacteria 2741
203 Ga0495585_0038580 3300046492 Bacteria 2688
204 Ga0495585_0039203 3300046492 Bacteria 2663
205 Ga0495585_0066781 3300046492 Bacteria 1968
206 Ga0495585_0111266 3300046492 Bacteria 1456
207 Ga0495585_0156806 3300046492 Bacteria 1183
208 Ga0495596_0005761 3300046500 Bacteria 5810
209 Ga0495596_0007923 3300046500 Bacteria 4755
210 Ga0495607_0001832 3300046501 Bacteria 18116
211 Ga0495607_0002956 3300046501 Bacteria 13357
212 Ga0495607_0008276 3300046501 Bacteria 7116
213 Ga0495607_0018840 3300046501 Bacteria 4391
214 Ga0495607_0020760 3300046501 Bacteria 4144
215 Ga0495607_0087426 3300046501 Bacteria 1696
216 Ga0495607_0129276 3300046501 Bacteria 1316
217 Ga0495583_0000050 3300046506 Bacteria 213627
218 Ga0495583_0000250 3300046506 Bacteria 88815
219 Ga0495583_0002249 3300046506 Bacteria 16985
220 Ga0495583_0033367 3300046506 Bacteria 2476
221 Ga0495606_0000001 3300046507 Bacteria 592123
222 Ga0495606_0000030 3300046507 Bacteria 249484
223 Ga0495606_0007668 3300046507 Bacteria 9570
224 Ga0495606_0028869 3300046507 Bacteria 3905
225 Ga0495610_0000003 3300046512 Bacteria 1203910
226 Ga0495610_0000275 3300046512 Bacteria 53769
227 Ga0495610_0003187 3300046512 Bacteria 13002
228 Ga0495610_0005970 3300046512 Bacteria 8521
229 Ga0495610_0012792 3300046512 Bacteria 5021
230 Ga0495616_0000012 3300046513 Bacteria 211342
231 Ga0495616_0004620 3300046513 Bacteria 8640
232 Ga0495616_0018003 3300046513 Bacteria 3889
233 Ga0495616_0038695 3300046513 Bacteria 2447
234 Ga0495631_0000214 3300046518 Bacteria 39867
235 Ga0495631_0002741 3300046518 Bacteria 9762
236 Ga0495632_0000117 3300046519 Bacteria 81479
237 Ga0495632_0000151 3300046519 Bacteria 71855
238 Ga0495632_0000367 3300046519 Bacteria 42974
239 Ga0495632_0009091 3300046519 Bacteria 6015
240 Ga0495632_0078743 3300046519 Bacteria 1574
241 Ga0495637_0000042 3300046520 Bacteria 114979
242 Ga0495637_0045364 3300046520 Bacteria 1865
243 Ga0495643_0000028 3300046522 Bacteria 262886
244 Ga0495643_0000285 3300046522 Bacteria 72233
245 Ga0495643_0002743 3300046522 Bacteria 13531
246 Ga0495643_0010394 3300046522 Bacteria 5730
247 Ga0495643_0016884 3300046522 Bacteria 4280
248 Ga0495643_0098007 3300046522 Bacteria 1505
249 Ga0495643_0172550 3300046522 Bacteria 1056
250 Ga0495644_0019399 3300046523 Bacteria 2597
251 Ga0495644_0023527 3300046523 Bacteria 2345
252 Ga0495644_0048011 3300046523 Bacteria 1603
253 Ga0495648_0000001 3300046524 Bacteria 696872
254 Ga0495648_0001299 3300046524 Bacteria 24837
255 Ga0495648_0002750 3300046524 Bacteria 15879
256 Ga0495648_0003706 3300046524 Bacteria 13353
257 Ga0495648_0004046 3300046524 Bacteria 12657
258 Ga0495648_0004835 3300046524 Bacteria 11367
259 Ga0495648_0008621 3300046524 Bacteria 7997
260 Ga0495648_0022743 3300046524 Bacteria 4308
261 Ga0495648_0050683 3300046524 Bacteria 2534
262 Ga0495648_0053956 3300046524 Bacteria 2431
263 Ga0495642_0000091 3300046528 Bacteria 53133
264 Ga0495642_0001217 3300046528 Bacteria 11835
265 Ga0495642_0024534 3300046528 Bacteria 2386
266 Ga0495642_0031965 3300046528 Bacteria 2110
267 Ga0495654_0000037 3300046530 Bacteria 188218
268 Ga0495654_0032959 3300046530 Bacteria 2624
269 Ga0495654_0033389 3300046530 Bacteria 2605
270 Ga0495587_0045810 3300046536 Bacteria 2598
271 Ga0495609_0000026 3300046538 Bacteria 251973
272 Ga0495609_0000979 3300046538 Bacteria 20452
273 Ga0495609_0001294 3300046538 Bacteria 17071
274 Ga0495609_0033585 3300046538 Bacteria 2329
275 Ga0495597_0000314 3300046542 Bacteria 43625
276 Ga0495597_0000785 3300046542 Bacteria 25063
277 Ga0495597_0002465 3300046542 Bacteria 11695
278 Ga0495597_0007122 3300046542 Bacteria 5721
279 Ga0495597_0020310 3300046542 Bacteria 3095
280 Ga0495597_0021450 3300046542 Bacteria 3003
281 Ga0495597_0077676 3300046542 Bacteria 1422
282 Ga0495645_0136787 3300046543 Bacteria 1713
283 Ga0495622_0000001 3300046557 Bacteria 365248
284 Ga0495622_0000131 3300046557 Bacteria 64280
285 Ga0495622_0017966 3300046557 Bacteria 3294
286 Ga0495633_0000106 3300046558 Bacteria 113381
287 Ga0495633_0000675 3300046558 Bacteria 31481
288 Ga0495633_0022630 3300046558 Bacteria 3124
289 Ga0495633_0034438 3300046558 Bacteria 2436
290 Ga0495633_0054698 3300046558 Bacteria 1877
291 Ga0495656_0023597 3300046615 Bacteria 2422
292 Ga0495668_0000190 3300046616 Bacteria 91473
293 Ga0495668_0000666 3300046616 Bacteria 41285
294 Ga0495668_0000686 3300046616 Bacteria 40735
295 Ga0495668_0001174 3300046616 Bacteria 26668
296 Ga0495668_0001982 3300046616 Bacteria 17930
297 Ga0495668_0002092 3300046616 Bacteria 17268
298 Ga0495668_0002207 3300046616 Bacteria 16580
299 Ga0495668_0159284 3300046616 Bacteria 1236
300 Ga0495611_0000151 3300046648 Bacteria 49625
301 Ga0495625_0000035 3300046660 Bacteria 224323
302 Ga0495625_0000391 3300046660 Bacteria 66888
303 Ga0495625_0005884 3300046660 Bacteria 11043
304 Ga0495625_0032458 3300046660 Bacteria 3870
305 Ga0495625_0048352 3300046660 Bacteria 3063
306 Ga0495625_0153739 3300046660 Bacteria 1545
307 Ga0495661_0000408 3300046665 Bacteria 45688
308 Ga0495661_0003698 3300046665 Bacteria 11236
309 Ga0495661_0010298 3300046665 Bacteria 6385
310 Ga0495661_0012654 3300046665 Bacteria 5694
311 Ga0495661_0015295 3300046665 Bacteria 5122
312 Ga0495661_0025710 3300046665 Bacteria 3800
313 Ga0495661_0064420 3300046665 Bacteria 2162
314 Ga0495661_0138462 3300046665 Bacteria 1326
315 Ga0495661_0147323 3300046665 Bacteria 1274
316 Ga0495661_0172485 3300046665 Bacteria 1152
317 Ga0495661_0188850 3300046665 Bacteria 1086
318 Ga0495588_0000139 3300046674 Bacteria 109955
319 Ga0495669_0004286 3300046684 Bacteria 5884
320 Ga0495670_0020058 3300046691 Bacteria 3294
321 Ga0495671_0000010 3300046692 Bacteria 368641
322 Ga0495671_0004463 3300046692 Bacteria 8361
323 Ga0495671_0024354 3300046692 Bacteria 3152
324 Ga0495649_0002113 3300046694 Bacteria 14263
325 Ga0495649_0069162 3300046694 Bacteria 1894
326 Ga0495589_0000073 3300046794 Bacteria 94125
327 Ga0495589_0000100 3300046794 Bacteria 83307
328 Ga0495589_0012082 3300046794 Bacteria 4478
329 Ga0495660_0000027 3300046810 Bacteria 254331
330 Ga0495660_0000187 3300046810 Bacteria 66615
331 Ga0495660_0000335 3300046810 Bacteria 41632
332 Ga0495660_0000555 3300046810 Bacteria 30632
333 Ga0495660_0000752 3300046810 Bacteria 24444
334 Ga0495660_0004846 3300046810 Bacteria 8113
335 Ga0495660_0011293 3300046810 Bacteria 5186
336 Ga0495660_0016170 3300046810 Bacteria 4304
337 Ga0495660_0020359 3300046810 Bacteria 3802
338 Ga0495660_0021900 3300046810 Bacteria 3655
339 Ga0495660_0113468 3300046810 Bacteria 1380
340 Ga0495672_0000165 3300047320 Bacteria 96215
341 Ga0495672_0000400 3300047320 Bacteria 52696
342 Ga0495672_0045448 3300047320 Bacteria 2627
343 Ga0495680_0057298 3300047322 Bacteria 3014
344 Ga0495683_0014282 3300047323 Bacteria 4137
345 Ga0495683_0023605 3300047323 Bacteria 3160
346 Ga0495687_000012 3300047443 Bacteria 391586
347 Ga0495687_000037 3300047443 Bacteria 252363
348 Ga0495687_000122 3300047443 Bacteria 119372
349 Ga0495687_001008 3300047443 Bacteria 28121
350 Ga0495687_001859 3300047443 Bacteria 18393
351 Ga0495687_002318 3300047443 Bacteria 15517
352 Ga0495687_049876 3300047443 Bacteria 1787
353 Ga0495675_0048443 3300047444 Bacteria 2703
354 Ga0495677_0000014 3300047445 Bacteria 136236
355 Ga0495677_0002215 3300047445 Bacteria 7702
356 Ga0495677_0011273 3300047445 Bacteria 3272
357 Ga0495679_000603 3300047446 Bacteria 24373
358 Ga0495679_003356 3300047446 Bacteria 7730
359 Ga0495679_017325 3300047446 Bacteria 2582
360 Ga0495685_056855 3300047447 Bacteria 1322
361 Ga0495673_0000003 3300047469 Bacteria 1491337
362 Ga0495673_0000016 3300047469 Bacteria 580643
363 Ga0495673_0000035 3300047469 Bacteria 316861
364 Ga0495681_0000021 3300047470 Bacteria 166534
365 Ga0495681_0003295 3300047470 Bacteria 11254
366 Ga0495681_0003738 3300047470 Bacteria 10540
367 Ga0495681_0007118 3300047470 Bacteria 7210
368 Ga0495681_0054731 3300047470 Bacteria 1863
369 Ga0495686_0032283 3300047472 Bacteria 3390
370 Ga0495686_0213153 3300047472 Bacteria 1102
371 Ga0495626_0000222 3300048091 Bacteria 67304
372 Ga0495626_0003930 3300048091 Bacteria 9298
373 Ga0495626_0015346 3300048091 Bacteria 3925
374 Ga0495626_0023441 3300048091 Bacteria 3039
375 Ga0495626_0028683 3300048091 Bacteria 2696
376 Ga0495626_0030870 3300048091 Bacteria 2582
377 Ga0495626_0039987 3300048091 Bacteria 2216
378 Ga0495626_0066055 3300048091 Bacteria 1636
379 Ga0495626_0079461 3300048091 Bacteria 1459
380 Ga0496100_0321177 3300048903 Bacteria 1163
381 Ga0496103_0003052 3300048906 Bacteria 10295
382 Ga0496103_0072931 3300048906 Bacteria 2151
383 Ga0496105_0353669 3300048908 Bacteria 1173
384 Ga0496106_0007416 3300048909 Bacteria 8106
385 Ga0496107_0177834 3300048910 Bacteria 1580
386 Ga0496107_0185306 3300048910 Bacteria 1546
387 Ga0496109_0278338 3300048912 Bacteria 1577
388 Ga0496110_0000026 3300048913 Bacteria 71385
389 Ga0496113_0007190 3300048916 Bacteria 7135
390 Ga0496116_0026414 3300048919 Bacteria 4248
391 Ga0496117_0000005 3300048920 Bacteria 777468
392 Ga0496118_0000022 3300048921 Bacteria 438602
393 Ga0496119_0159158 3300048922 Bacteria 1203
394 Ga0496121_0011949 3300048924 Bacteria 9553
395 Ga0496121_0017125 3300048924 Bacteria 7425
396 Ga0496121_0083355 3300048924 Bacteria 2524
397 Ga0496122_0001081 3300048925 Bacteria 47312
398 Ga0496122_0016946 3300048925 Bacteria 6846
399 Ga0496122_0021359 3300048925 Bacteria 5798
400 Ga0496122_0042580 3300048925 Bacteria 3570
401 Ga0496123_0001385 3300048926 Bacteria 33978
402 Ga0496123_0003098 3300048926 Bacteria 19096
403 Ga0496123_0004351 3300048926 Bacteria 14974
404 Ga0496123_0041420 3300048926 Bacteria 3193
405 Ga0496124_0029154 3300048927 Bacteria 4923
406 Ga0496124_0038593 3300048927 Bacteria 4146
407 Ga0496124_0054723 3300048927 Bacteria 3376
408 Ga0496124_0112439 3300048927 Bacteria 2190
409 Ga0496124_0138455 3300048927 Bacteria 1924
410 Ga0496125_0070349 3300048928 Bacteria 2740
411 Ga0495678_000002 3300049459 Bacteria 999613
412 Ga0495678_000010 3300049459 Bacteria 357896
413 Ga0495678_000029 3300049459 Bacteria 219803
414 Ga0495678_000045 3300049459 Bacteria 171880
415 Ga0495678_001464 3300049459 Bacteria 18513
416 Ga0495678_008318 3300049459 Bacteria 5246
417 Ga0495682_0000082 3300049460 Bacteria 83453
418 Ga0495682_0002171 3300049460 Bacteria 9502
419 Ga0501249_000002 3300049679 Bacteria 262756
420 Ga0501249_001714 3300049679 Bacteria 4466
421 Ga0501269_000010 3300049766 Bacteria 70454
422 Ga0500644_0000021 3300053088 Bacteria 100777
423 Ga0500651_0026394 3300053093 Unclassified 3651
424 Ga0500641_0000142 3300053096 Bacteria 26342
425 Ga0500562_000033 3300053108 Bacteria 86295
426 Ga0500618_000068 3300053125 Bacteria 88668
427 Ga0500618_035483 3300053125 Bacteria 1158
428 Ga0500658_0000015 3300053134 Bacteria 151134
429 Ga0500586_000133 3300053145 Bacteria 13666
430 Ga0500586_053653 3300053145 Bacteria 1393
431 Ga0500584_017230 3300053726 Bacteria 3336
432 2601671300 2600255292 Bacteria 6300551
433 2643801485 2643221556 Bacteria 7251154
434 2644012070 2643221600 Bacteria 5530138
435 2644471453 2643221684 Bacteria 7145183
436 2738733850 2738541279 Bacteria 6149495
437 2738759337 2738541283 Bacteria 7222293
438 2738766193 2738541285 Bacteria 6150075
439 2738829899 2738541297 Bacteria 6549566
440 2739153695 2738541357 Bacteria 6549408
441 2739195615 2738543003 Bacteria 6549560
442 2739215431 2738543007 Bacteria 6149845
443 2739303194 2738543023 Bacteria 6767879
444 2739322091 2738543026 Bacteria 6549408
445 2739340332 2738543029 Bacteria 6549249
446 2739617141 2739367656 Bacteria 5152243
447 2739644649 2739367663 Bacteria 5040914
448 2833641822 2833640130 Bacteria 4858325
449 2842715533 2842711865 Bacteria 7155354
450 2857548860 2857547612 Bacteria 6179999
451 2857555910 2857553236 Bacteria 6166726
452 2857557819 2857553236 Bacteria 6166726
453 2857566922 2857564685 Bacteria 6290584
454 2857621450 2857618242 Bacteria 5635925
455 2881361500 2881359912 Bacteria 4935907
456 2885080341 2885080285 Bacteria 6355622
457 2886851939 2886848708 Bacteria 5632523
458 2904425705 2904424332 Bacteria 7633521
459 2914761378 2914759650 Bacteria 4701441
460 2919478244 2919476304 Bacteria 5888696
461 2932415443 2932410948 Bacteria 6312192
462 2932421396 2932416698 Bacteria 6315112
463 2958512636 2958512119 Bacteria 4528530
464 8047677211 8047673197 Bacteria 7395230
465 Ga0495633_0000103
466 JGI25152J39213_1000123
467 JGI25150J39212_1000002
468 JGI25150J39212_1004020
469 JGI25151J46595_10000003
470 JGI25153J46596_10000003
471 JGI25153J46596_10044922
472 rootH1_10037490
473 rootH2_10070538
474 rootL2_10053663
475 rootH1_10012160
476 rootH1_10066160
477 rootH1_10372807
478 Ga0055525_1000006
479 Ga0055529_1000032
480 Ga0055526_1000018
481 Ga0055526_1000053
482 Ga0055524_1000117
483 Ga0055524_1010128
484 Ga0055531_10007937
485 Ga0065165_1001148
486 Ga0065714_10129780
487 Ga0070658_10194266
488 Ga0070658_10303088
489 Ga0070660_100021556
490 Ga0070660_100022811
491 Ga0070659_100000100
492 Ga0070659_100048416
493 Ga0068855_100046437
494 Ga0068855_100456097
495 Ga0068856_100039759
496 Ga0068852_100064530
497 Ga0097621_100011021
498 Ga0075370_10035845
499 Ga0068871_100061566
500 Ga0068865_100129450
501 Ga0099824_1042644
502 Ga0099823_1004640
503 Ga0079104_1012985
504 Ga0105244_10000054
505 Ga0105244_10002743
506 Ga0105244_10020002
507 Ga0105244_10032373
508 Ga0105243_10097085
509 Ga0105241_10045454
510 Ga0105242_10053440
511 Ga0105242_10093241
512 Ga0157319_1000026
513 Ga0157373_10002256
514 Ga0157371_10000014
515 Ga0157371_10182386
516 Ga0157370_10013430
517 Ga0157370_10014601
518 Ga0157369_10001134
519 Ga0157369_10206748
520 Ga0157378_10015102
521 Ga0163162_10396344
522 Ga0157372_10000099
523 Ga0157372_10082994
524 Ga0157372_10097316
525 Ga0182008_10015609
526 Ga0182006_1000007
527 Ga0182006_1000040
528 Ga0182006_1000080
529 Ga0182007_10000120
530 Ga0182005_1000010
531 Ga0182005_1000051
532 Ga0163161_10003856
533 Ga0163161_10009421
534 Ga0213872_10033396
535 Ga0209563_100022
536 Ga0209437_102557
537 Ga0207425_1000004
538 Ga0207425_1000326
539 Ga0209646_1000051
540 Ga0209026_1000762
541 Ga0209677_107524
542 Ga0209148_1000678
543 Ga0209129_1000005
544 Ga0209455_1000043
545 Ga0209673_1003819
546 Ga0209673_1013141
547 Ga0209130_1000078
548 Ga0209025_1000009
549 Ga0209025_1001273
550 Ga0209564_1000011
551 Ga0209564_1000068
552 Ga0209758_1000010
553 Ga0209758_1000568
554 Ga0209256_1000075
555 Ga0209256_1000267
556 Ga0209256_1037285
557 Ga0209051_1004058
558 Ga0209257_1000244
559 Ga0209257_1003739
560 Ga0207655_1000003
561 Ga0207655_1003729
562 Ga0207655_1018587
563 Ga0207655_1057721
564 Ga0207705_10005752
565 Ga0207705_10163296
566 Ga0207654_10118734
567 Ga0207657_10025414
568 Ga0207657_10029637
569 Ga0207657_10087231
570 Ga0207690_10000609
571 Ga0207690_10032662
572 Ga0207686_10086728
573 Ga0207709_10029114
574 Ga0207704_10109272
575 Ga0207689_10532341
576 Ga0207667_10283647
577 Ga0207667_10413266
578 Ga0207648_10213590
579 Ga0207648_10368154
580 Ga0207698_10110500
581 Ga0307515_10000007
582 Ga0307515_10017272
583 Ga0316177_1157343
584 Ga0316182_1168160
585 Ga0307408_100001079
586 Ga0307414_10004089
587 Ga0307510_10006279
588 Ga0395899_0000001
589 Ga0395899_0000245
590 Ga0395899_0000315
591 Ga0395900_0000202
592 Ga0395900_0001818
593 Ga0395900_0005977
594 Ga0395900_0090199
595 Ga0395900_0148981
596 Ga0395900_0149960
597 Ga0395900_0172989
598 Ga0395900_0293331
599 Ga0395898_0436524
600 Ga0395905_0014150
601 Ga0395905_0224537
602 Ga0395901_0000019
603 Ga0395901_0002353
604 Ga0395901_0350500
605 Ga0395901_0377931
606 Ga0395901_0508601
607 Ga0436361_0441859
608 Ga0439448_0003221
609 Ga0439450_022102
610 Ga0466969_0009972
611 Ga0466972_0000017
612 Ga0466965_0008650
613 Ga0466965_0054971
614 Ga0466965_0167181
615 Ga0466966_0026820
616 Ga0466966_0030013
617 Ga0466961_0006446
618 Ga0466961_0117053
619 Ga0466963_0012720
620 Ga0466964_0001250
621 Ga0466968_0000207
622 Ga0466957_0001749
623 Ga0466957_0073547
624 Ga0466959_0051216
625 Ga0466959_0162763
626 Ga0466959_0269149
627 Ga0466967_0147943
628 Ga0466967_0358367
629 Ga0495617_000003
630 Ga0495627_000008
631 Ga0495627_000011
632 Ga0495627_020416
633 Ga0495603_0033801
634 Ga0495590_0000001
635 Ga0495590_0000512
636 Ga0495590_0007095
637 Ga0495638_0000017
638 Ga0495638_0011980
639 Ga0495638_0038606
640 Ga0495638_0093266
641 Ga0495638_0119826
642 Ga0495653_0000002
643 Ga0495653_0054284
644 Ga0495650_0000001
645 Ga0495650_0000072
646 Ga0495650_0000434
647 Ga0495650_0001400
648 Ga0495650_0005904
649 Ga0495650_0012300
650 Ga0495650_0014983
651 Ga0495605_0000065
652 Ga0495605_0000103
653 Ga0495605_0010428
654 Ga0495605_0014301
655 Ga0495605_0027683
656 Ga0495605_0053979
657 Ga0495584_0000182
658 Ga0495584_0000589
659 Ga0495584_0006047
660 Ga0495584_0007217
661 Ga0495584_0057690
662 Ga0495584_0102756
663 Ga0495585_0000154
664 Ga0495585_0001370
665 Ga0495585_0017794
666 Ga0495585_0037212
667 Ga0495585_0038580
668 Ga0495585_0039203
669 Ga0495585_0066781
670 Ga0495585_0111266
671 Ga0495585_0156806
672 Ga0495596_0005761
673 Ga0495596_0007923
674 Ga0495607_0001832
675 Ga0495607_0002956
676 Ga0495607_0008276
677 Ga0495607_0018840
678 Ga0495607_0020760
679 Ga0495607_0087426
680 Ga0495607_0129276
681 Ga0495583_0000050
682 Ga0495583_0000250
683 Ga0495583_0002249
684 Ga0495583_0033367
685 Ga0495606_0000001
686 Ga0495606_0000030
687 Ga0495606_0007668
688 Ga0495606_0028869
689 Ga0495610_0000003
690 Ga0495610_0000275
691 Ga0495610_0003187
692 Ga0495610_0005970
693 Ga0495610_0012792
694 Ga0495616_0000012
695 Ga0495616_0004620
696 Ga0495616_0018003
697 Ga0495616_0038695
698 Ga0495631_0000214
699 Ga0495631_0002741
700 Ga0495632_0000117
701 Ga0495632_0000151
702 Ga0495632_0000367
703 Ga0495632_0009091
704 Ga0495632_0078743
705 Ga0495637_0000042
706 Ga0495637_0045364
707 Ga0495643_0000028
708 Ga0495643_0000285
709 Ga0495643_0002743
710 Ga0495643_0010394
711 Ga0495643_0016884
712 Ga0495643_0098007
713 Ga0495643_0172550
714 Ga0495644_0019399
715 Ga0495644_0023527
716 Ga0495644_0048011
717 Ga0495648_0000001
718 Ga0495648_0001299
719 Ga0495648_0002750
720 Ga0495648_0003706
721 Ga0495648_0004046
722 Ga0495648_0004835
723 Ga0495648_0008621
724 Ga0495648_0022743
725 Ga0495648_0050683
726 Ga0495648_0053956
727 Ga0495642_0000091
728 Ga0495642_0001217
729 Ga0495642_0024534
730 Ga0495642_0031965
731 Ga0495654_0000037
732 Ga0495654_0032959
733 Ga0495654_0033389
734 Ga0495587_0045810
735 Ga0495609_0000026
736 Ga0495609_0000979
737 Ga0495609_0001294
738 Ga0495609_0033585
739 Ga0495597_0000314
740 Ga0495597_0000785
741 Ga0495597_0002465
742 Ga0495597_0007122
743 Ga0495597_0020310
744 Ga0495597_0021450
745 Ga0495597_0077676
746 Ga0495645_0136787
747 Ga0495622_0000001
748 Ga0495622_0000131
749 Ga0495622_0017966
750 Ga0495633_0000106
751 Ga0495633_0000675
752 Ga0495633_0022630
753 Ga0495633_0034438
754 Ga0495633_0054698
755 Ga0495656_0023597
756 Ga0495668_0000190
757 Ga0495668_0000666
758 Ga0495668_0000686
759 Ga0495668_0001174
760 Ga0495668_0001982
761 Ga0495668_0002092
762 Ga0495668_0002207
763 Ga0495668_0159284
764 Ga0495611_0000151
765 Ga0495625_0000035
766 Ga0495625_0000391
767 Ga0495625_0005884
768 Ga0495625_0032458
769 Ga0495625_0048352
770 Ga0495625_0153739
771 Ga0495661_0000408
772 Ga0495661_0003698
773 Ga0495661_0010298
774 Ga0495661_0012654
775 Ga0495661_0015295
776 Ga0495661_0025710
777 Ga0495661_0064420
778 Ga0495661_0138462
779 Ga0495661_0147323
780 Ga0495661_0172485
781 Ga0495661_0188850
782 Ga0495588_0000139
783 Ga0495669_0004286
784 Ga0495670_0020058
785 Ga0495671_0000010
786 Ga0495671_0004463
787 Ga0495671_0024354
788 Ga0495649_0002113
789 Ga0495649_0069162
790 Ga0495589_0000073
791 Ga0495589_0000100
792 Ga0495589_0012082
793 Ga0495660_0000027
794 Ga0495660_0000187
795 Ga0495660_0000335
796 Ga0495660_0000555
797 Ga0495660_0000752
798 Ga0495660_0004846
799 Ga0495660_0011293
800 Ga0495660_0016170
801 Ga0495660_0020359
802 Ga0495660_0021900
803 Ga0495660_0113468
804 Ga0495672_0000165
805 Ga0495672_0000400
806 Ga0495672_0045448
807 Ga0495680_0057298
808 Ga0495683_0014282
809 Ga0495683_0023605
810 Ga0495687_000012
811 Ga0495687_000037
812 Ga0495687_000122
813 Ga0495687_001008
814 Ga0495687_001859
815 Ga0495687_002318
816 Ga0495687_049876
817 Ga0495675_0048443
818 Ga0495677_0000014
819 Ga0495677_0002215
820 Ga0495677_0011273
821 Ga0495679_000603
822 Ga0495679_003356
823 Ga0495679_017325
824 Ga0495685_056855
825 Ga0495673_0000003
826 Ga0495673_0000016
827 Ga0495673_0000035
828 Ga0495681_0000021
829 Ga0495681_0003295
830 Ga0495681_0003738
831 Ga0495681_0007118
832 Ga0495681_0054731
833 Ga0495686_0032283
834 Ga0495686_0213153
835 Ga0495626_0000222
836 Ga0495626_0003930
837 Ga0495626_0015346
838 Ga0495626_0023441
839 Ga0495626_0028683
840 Ga0495626_0030870
841 Ga0495626_0039987
842 Ga0495626_0066055
843 Ga0495626_0079461
844 Ga0496100_0321177
845 Ga0496103_0003052
846 Ga0496103_0072931
847 Ga0496105_0353669
848 Ga0496106_0007416
849 Ga0496107_0177834
850 Ga0496107_0185306
851 Ga0496109_0278338
852 Ga0496110_0000026
853 Ga0496113_0007190
854 Ga0496116_0026414
855 Ga0496117_0000005
856 Ga0496118_0000022
857 Ga0496119_0159158
858 Ga0496121_0011949
859 Ga0496121_0017125
860 Ga0496121_0083355
861 Ga0496122_0001081
862 Ga0496122_0016946
863 Ga0496122_0021359
864 Ga0496122_0042580
865 Ga0496123_0001385
866 Ga0496123_0003098
867 Ga0496123_0004351
868 Ga0496123_0041420
869 Ga0496124_0029154
870 Ga0496124_0038593
871 Ga0496124_0054723
872 Ga0496124_0112439
873 Ga0496124_0138455
874 Ga0496125_0070349
875 Ga0495678_000002
876 Ga0495678_000010
877 Ga0495678_000029
878 Ga0495678_000045
879 Ga0495678_001464
880 Ga0495678_008318
881 Ga0495682_0000082
882 Ga0495682_0002171
883 Ga0501249_000002
884 Ga0501249_001714
885 Ga0501269_000010
886 Ga0500644_0000021
887 Ga0500651_0026394
888 Ga0500641_0000142
889 Ga0500562_000033
890 Ga0500618_000068
891 Ga0500618_035483
892 Ga0500658_0000015
893 Ga0500586_000133
894 Ga0500586_053653
895 Ga0500584_017230
896 2601671300
897 2643801485
898 2644012070
899 2644471453
900 2738733850
901 2738759337
902 2738766193
903 2738829899
904 2739153695
905 2739195615
906 2739215431
907 2739303194
908 2739322091
909 2739340332
910 2739617141
911 2739644649
912 2833641822
913 2842715533
914 2857548860
915 2857555910
916 2857557819
917 2857566922
918 2857621450
919 2881361500
920 2885080341
921 2886851939
922 2904425705
923 2914761378
924 2919478244
925 2932415443
926 2932421396
927 2958512636
928 8047677211

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04616

Glyco_hydro_43

Glycosyl hydrolases family 43

65

343

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qee-assembly2.cif.gz_B the structure and function of an arabinan-specific alpha-1,2-arabinofuranosidase identified from screening the activities of bacterial gh43 glycoside hydrolases 0.9761 30 322
3qef-assembly1.cif.gz_A the structure and function of an arabinan-specific alpha-1,2-arabinofuranosidase identified from screening the activities of bacterial gh43 glycoside hydrolases 0.9737 31 322
3qef-assembly1.cif.gz_A the structure and function of an arabinan-specific alpha-1,2-arabinofuranosidase identified from screening the activities of bacterial gh43 glycoside hydrolases 0.9576 31 322
3qee-assembly2.cif.gz_B the structure and function of an arabinan-specific alpha-1,2-arabinofuranosidase identified from screening the activities of bacterial gh43 glycoside hydrolases 0.9536 30 322
8hcj-assembly2.cif.gz_F structure of gh43 family enzyme, xylan 1, 4 beta- xylosidase from pseudopedobacter saltans 0.9116 31 320
ID Description Score Start End Superfamily
3qefB00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.9735 30 322 2.115.10.20
3qefB00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.9574 30 322 2.115.10.20
4novA00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8704 23 320 2.115.10.20
4novA00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.862 23 320 2.115.10.20
5glmA00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8589 24 310 2.115.10.20
ID Description Score Start End GO Terms
AF-S0DDZ8-F1-model_v4 non-reducing end alpha-L-arabinofuranosidase (EC 3.2.1.55) 0.9839 22 318 GO:0046373
GO:0046556
AF-A0A1B9DYK2-F1-model_v4 Glycoside hydrolase 0.9836 31 319 GO:0004553
GO:0045493
AF-A0A4Q5QWV5-F1-model_v4 Glycoside hydrolase 0.9827 31 261 GO:0004553
GO:0045493
AF-A0A7K1SZ81-F1-model_v4 Family 43 glycosylhydrolase 0.9822 23 322 GO:0004553
GO:0045493
AF-A0A4Q5YTP3-F1-model_v4 Glycoside hydrolase 0.9821 54 322 GO:0004553
GO:0045493

Map