F449362
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 464 | 215 | 928 | 319 |
Family's Representative Sequence
| Representative Sequence | 3300046558|Ga0495633_0000103|Ga0495633_0000103_78607_79680 |
| Length | 357 |
| Sequence | MTKTGMTDFLILSSQHLYLHANTVMKKNISVKPVSLLACLFFCTVGTTTLSANNSSVDTTIYADSNPIIKHKYTADPAALVYNGKVYLYSGHDEAIPPKEGYVMHEWLCFSSSDMTTWTEHPSPLNVKAFSWAKDDAWASQVIHRNNKFYWYVAVQHNSIPGKAIGVAVSDSPTGPFKDARGSALITNDMTLDTKISWDDIDPTVFIDDNGQAYLYWGNTICYYAKLKENMTELDGPIHTVPLKDFTEAPWIHKHKNWYYLSYASSFPEKIVYAMSRSIEGPWEYKGILNEVAGNSNTNHQAIIDFKGKSYFIYHNGSIPTAGGSYRRSVCIDYLYYNPDGTMKRVVMTTEGVKTVK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 3 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 4 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 16 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 21 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 22 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 23 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 25 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 26 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 27 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 28 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 29 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 30 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 35 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 43 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 44 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 45 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 46 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 48 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 51 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 52 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 53 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 56 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 58 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 61 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 63 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 78 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 79 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 80 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 81 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 82 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 83 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 84 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 85 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 86 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 87 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 88 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 89 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 90 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 91 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 92 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 93 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 94 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 95 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 96 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 97 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 98 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 99 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 100 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 101 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 102 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 157 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 158 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 159 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 160 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 162 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 163 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 164 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 165 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 166 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 167 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 168 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 169 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 170 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 171 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 172 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 175 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 176 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 177 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 178 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 179 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 180 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 181 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 182 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 183 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 184 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 185 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 186 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 187 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 188 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 189 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 190 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 191 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 192 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 193 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 194 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 195 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 196 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 197 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 198 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 199 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 200 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 201 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 202 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 203 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 204 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 205 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 206 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 207 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 208 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 209 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 210 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 211 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 212 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 213 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 214 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 215 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.89 |
| Metatranscriptomes | 0 |
| Isolates | 7.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.34 |
| Nodule | 0.65 |
| Rhizoplane | 2.37 |
| Rhizosphere | 75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495633_0000103 | 3300046558 | Bacteria | 114769 |
| 2 | JGI25152J39213_1000123 | 3300002773 | Bacteria | 53207 |
| 3 | JGI25150J39212_1000002 | 3300002774 | Bacteria | 537631 |
| 4 | JGI25150J39212_1004020 | 3300002774 | Bacteria | 3338 |
| 5 | JGI25151J46595_10000003 | 3300003187 | Bacteria | 715330 |
| 6 | JGI25153J46596_10000003 | 3300003215 | Bacteria | 553253 |
| 7 | JGI25153J46596_10044922 | 3300003215 | Bacteria | 1323 |
| 8 | rootH1_10037490 | 3300003316 | Bacteria | 4070 |
| 9 | rootH2_10070538 | 3300003320 | Bacteria | 2883 |
| 10 | rootL2_10053663 | 3300003322 | Bacteria | 2134 |
| 11 | rootH1_10012160 | 3300003323 | Bacteria | 5089 |
| 12 | rootH1_10066160 | 3300003323 | Bacteria | 1182 |
| 13 | rootH1_10372807 | 3300003323 | Bacteria | 1709 |
| 14 | Ga0055525_1000006 | 3300003759 | Bacteria | 642912 |
| 15 | Ga0055529_1000032 | 3300003763 | Bacteria | 255895 |
| 16 | Ga0055526_1000018 | 3300003771 | Bacteria | 198838 |
| 17 | Ga0055526_1000053 | 3300003771 | Bacteria | 114820 |
| 18 | Ga0055524_1000117 | 3300003775 | Bacteria | 93643 |
| 19 | Ga0055524_1010128 | 3300003775 | Bacteria | 3776 |
| 20 | Ga0055531_10007937 | 3300003794 | Bacteria | 5691 |
| 21 | Ga0065165_1001148 | 3300005262 | Bacteria | 30990 |
| 22 | Ga0065714_10129780 | 3300005288 | Bacteria | 1261 |
| 23 | Ga0070658_10194266 | 3300005327 | Bacteria | 1711 |
| 24 | Ga0070658_10303088 | 3300005327 | Bacteria | 1362 |
| 25 | Ga0070660_100021556 | 3300005339 | Bacteria | 4754 |
| 26 | Ga0070660_100022811 | 3300005339 | Bacteria | 4635 |
| 27 | Ga0070659_100000100 | 3300005366 | Bacteria | 63786 |
| 28 | Ga0070659_100048416 | 3300005366 | Bacteria | 3339 |
| 29 | Ga0068855_100046437 | 3300005563 | Bacteria | 5134 |
| 30 | Ga0068855_100456097 | 3300005563 | Bacteria | 1394 |
| 31 | Ga0068856_100039759 | 3300005614 | Bacteria | 4618 |
| 32 | Ga0068852_100064530 | 3300005616 | Bacteria | 3192 |
| 33 | Ga0097621_100011021 | 3300006237 | Bacteria | 6643 |
| 34 | Ga0075370_10035845 | 3300006353 | Bacteria | 2786 |
| 35 | Ga0068871_100061566 | 3300006358 | Bacteria | 3066 |
| 36 | Ga0068865_100129450 | 3300006881 | Bacteria | 1889 |
| 37 | Ga0099824_1042644 | 3300006942 | Unclassified | 1036 |
| 38 | Ga0099823_1004640 | 3300006944 | Bacteria | 13498 |
| 39 | Ga0079104_1012985 | 3300006946 | Bacteria | 2589 |
| 40 | Ga0105244_10000054 | 3300009036 | Bacteria | 133715 |
| 41 | Ga0105244_10002743 | 3300009036 | Bacteria | 13142 |
| 42 | Ga0105244_10020002 | 3300009036 | Bacteria | 3722 |
| 43 | Ga0105244_10032373 | 3300009036 | Bacteria | 2768 |
| 44 | Ga0105243_10097085 | 3300009148 | Bacteria | 2439 |
| 45 | Ga0105241_10045454 | 3300009174 | Bacteria | 3332 |
| 46 | Ga0105242_10053440 | 3300009176 | Bacteria | 3298 |
| 47 | Ga0105242_10093241 | 3300009176 | Bacteria | 2538 |
| 48 | Ga0157319_1000026 | 3300012497 | Bacteria | 63349 |
| 49 | Ga0157373_10002256 | 3300013100 | Bacteria | 14605 |
| 50 | Ga0157371_10000014 | 3300013102 | Bacteria | 347490 |
| 51 | Ga0157371_10182386 | 3300013102 | Unclassified | 1501 |
| 52 | Ga0157370_10013430 | 3300013104 | Bacteria | 8436 |
| 53 | Ga0157370_10014601 | 3300013104 | Bacteria | 8026 |
| 54 | Ga0157369_10001134 | 3300013105 | Bacteria | 33314 |
| 55 | Ga0157369_10206748 | 3300013105 | Bacteria | 2059 |
| 56 | Ga0157378_10015102 | 3300013297 | Bacteria | 6760 |
| 57 | Ga0163162_10396344 | 3300013306 | Bacteria | 1513 |
| 58 | Ga0157372_10000099 | 3300013307 | Bacteria | 89946 |
| 59 | Ga0157372_10082994 | 3300013307 | Bacteria | 3629 |
| 60 | Ga0157372_10097316 | 3300013307 | Bacteria | 3356 |
| 61 | Ga0182008_10015609 | 3300014497 | Bacteria | 3959 |
| 62 | Ga0182006_1000007 | 3300015261 | Bacteria | 452190 |
| 63 | Ga0182006_1000040 | 3300015261 | Bacteria | 209209 |
| 64 | Ga0182006_1000080 | 3300015261 | Bacteria | 122163 |
| 65 | Ga0182007_10000120 | 3300015262 | Bacteria | 54341 |
| 66 | Ga0182005_1000010 | 3300015265 | Bacteria | 434103 |
| 67 | Ga0182005_1000051 | 3300015265 | Bacteria | 114808 |
| 68 | Ga0163161_10003856 | 3300017792 | Bacteria | 10514 |
| 69 | Ga0163161_10009421 | 3300017792 | Bacteria | 6757 |
| 70 | Ga0213872_10033396 | 3300021361 | Bacteria | 2357 |
| 71 | Ga0209563_100022 | 3300025230 | Bacteria | 643318 |
| 72 | Ga0209437_102557 | 3300025233 | Bacteria | 3502 |
| 73 | Ga0207425_1000004 | 3300025245 | Bacteria | 1092421 |
| 74 | Ga0207425_1000326 | 3300025245 | Bacteria | 33697 |
| 75 | Ga0209646_1000051 | 3300025246 | Bacteria | 296525 |
| 76 | Ga0209026_1000762 | 3300025250 | Bacteria | 18053 |
| 77 | Ga0209677_107524 | 3300025253 | Bacteria | 2292 |
| 78 | Ga0209148_1000678 | 3300025254 | Bacteria | 28482 |
| 79 | Ga0209129_1000005 | 3300025258 | Bacteria | 777812 |
| 80 | Ga0209455_1000043 | 3300025272 | Bacteria | 413928 |
| 81 | Ga0209673_1003819 | 3300025273 | Bacteria | 8534 |
| 82 | Ga0209673_1013141 | 3300025273 | Bacteria | 3288 |
| 83 | Ga0209130_1000078 | 3300025284 | Bacteria | 169374 |
| 84 | Ga0209025_1000009 | 3300025294 | Bacteria | 1092561 |
| 85 | Ga0209025_1001273 | 3300025294 | Bacteria | 34682 |
| 86 | Ga0209564_1000011 | 3300025295 | Bacteria | 822327 |
| 87 | Ga0209564_1000068 | 3300025295 | Bacteria | 311171 |
| 88 | Ga0209758_1000010 | 3300025297 | Bacteria | 1092782 |
| 89 | Ga0209758_1000568 | 3300025297 | Bacteria | 57997 |
| 90 | Ga0209256_1000075 | 3300025299 | Bacteria | 236149 |
| 91 | Ga0209256_1000267 | 3300025299 | Bacteria | 92278 |
| 92 | Ga0209256_1037285 | 3300025299 | Bacteria | 1268 |
| 93 | Ga0209051_1004058 | 3300025303 | Bacteria | 9230 |
| 94 | Ga0209257_1000244 | 3300025304 | Bacteria | 126098 |
| 95 | Ga0209257_1003739 | 3300025304 | Bacteria | 12616 |
| 96 | Ga0207655_1000003 | 3300025728 | Bacteria | 1081376 |
| 97 | Ga0207655_1003729 | 3300025728 | Bacteria | 11186 |
| 98 | Ga0207655_1018587 | 3300025728 | Bacteria | 3677 |
| 99 | Ga0207655_1057721 | 3300025728 | Bacteria | 1522 |
| 100 | Ga0207705_10005752 | 3300025909 | Bacteria | 9252 |
| 101 | Ga0207705_10163296 | 3300025909 | Bacteria | 1674 |
| 102 | Ga0207654_10118734 | 3300025911 | Bacteria | 1657 |
| 103 | Ga0207657_10025414 | 3300025919 | Bacteria | 5462 |
| 104 | Ga0207657_10029637 | 3300025919 | Bacteria | 4979 |
| 105 | Ga0207657_10087231 | 3300025919 | Bacteria | 2611 |
| 106 | Ga0207690_10000609 | 3300025932 | Bacteria | 23117 |
| 107 | Ga0207690_10032662 | 3300025932 | Bacteria | 3341 |
| 108 | Ga0207686_10086728 | 3300025934 | Bacteria | 2057 |
| 109 | Ga0207709_10029114 | 3300025935 | Bacteria | 3199 |
| 110 | Ga0207704_10109272 | 3300025938 | Bacteria | 1865 |
| 111 | Ga0207689_10532341 | 3300025942 | Bacteria | 986 |
| 112 | Ga0207667_10283647 | 3300025949 | Bacteria | 1692 |
| 113 | Ga0207667_10413266 | 3300025949 | Bacteria | 1373 |
| 114 | Ga0207648_10213590 | 3300026089 | Bacteria | 1713 |
| 115 | Ga0207648_10368154 | 3300026089 | Bacteria | 1298 |
| 116 | Ga0207698_10110500 | 3300026142 | Bacteria | 2303 |
| 117 | Ga0307515_10000007 | 3300028794 | Bacteria | 719669 |
| 118 | Ga0307515_10017272 | 3300028794 | Bacteria | 13154 |
| 119 | Ga0316177_1157343 | 3300030731 | Bacteria | 6045 |
| 120 | Ga0316182_1168160 | 3300030745 | Bacteria | 1617 |
| 121 | Ga0307408_100001079 | 3300031548 | Bacteria | 20870 |
| 122 | Ga0307414_10004089 | 3300032004 | Bacteria | 7870 |
| 123 | Ga0307510_10006279 | 3300033180 | Bacteria | 14175 |
| 124 | Ga0395899_0000001 | 3300037312 | Bacteria | 1750322 |
| 125 | Ga0395899_0000245 | 3300037312 | Bacteria | 72304 |
| 126 | Ga0395899_0000315 | 3300037312 | Bacteria | 61724 |
| 127 | Ga0395900_0000202 | 3300037418 | Bacteria | 93773 |
| 128 | Ga0395900_0001818 | 3300037418 | Bacteria | 24409 |
| 129 | Ga0395900_0005977 | 3300037418 | Bacteria | 12708 |
| 130 | Ga0395900_0090199 | 3300037418 | Bacteria | 3150 |
| 131 | Ga0395900_0148981 | 3300037418 | Bacteria | 2391 |
| 132 | Ga0395900_0149960 | 3300037418 | Bacteria | 2382 |
| 133 | Ga0395900_0172989 | 3300037418 | Bacteria | 2197 |
| 134 | Ga0395900_0293331 | 3300037418 | Bacteria | 1614 |
| 135 | Ga0395898_0436524 | 3300037466 | Bacteria | 1247 |
| 136 | Ga0395905_0014150 | 3300037471 | Bacteria | 7623 |
| 137 | Ga0395905_0224537 | 3300037471 | Bacteria | 1757 |
| 138 | Ga0395901_0000019 | 3300038443 | Bacteria | 317063 |
| 139 | Ga0395901_0002353 | 3300038443 | Bacteria | 19225 |
| 140 | Ga0395901_0350500 | 3300038443 | Bacteria | 1523 |
| 141 | Ga0395901_0377931 | 3300038443 | Bacteria | 1459 |
| 142 | Ga0395901_0508601 | 3300038443 | Bacteria | 1225 |
| 143 | Ga0436361_0441859 | 3300039447 | Bacteria | 17533 |
| 144 | Ga0439448_0003221 | 3300042005 | Bacteria | 4505 |
| 145 | Ga0439450_022102 | 3300042008 | Bacteria | 1371 |
| 146 | Ga0466969_0009972 | 3300044656 | Bacteria | 5037 |
| 147 | Ga0466972_0000017 | 3300044658 | Bacteria | 199884 |
| 148 | Ga0466965_0008650 | 3300044683 | Bacteria | 4710 |
| 149 | Ga0466965_0054971 | 3300044683 | Bacteria | 1980 |
| 150 | Ga0466965_0167181 | 3300044683 | Bacteria | 1155 |
| 151 | Ga0466966_0026820 | 3300044684 | Bacteria | 3759 |
| 152 | Ga0466966_0030013 | 3300044684 | Bacteria | 3534 |
| 153 | Ga0466961_0006446 | 3300044693 | Bacteria | 7453 |
| 154 | Ga0466961_0117053 | 3300044693 | Bacteria | 1674 |
| 155 | Ga0466963_0012720 | 3300044694 | Bacteria | 5155 |
| 156 | Ga0466964_0001250 | 3300044706 | Bacteria | 8632 |
| 157 | Ga0466968_0000207 | 3300044735 | Bacteria | 18092 |
| 158 | Ga0466957_0001749 | 3300044842 | Bacteria | 11419 |
| 159 | Ga0466957_0073547 | 3300044842 | Bacteria | 2118 |
| 160 | Ga0466959_0051216 | 3300045049 | Bacteria | 3029 |
| 161 | Ga0466959_0162763 | 3300045049 | Bacteria | 1568 |
| 162 | Ga0466959_0269149 | 3300045049 | Bacteria | 1171 |
| 163 | Ga0466967_0147943 | 3300045976 | Bacteria | 2192 |
| 164 | Ga0466967_0358367 | 3300045976 | Bacteria | 1413 |
| 165 | Ga0495617_000003 | 3300046452 | Bacteria | 541914 |
| 166 | Ga0495627_000008 | 3300046453 | Bacteria | 572150 |
| 167 | Ga0495627_000011 | 3300046453 | Bacteria | 354522 |
| 168 | Ga0495627_020416 | 3300046453 | Bacteria | 2208 |
| 169 | Ga0495603_0033801 | 3300046455 | Bacteria | 3076 |
| 170 | Ga0495590_0000001 | 3300046457 | Bacteria | 762984 |
| 171 | Ga0495590_0000512 | 3300046457 | Bacteria | 18985 |
| 172 | Ga0495590_0007095 | 3300046457 | Bacteria | 4337 |
| 173 | Ga0495638_0000017 | 3300046460 | Bacteria | 391117 |
| 174 | Ga0495638_0011980 | 3300046460 | Bacteria | 5961 |
| 175 | Ga0495638_0038606 | 3300046460 | Bacteria | 3033 |
| 176 | Ga0495638_0093266 | 3300046460 | Bacteria | 1811 |
| 177 | Ga0495638_0119826 | 3300046460 | Bacteria | 1556 |
| 178 | Ga0495653_0000002 | 3300046463 | Bacteria | 507262 |
| 179 | Ga0495653_0054284 | 3300046463 | Bacteria | 3062 |
| 180 | Ga0495650_0000001 | 3300046471 | Bacteria | 1085492 |
| 181 | Ga0495650_0000072 | 3300046471 | Bacteria | 257886 |
| 182 | Ga0495650_0000434 | 3300046471 | Bacteria | 67282 |
| 183 | Ga0495650_0001400 | 3300046471 | Bacteria | 23592 |
| 184 | Ga0495650_0005904 | 3300046471 | Bacteria | 7782 |
| 185 | Ga0495650_0012300 | 3300046471 | Bacteria | 4611 |
| 186 | Ga0495650_0014983 | 3300046471 | Bacteria | 4001 |
| 187 | Ga0495605_0000065 | 3300046474 | Bacteria | 139441 |
| 188 | Ga0495605_0000103 | 3300046474 | Bacteria | 105879 |
| 189 | Ga0495605_0010428 | 3300046474 | Bacteria | 5198 |
| 190 | Ga0495605_0014301 | 3300046474 | Bacteria | 4349 |
| 191 | Ga0495605_0027683 | 3300046474 | Bacteria | 2935 |
| 192 | Ga0495605_0053979 | 3300046474 | Bacteria | 1948 |
| 193 | Ga0495584_0000182 | 3300046491 | Bacteria | 44393 |
| 194 | Ga0495584_0000589 | 3300046491 | Bacteria | 24441 |
| 195 | Ga0495584_0006047 | 3300046491 | Bacteria | 6375 |
| 196 | Ga0495584_0007217 | 3300046491 | Bacteria | 5798 |
| 197 | Ga0495584_0057690 | 3300046491 | Bacteria | 1953 |
| 198 | Ga0495584_0102756 | 3300046491 | Bacteria | 1445 |
| 199 | Ga0495585_0000154 | 3300046492 | Bacteria | 73681 |
| 200 | Ga0495585_0001370 | 3300046492 | Bacteria | 19288 |
| 201 | Ga0495585_0017794 | 3300046492 | Bacteria | 4102 |
| 202 | Ga0495585_0037212 | 3300046492 | Bacteria | 2741 |
| 203 | Ga0495585_0038580 | 3300046492 | Bacteria | 2688 |
| 204 | Ga0495585_0039203 | 3300046492 | Bacteria | 2663 |
| 205 | Ga0495585_0066781 | 3300046492 | Bacteria | 1968 |
| 206 | Ga0495585_0111266 | 3300046492 | Bacteria | 1456 |
| 207 | Ga0495585_0156806 | 3300046492 | Bacteria | 1183 |
| 208 | Ga0495596_0005761 | 3300046500 | Bacteria | 5810 |
| 209 | Ga0495596_0007923 | 3300046500 | Bacteria | 4755 |
| 210 | Ga0495607_0001832 | 3300046501 | Bacteria | 18116 |
| 211 | Ga0495607_0002956 | 3300046501 | Bacteria | 13357 |
| 212 | Ga0495607_0008276 | 3300046501 | Bacteria | 7116 |
| 213 | Ga0495607_0018840 | 3300046501 | Bacteria | 4391 |
| 214 | Ga0495607_0020760 | 3300046501 | Bacteria | 4144 |
| 215 | Ga0495607_0087426 | 3300046501 | Bacteria | 1696 |
| 216 | Ga0495607_0129276 | 3300046501 | Bacteria | 1316 |
| 217 | Ga0495583_0000050 | 3300046506 | Bacteria | 213627 |
| 218 | Ga0495583_0000250 | 3300046506 | Bacteria | 88815 |
| 219 | Ga0495583_0002249 | 3300046506 | Bacteria | 16985 |
| 220 | Ga0495583_0033367 | 3300046506 | Bacteria | 2476 |
| 221 | Ga0495606_0000001 | 3300046507 | Bacteria | 592123 |
| 222 | Ga0495606_0000030 | 3300046507 | Bacteria | 249484 |
| 223 | Ga0495606_0007668 | 3300046507 | Bacteria | 9570 |
| 224 | Ga0495606_0028869 | 3300046507 | Bacteria | 3905 |
| 225 | Ga0495610_0000003 | 3300046512 | Bacteria | 1203910 |
| 226 | Ga0495610_0000275 | 3300046512 | Bacteria | 53769 |
| 227 | Ga0495610_0003187 | 3300046512 | Bacteria | 13002 |
| 228 | Ga0495610_0005970 | 3300046512 | Bacteria | 8521 |
| 229 | Ga0495610_0012792 | 3300046512 | Bacteria | 5021 |
| 230 | Ga0495616_0000012 | 3300046513 | Bacteria | 211342 |
| 231 | Ga0495616_0004620 | 3300046513 | Bacteria | 8640 |
| 232 | Ga0495616_0018003 | 3300046513 | Bacteria | 3889 |
| 233 | Ga0495616_0038695 | 3300046513 | Bacteria | 2447 |
| 234 | Ga0495631_0000214 | 3300046518 | Bacteria | 39867 |
| 235 | Ga0495631_0002741 | 3300046518 | Bacteria | 9762 |
| 236 | Ga0495632_0000117 | 3300046519 | Bacteria | 81479 |
| 237 | Ga0495632_0000151 | 3300046519 | Bacteria | 71855 |
| 238 | Ga0495632_0000367 | 3300046519 | Bacteria | 42974 |
| 239 | Ga0495632_0009091 | 3300046519 | Bacteria | 6015 |
| 240 | Ga0495632_0078743 | 3300046519 | Bacteria | 1574 |
| 241 | Ga0495637_0000042 | 3300046520 | Bacteria | 114979 |
| 242 | Ga0495637_0045364 | 3300046520 | Bacteria | 1865 |
| 243 | Ga0495643_0000028 | 3300046522 | Bacteria | 262886 |
| 244 | Ga0495643_0000285 | 3300046522 | Bacteria | 72233 |
| 245 | Ga0495643_0002743 | 3300046522 | Bacteria | 13531 |
| 246 | Ga0495643_0010394 | 3300046522 | Bacteria | 5730 |
| 247 | Ga0495643_0016884 | 3300046522 | Bacteria | 4280 |
| 248 | Ga0495643_0098007 | 3300046522 | Bacteria | 1505 |
| 249 | Ga0495643_0172550 | 3300046522 | Bacteria | 1056 |
| 250 | Ga0495644_0019399 | 3300046523 | Bacteria | 2597 |
| 251 | Ga0495644_0023527 | 3300046523 | Bacteria | 2345 |
| 252 | Ga0495644_0048011 | 3300046523 | Bacteria | 1603 |
| 253 | Ga0495648_0000001 | 3300046524 | Bacteria | 696872 |
| 254 | Ga0495648_0001299 | 3300046524 | Bacteria | 24837 |
| 255 | Ga0495648_0002750 | 3300046524 | Bacteria | 15879 |
| 256 | Ga0495648_0003706 | 3300046524 | Bacteria | 13353 |
| 257 | Ga0495648_0004046 | 3300046524 | Bacteria | 12657 |
| 258 | Ga0495648_0004835 | 3300046524 | Bacteria | 11367 |
| 259 | Ga0495648_0008621 | 3300046524 | Bacteria | 7997 |
| 260 | Ga0495648_0022743 | 3300046524 | Bacteria | 4308 |
| 261 | Ga0495648_0050683 | 3300046524 | Bacteria | 2534 |
| 262 | Ga0495648_0053956 | 3300046524 | Bacteria | 2431 |
| 263 | Ga0495642_0000091 | 3300046528 | Bacteria | 53133 |
| 264 | Ga0495642_0001217 | 3300046528 | Bacteria | 11835 |
| 265 | Ga0495642_0024534 | 3300046528 | Bacteria | 2386 |
| 266 | Ga0495642_0031965 | 3300046528 | Bacteria | 2110 |
| 267 | Ga0495654_0000037 | 3300046530 | Bacteria | 188218 |
| 268 | Ga0495654_0032959 | 3300046530 | Bacteria | 2624 |
| 269 | Ga0495654_0033389 | 3300046530 | Bacteria | 2605 |
| 270 | Ga0495587_0045810 | 3300046536 | Bacteria | 2598 |
| 271 | Ga0495609_0000026 | 3300046538 | Bacteria | 251973 |
| 272 | Ga0495609_0000979 | 3300046538 | Bacteria | 20452 |
| 273 | Ga0495609_0001294 | 3300046538 | Bacteria | 17071 |
| 274 | Ga0495609_0033585 | 3300046538 | Bacteria | 2329 |
| 275 | Ga0495597_0000314 | 3300046542 | Bacteria | 43625 |
| 276 | Ga0495597_0000785 | 3300046542 | Bacteria | 25063 |
| 277 | Ga0495597_0002465 | 3300046542 | Bacteria | 11695 |
| 278 | Ga0495597_0007122 | 3300046542 | Bacteria | 5721 |
| 279 | Ga0495597_0020310 | 3300046542 | Bacteria | 3095 |
| 280 | Ga0495597_0021450 | 3300046542 | Bacteria | 3003 |
| 281 | Ga0495597_0077676 | 3300046542 | Bacteria | 1422 |
| 282 | Ga0495645_0136787 | 3300046543 | Bacteria | 1713 |
| 283 | Ga0495622_0000001 | 3300046557 | Bacteria | 365248 |
| 284 | Ga0495622_0000131 | 3300046557 | Bacteria | 64280 |
| 285 | Ga0495622_0017966 | 3300046557 | Bacteria | 3294 |
| 286 | Ga0495633_0000106 | 3300046558 | Bacteria | 113381 |
| 287 | Ga0495633_0000675 | 3300046558 | Bacteria | 31481 |
| 288 | Ga0495633_0022630 | 3300046558 | Bacteria | 3124 |
| 289 | Ga0495633_0034438 | 3300046558 | Bacteria | 2436 |
| 290 | Ga0495633_0054698 | 3300046558 | Bacteria | 1877 |
| 291 | Ga0495656_0023597 | 3300046615 | Bacteria | 2422 |
| 292 | Ga0495668_0000190 | 3300046616 | Bacteria | 91473 |
| 293 | Ga0495668_0000666 | 3300046616 | Bacteria | 41285 |
| 294 | Ga0495668_0000686 | 3300046616 | Bacteria | 40735 |
| 295 | Ga0495668_0001174 | 3300046616 | Bacteria | 26668 |
| 296 | Ga0495668_0001982 | 3300046616 | Bacteria | 17930 |
| 297 | Ga0495668_0002092 | 3300046616 | Bacteria | 17268 |
| 298 | Ga0495668_0002207 | 3300046616 | Bacteria | 16580 |
| 299 | Ga0495668_0159284 | 3300046616 | Bacteria | 1236 |
| 300 | Ga0495611_0000151 | 3300046648 | Bacteria | 49625 |
| 301 | Ga0495625_0000035 | 3300046660 | Bacteria | 224323 |
| 302 | Ga0495625_0000391 | 3300046660 | Bacteria | 66888 |
| 303 | Ga0495625_0005884 | 3300046660 | Bacteria | 11043 |
| 304 | Ga0495625_0032458 | 3300046660 | Bacteria | 3870 |
| 305 | Ga0495625_0048352 | 3300046660 | Bacteria | 3063 |
| 306 | Ga0495625_0153739 | 3300046660 | Bacteria | 1545 |
| 307 | Ga0495661_0000408 | 3300046665 | Bacteria | 45688 |
| 308 | Ga0495661_0003698 | 3300046665 | Bacteria | 11236 |
| 309 | Ga0495661_0010298 | 3300046665 | Bacteria | 6385 |
| 310 | Ga0495661_0012654 | 3300046665 | Bacteria | 5694 |
| 311 | Ga0495661_0015295 | 3300046665 | Bacteria | 5122 |
| 312 | Ga0495661_0025710 | 3300046665 | Bacteria | 3800 |
| 313 | Ga0495661_0064420 | 3300046665 | Bacteria | 2162 |
| 314 | Ga0495661_0138462 | 3300046665 | Bacteria | 1326 |
| 315 | Ga0495661_0147323 | 3300046665 | Bacteria | 1274 |
| 316 | Ga0495661_0172485 | 3300046665 | Bacteria | 1152 |
| 317 | Ga0495661_0188850 | 3300046665 | Bacteria | 1086 |
| 318 | Ga0495588_0000139 | 3300046674 | Bacteria | 109955 |
| 319 | Ga0495669_0004286 | 3300046684 | Bacteria | 5884 |
| 320 | Ga0495670_0020058 | 3300046691 | Bacteria | 3294 |
| 321 | Ga0495671_0000010 | 3300046692 | Bacteria | 368641 |
| 322 | Ga0495671_0004463 | 3300046692 | Bacteria | 8361 |
| 323 | Ga0495671_0024354 | 3300046692 | Bacteria | 3152 |
| 324 | Ga0495649_0002113 | 3300046694 | Bacteria | 14263 |
| 325 | Ga0495649_0069162 | 3300046694 | Bacteria | 1894 |
| 326 | Ga0495589_0000073 | 3300046794 | Bacteria | 94125 |
| 327 | Ga0495589_0000100 | 3300046794 | Bacteria | 83307 |
| 328 | Ga0495589_0012082 | 3300046794 | Bacteria | 4478 |
| 329 | Ga0495660_0000027 | 3300046810 | Bacteria | 254331 |
| 330 | Ga0495660_0000187 | 3300046810 | Bacteria | 66615 |
| 331 | Ga0495660_0000335 | 3300046810 | Bacteria | 41632 |
| 332 | Ga0495660_0000555 | 3300046810 | Bacteria | 30632 |
| 333 | Ga0495660_0000752 | 3300046810 | Bacteria | 24444 |
| 334 | Ga0495660_0004846 | 3300046810 | Bacteria | 8113 |
| 335 | Ga0495660_0011293 | 3300046810 | Bacteria | 5186 |
| 336 | Ga0495660_0016170 | 3300046810 | Bacteria | 4304 |
| 337 | Ga0495660_0020359 | 3300046810 | Bacteria | 3802 |
| 338 | Ga0495660_0021900 | 3300046810 | Bacteria | 3655 |
| 339 | Ga0495660_0113468 | 3300046810 | Bacteria | 1380 |
| 340 | Ga0495672_0000165 | 3300047320 | Bacteria | 96215 |
| 341 | Ga0495672_0000400 | 3300047320 | Bacteria | 52696 |
| 342 | Ga0495672_0045448 | 3300047320 | Bacteria | 2627 |
| 343 | Ga0495680_0057298 | 3300047322 | Bacteria | 3014 |
| 344 | Ga0495683_0014282 | 3300047323 | Bacteria | 4137 |
| 345 | Ga0495683_0023605 | 3300047323 | Bacteria | 3160 |
| 346 | Ga0495687_000012 | 3300047443 | Bacteria | 391586 |
| 347 | Ga0495687_000037 | 3300047443 | Bacteria | 252363 |
| 348 | Ga0495687_000122 | 3300047443 | Bacteria | 119372 |
| 349 | Ga0495687_001008 | 3300047443 | Bacteria | 28121 |
| 350 | Ga0495687_001859 | 3300047443 | Bacteria | 18393 |
| 351 | Ga0495687_002318 | 3300047443 | Bacteria | 15517 |
| 352 | Ga0495687_049876 | 3300047443 | Bacteria | 1787 |
| 353 | Ga0495675_0048443 | 3300047444 | Bacteria | 2703 |
| 354 | Ga0495677_0000014 | 3300047445 | Bacteria | 136236 |
| 355 | Ga0495677_0002215 | 3300047445 | Bacteria | 7702 |
| 356 | Ga0495677_0011273 | 3300047445 | Bacteria | 3272 |
| 357 | Ga0495679_000603 | 3300047446 | Bacteria | 24373 |
| 358 | Ga0495679_003356 | 3300047446 | Bacteria | 7730 |
| 359 | Ga0495679_017325 | 3300047446 | Bacteria | 2582 |
| 360 | Ga0495685_056855 | 3300047447 | Bacteria | 1322 |
| 361 | Ga0495673_0000003 | 3300047469 | Bacteria | 1491337 |
| 362 | Ga0495673_0000016 | 3300047469 | Bacteria | 580643 |
| 363 | Ga0495673_0000035 | 3300047469 | Bacteria | 316861 |
| 364 | Ga0495681_0000021 | 3300047470 | Bacteria | 166534 |
| 365 | Ga0495681_0003295 | 3300047470 | Bacteria | 11254 |
| 366 | Ga0495681_0003738 | 3300047470 | Bacteria | 10540 |
| 367 | Ga0495681_0007118 | 3300047470 | Bacteria | 7210 |
| 368 | Ga0495681_0054731 | 3300047470 | Bacteria | 1863 |
| 369 | Ga0495686_0032283 | 3300047472 | Bacteria | 3390 |
| 370 | Ga0495686_0213153 | 3300047472 | Bacteria | 1102 |
| 371 | Ga0495626_0000222 | 3300048091 | Bacteria | 67304 |
| 372 | Ga0495626_0003930 | 3300048091 | Bacteria | 9298 |
| 373 | Ga0495626_0015346 | 3300048091 | Bacteria | 3925 |
| 374 | Ga0495626_0023441 | 3300048091 | Bacteria | 3039 |
| 375 | Ga0495626_0028683 | 3300048091 | Bacteria | 2696 |
| 376 | Ga0495626_0030870 | 3300048091 | Bacteria | 2582 |
| 377 | Ga0495626_0039987 | 3300048091 | Bacteria | 2216 |
| 378 | Ga0495626_0066055 | 3300048091 | Bacteria | 1636 |
| 379 | Ga0495626_0079461 | 3300048091 | Bacteria | 1459 |
| 380 | Ga0496100_0321177 | 3300048903 | Bacteria | 1163 |
| 381 | Ga0496103_0003052 | 3300048906 | Bacteria | 10295 |
| 382 | Ga0496103_0072931 | 3300048906 | Bacteria | 2151 |
| 383 | Ga0496105_0353669 | 3300048908 | Bacteria | 1173 |
| 384 | Ga0496106_0007416 | 3300048909 | Bacteria | 8106 |
| 385 | Ga0496107_0177834 | 3300048910 | Bacteria | 1580 |
| 386 | Ga0496107_0185306 | 3300048910 | Bacteria | 1546 |
| 387 | Ga0496109_0278338 | 3300048912 | Bacteria | 1577 |
| 388 | Ga0496110_0000026 | 3300048913 | Bacteria | 71385 |
| 389 | Ga0496113_0007190 | 3300048916 | Bacteria | 7135 |
| 390 | Ga0496116_0026414 | 3300048919 | Bacteria | 4248 |
| 391 | Ga0496117_0000005 | 3300048920 | Bacteria | 777468 |
| 392 | Ga0496118_0000022 | 3300048921 | Bacteria | 438602 |
| 393 | Ga0496119_0159158 | 3300048922 | Bacteria | 1203 |
| 394 | Ga0496121_0011949 | 3300048924 | Bacteria | 9553 |
| 395 | Ga0496121_0017125 | 3300048924 | Bacteria | 7425 |
| 396 | Ga0496121_0083355 | 3300048924 | Bacteria | 2524 |
| 397 | Ga0496122_0001081 | 3300048925 | Bacteria | 47312 |
| 398 | Ga0496122_0016946 | 3300048925 | Bacteria | 6846 |
| 399 | Ga0496122_0021359 | 3300048925 | Bacteria | 5798 |
| 400 | Ga0496122_0042580 | 3300048925 | Bacteria | 3570 |
| 401 | Ga0496123_0001385 | 3300048926 | Bacteria | 33978 |
| 402 | Ga0496123_0003098 | 3300048926 | Bacteria | 19096 |
| 403 | Ga0496123_0004351 | 3300048926 | Bacteria | 14974 |
| 404 | Ga0496123_0041420 | 3300048926 | Bacteria | 3193 |
| 405 | Ga0496124_0029154 | 3300048927 | Bacteria | 4923 |
| 406 | Ga0496124_0038593 | 3300048927 | Bacteria | 4146 |
| 407 | Ga0496124_0054723 | 3300048927 | Bacteria | 3376 |
| 408 | Ga0496124_0112439 | 3300048927 | Bacteria | 2190 |
| 409 | Ga0496124_0138455 | 3300048927 | Bacteria | 1924 |
| 410 | Ga0496125_0070349 | 3300048928 | Bacteria | 2740 |
| 411 | Ga0495678_000002 | 3300049459 | Bacteria | 999613 |
| 412 | Ga0495678_000010 | 3300049459 | Bacteria | 357896 |
| 413 | Ga0495678_000029 | 3300049459 | Bacteria | 219803 |
| 414 | Ga0495678_000045 | 3300049459 | Bacteria | 171880 |
| 415 | Ga0495678_001464 | 3300049459 | Bacteria | 18513 |
| 416 | Ga0495678_008318 | 3300049459 | Bacteria | 5246 |
| 417 | Ga0495682_0000082 | 3300049460 | Bacteria | 83453 |
| 418 | Ga0495682_0002171 | 3300049460 | Bacteria | 9502 |
| 419 | Ga0501249_000002 | 3300049679 | Bacteria | 262756 |
| 420 | Ga0501249_001714 | 3300049679 | Bacteria | 4466 |
| 421 | Ga0501269_000010 | 3300049766 | Bacteria | 70454 |
| 422 | Ga0500644_0000021 | 3300053088 | Bacteria | 100777 |
| 423 | Ga0500651_0026394 | 3300053093 | Unclassified | 3651 |
| 424 | Ga0500641_0000142 | 3300053096 | Bacteria | 26342 |
| 425 | Ga0500562_000033 | 3300053108 | Bacteria | 86295 |
| 426 | Ga0500618_000068 | 3300053125 | Bacteria | 88668 |
| 427 | Ga0500618_035483 | 3300053125 | Bacteria | 1158 |
| 428 | Ga0500658_0000015 | 3300053134 | Bacteria | 151134 |
| 429 | Ga0500586_000133 | 3300053145 | Bacteria | 13666 |
| 430 | Ga0500586_053653 | 3300053145 | Bacteria | 1393 |
| 431 | Ga0500584_017230 | 3300053726 | Bacteria | 3336 |
| 432 | 2601671300 | 2600255292 | Bacteria | 6300551 |
| 433 | 2643801485 | 2643221556 | Bacteria | 7251154 |
| 434 | 2644012070 | 2643221600 | Bacteria | 5530138 |
| 435 | 2644471453 | 2643221684 | Bacteria | 7145183 |
| 436 | 2738733850 | 2738541279 | Bacteria | 6149495 |
| 437 | 2738759337 | 2738541283 | Bacteria | 7222293 |
| 438 | 2738766193 | 2738541285 | Bacteria | 6150075 |
| 439 | 2738829899 | 2738541297 | Bacteria | 6549566 |
| 440 | 2739153695 | 2738541357 | Bacteria | 6549408 |
| 441 | 2739195615 | 2738543003 | Bacteria | 6549560 |
| 442 | 2739215431 | 2738543007 | Bacteria | 6149845 |
| 443 | 2739303194 | 2738543023 | Bacteria | 6767879 |
| 444 | 2739322091 | 2738543026 | Bacteria | 6549408 |
| 445 | 2739340332 | 2738543029 | Bacteria | 6549249 |
| 446 | 2739617141 | 2739367656 | Bacteria | 5152243 |
| 447 | 2739644649 | 2739367663 | Bacteria | 5040914 |
| 448 | 2833641822 | 2833640130 | Bacteria | 4858325 |
| 449 | 2842715533 | 2842711865 | Bacteria | 7155354 |
| 450 | 2857548860 | 2857547612 | Bacteria | 6179999 |
| 451 | 2857555910 | 2857553236 | Bacteria | 6166726 |
| 452 | 2857557819 | 2857553236 | Bacteria | 6166726 |
| 453 | 2857566922 | 2857564685 | Bacteria | 6290584 |
| 454 | 2857621450 | 2857618242 | Bacteria | 5635925 |
| 455 | 2881361500 | 2881359912 | Bacteria | 4935907 |
| 456 | 2885080341 | 2885080285 | Bacteria | 6355622 |
| 457 | 2886851939 | 2886848708 | Bacteria | 5632523 |
| 458 | 2904425705 | 2904424332 | Bacteria | 7633521 |
| 459 | 2914761378 | 2914759650 | Bacteria | 4701441 |
| 460 | 2919478244 | 2919476304 | Bacteria | 5888696 |
| 461 | 2932415443 | 2932410948 | Bacteria | 6312192 |
| 462 | 2932421396 | 2932416698 | Bacteria | 6315112 |
| 463 | 2958512636 | 2958512119 | Bacteria | 4528530 |
| 464 | 8047677211 | 8047673197 | Bacteria | 7395230 |
| 465 | Ga0495633_0000103 | |||
| 466 | JGI25152J39213_1000123 | |||
| 467 | JGI25150J39212_1000002 | |||
| 468 | JGI25150J39212_1004020 | |||
| 469 | JGI25151J46595_10000003 | |||
| 470 | JGI25153J46596_10000003 | |||
| 471 | JGI25153J46596_10044922 | |||
| 472 | rootH1_10037490 | |||
| 473 | rootH2_10070538 | |||
| 474 | rootL2_10053663 | |||
| 475 | rootH1_10012160 | |||
| 476 | rootH1_10066160 | |||
| 477 | rootH1_10372807 | |||
| 478 | Ga0055525_1000006 | |||
| 479 | Ga0055529_1000032 | |||
| 480 | Ga0055526_1000018 | |||
| 481 | Ga0055526_1000053 | |||
| 482 | Ga0055524_1000117 | |||
| 483 | Ga0055524_1010128 | |||
| 484 | Ga0055531_10007937 | |||
| 485 | Ga0065165_1001148 | |||
| 486 | Ga0065714_10129780 | |||
| 487 | Ga0070658_10194266 | |||
| 488 | Ga0070658_10303088 | |||
| 489 | Ga0070660_100021556 | |||
| 490 | Ga0070660_100022811 | |||
| 491 | Ga0070659_100000100 | |||
| 492 | Ga0070659_100048416 | |||
| 493 | Ga0068855_100046437 | |||
| 494 | Ga0068855_100456097 | |||
| 495 | Ga0068856_100039759 | |||
| 496 | Ga0068852_100064530 | |||
| 497 | Ga0097621_100011021 | |||
| 498 | Ga0075370_10035845 | |||
| 499 | Ga0068871_100061566 | |||
| 500 | Ga0068865_100129450 | |||
| 501 | Ga0099824_1042644 | |||
| 502 | Ga0099823_1004640 | |||
| 503 | Ga0079104_1012985 | |||
| 504 | Ga0105244_10000054 | |||
| 505 | Ga0105244_10002743 | |||
| 506 | Ga0105244_10020002 | |||
| 507 | Ga0105244_10032373 | |||
| 508 | Ga0105243_10097085 | |||
| 509 | Ga0105241_10045454 | |||
| 510 | Ga0105242_10053440 | |||
| 511 | Ga0105242_10093241 | |||
| 512 | Ga0157319_1000026 | |||
| 513 | Ga0157373_10002256 | |||
| 514 | Ga0157371_10000014 | |||
| 515 | Ga0157371_10182386 | |||
| 516 | Ga0157370_10013430 | |||
| 517 | Ga0157370_10014601 | |||
| 518 | Ga0157369_10001134 | |||
| 519 | Ga0157369_10206748 | |||
| 520 | Ga0157378_10015102 | |||
| 521 | Ga0163162_10396344 | |||
| 522 | Ga0157372_10000099 | |||
| 523 | Ga0157372_10082994 | |||
| 524 | Ga0157372_10097316 | |||
| 525 | Ga0182008_10015609 | |||
| 526 | Ga0182006_1000007 | |||
| 527 | Ga0182006_1000040 | |||
| 528 | Ga0182006_1000080 | |||
| 529 | Ga0182007_10000120 | |||
| 530 | Ga0182005_1000010 | |||
| 531 | Ga0182005_1000051 | |||
| 532 | Ga0163161_10003856 | |||
| 533 | Ga0163161_10009421 | |||
| 534 | Ga0213872_10033396 | |||
| 535 | Ga0209563_100022 | |||
| 536 | Ga0209437_102557 | |||
| 537 | Ga0207425_1000004 | |||
| 538 | Ga0207425_1000326 | |||
| 539 | Ga0209646_1000051 | |||
| 540 | Ga0209026_1000762 | |||
| 541 | Ga0209677_107524 | |||
| 542 | Ga0209148_1000678 | |||
| 543 | Ga0209129_1000005 | |||
| 544 | Ga0209455_1000043 | |||
| 545 | Ga0209673_1003819 | |||
| 546 | Ga0209673_1013141 | |||
| 547 | Ga0209130_1000078 | |||
| 548 | Ga0209025_1000009 | |||
| 549 | Ga0209025_1001273 | |||
| 550 | Ga0209564_1000011 | |||
| 551 | Ga0209564_1000068 | |||
| 552 | Ga0209758_1000010 | |||
| 553 | Ga0209758_1000568 | |||
| 554 | Ga0209256_1000075 | |||
| 555 | Ga0209256_1000267 | |||
| 556 | Ga0209256_1037285 | |||
| 557 | Ga0209051_1004058 | |||
| 558 | Ga0209257_1000244 | |||
| 559 | Ga0209257_1003739 | |||
| 560 | Ga0207655_1000003 | |||
| 561 | Ga0207655_1003729 | |||
| 562 | Ga0207655_1018587 | |||
| 563 | Ga0207655_1057721 | |||
| 564 | Ga0207705_10005752 | |||
| 565 | Ga0207705_10163296 | |||
| 566 | Ga0207654_10118734 | |||
| 567 | Ga0207657_10025414 | |||
| 568 | Ga0207657_10029637 | |||
| 569 | Ga0207657_10087231 | |||
| 570 | Ga0207690_10000609 | |||
| 571 | Ga0207690_10032662 | |||
| 572 | Ga0207686_10086728 | |||
| 573 | Ga0207709_10029114 | |||
| 574 | Ga0207704_10109272 | |||
| 575 | Ga0207689_10532341 | |||
| 576 | Ga0207667_10283647 | |||
| 577 | Ga0207667_10413266 | |||
| 578 | Ga0207648_10213590 | |||
| 579 | Ga0207648_10368154 | |||
| 580 | Ga0207698_10110500 | |||
| 581 | Ga0307515_10000007 | |||
| 582 | Ga0307515_10017272 | |||
| 583 | Ga0316177_1157343 | |||
| 584 | Ga0316182_1168160 | |||
| 585 | Ga0307408_100001079 | |||
| 586 | Ga0307414_10004089 | |||
| 587 | Ga0307510_10006279 | |||
| 588 | Ga0395899_0000001 | |||
| 589 | Ga0395899_0000245 | |||
| 590 | Ga0395899_0000315 | |||
| 591 | Ga0395900_0000202 | |||
| 592 | Ga0395900_0001818 | |||
| 593 | Ga0395900_0005977 | |||
| 594 | Ga0395900_0090199 | |||
| 595 | Ga0395900_0148981 | |||
| 596 | Ga0395900_0149960 | |||
| 597 | Ga0395900_0172989 | |||
| 598 | Ga0395900_0293331 | |||
| 599 | Ga0395898_0436524 | |||
| 600 | Ga0395905_0014150 | |||
| 601 | Ga0395905_0224537 | |||
| 602 | Ga0395901_0000019 | |||
| 603 | Ga0395901_0002353 | |||
| 604 | Ga0395901_0350500 | |||
| 605 | Ga0395901_0377931 | |||
| 606 | Ga0395901_0508601 | |||
| 607 | Ga0436361_0441859 | |||
| 608 | Ga0439448_0003221 | |||
| 609 | Ga0439450_022102 | |||
| 610 | Ga0466969_0009972 | |||
| 611 | Ga0466972_0000017 | |||
| 612 | Ga0466965_0008650 | |||
| 613 | Ga0466965_0054971 | |||
| 614 | Ga0466965_0167181 | |||
| 615 | Ga0466966_0026820 | |||
| 616 | Ga0466966_0030013 | |||
| 617 | Ga0466961_0006446 | |||
| 618 | Ga0466961_0117053 | |||
| 619 | Ga0466963_0012720 | |||
| 620 | Ga0466964_0001250 | |||
| 621 | Ga0466968_0000207 | |||
| 622 | Ga0466957_0001749 | |||
| 623 | Ga0466957_0073547 | |||
| 624 | Ga0466959_0051216 | |||
| 625 | Ga0466959_0162763 | |||
| 626 | Ga0466959_0269149 | |||
| 627 | Ga0466967_0147943 | |||
| 628 | Ga0466967_0358367 | |||
| 629 | Ga0495617_000003 | |||
| 630 | Ga0495627_000008 | |||
| 631 | Ga0495627_000011 | |||
| 632 | Ga0495627_020416 | |||
| 633 | Ga0495603_0033801 | |||
| 634 | Ga0495590_0000001 | |||
| 635 | Ga0495590_0000512 | |||
| 636 | Ga0495590_0007095 | |||
| 637 | Ga0495638_0000017 | |||
| 638 | Ga0495638_0011980 | |||
| 639 | Ga0495638_0038606 | |||
| 640 | Ga0495638_0093266 | |||
| 641 | Ga0495638_0119826 | |||
| 642 | Ga0495653_0000002 | |||
| 643 | Ga0495653_0054284 | |||
| 644 | Ga0495650_0000001 | |||
| 645 | Ga0495650_0000072 | |||
| 646 | Ga0495650_0000434 | |||
| 647 | Ga0495650_0001400 | |||
| 648 | Ga0495650_0005904 | |||
| 649 | Ga0495650_0012300 | |||
| 650 | Ga0495650_0014983 | |||
| 651 | Ga0495605_0000065 | |||
| 652 | Ga0495605_0000103 | |||
| 653 | Ga0495605_0010428 | |||
| 654 | Ga0495605_0014301 | |||
| 655 | Ga0495605_0027683 | |||
| 656 | Ga0495605_0053979 | |||
| 657 | Ga0495584_0000182 | |||
| 658 | Ga0495584_0000589 | |||
| 659 | Ga0495584_0006047 | |||
| 660 | Ga0495584_0007217 | |||
| 661 | Ga0495584_0057690 | |||
| 662 | Ga0495584_0102756 | |||
| 663 | Ga0495585_0000154 | |||
| 664 | Ga0495585_0001370 | |||
| 665 | Ga0495585_0017794 | |||
| 666 | Ga0495585_0037212 | |||
| 667 | Ga0495585_0038580 | |||
| 668 | Ga0495585_0039203 | |||
| 669 | Ga0495585_0066781 | |||
| 670 | Ga0495585_0111266 | |||
| 671 | Ga0495585_0156806 | |||
| 672 | Ga0495596_0005761 | |||
| 673 | Ga0495596_0007923 | |||
| 674 | Ga0495607_0001832 | |||
| 675 | Ga0495607_0002956 | |||
| 676 | Ga0495607_0008276 | |||
| 677 | Ga0495607_0018840 | |||
| 678 | Ga0495607_0020760 | |||
| 679 | Ga0495607_0087426 | |||
| 680 | Ga0495607_0129276 | |||
| 681 | Ga0495583_0000050 | |||
| 682 | Ga0495583_0000250 | |||
| 683 | Ga0495583_0002249 | |||
| 684 | Ga0495583_0033367 | |||
| 685 | Ga0495606_0000001 | |||
| 686 | Ga0495606_0000030 | |||
| 687 | Ga0495606_0007668 | |||
| 688 | Ga0495606_0028869 | |||
| 689 | Ga0495610_0000003 | |||
| 690 | Ga0495610_0000275 | |||
| 691 | Ga0495610_0003187 | |||
| 692 | Ga0495610_0005970 | |||
| 693 | Ga0495610_0012792 | |||
| 694 | Ga0495616_0000012 | |||
| 695 | Ga0495616_0004620 | |||
| 696 | Ga0495616_0018003 | |||
| 697 | Ga0495616_0038695 | |||
| 698 | Ga0495631_0000214 | |||
| 699 | Ga0495631_0002741 | |||
| 700 | Ga0495632_0000117 | |||
| 701 | Ga0495632_0000151 | |||
| 702 | Ga0495632_0000367 | |||
| 703 | Ga0495632_0009091 | |||
| 704 | Ga0495632_0078743 | |||
| 705 | Ga0495637_0000042 | |||
| 706 | Ga0495637_0045364 | |||
| 707 | Ga0495643_0000028 | |||
| 708 | Ga0495643_0000285 | |||
| 709 | Ga0495643_0002743 | |||
| 710 | Ga0495643_0010394 | |||
| 711 | Ga0495643_0016884 | |||
| 712 | Ga0495643_0098007 | |||
| 713 | Ga0495643_0172550 | |||
| 714 | Ga0495644_0019399 | |||
| 715 | Ga0495644_0023527 | |||
| 716 | Ga0495644_0048011 | |||
| 717 | Ga0495648_0000001 | |||
| 718 | Ga0495648_0001299 | |||
| 719 | Ga0495648_0002750 | |||
| 720 | Ga0495648_0003706 | |||
| 721 | Ga0495648_0004046 | |||
| 722 | Ga0495648_0004835 | |||
| 723 | Ga0495648_0008621 | |||
| 724 | Ga0495648_0022743 | |||
| 725 | Ga0495648_0050683 | |||
| 726 | Ga0495648_0053956 | |||
| 727 | Ga0495642_0000091 | |||
| 728 | Ga0495642_0001217 | |||
| 729 | Ga0495642_0024534 | |||
| 730 | Ga0495642_0031965 | |||
| 731 | Ga0495654_0000037 | |||
| 732 | Ga0495654_0032959 | |||
| 733 | Ga0495654_0033389 | |||
| 734 | Ga0495587_0045810 | |||
| 735 | Ga0495609_0000026 | |||
| 736 | Ga0495609_0000979 | |||
| 737 | Ga0495609_0001294 | |||
| 738 | Ga0495609_0033585 | |||
| 739 | Ga0495597_0000314 | |||
| 740 | Ga0495597_0000785 | |||
| 741 | Ga0495597_0002465 | |||
| 742 | Ga0495597_0007122 | |||
| 743 | Ga0495597_0020310 | |||
| 744 | Ga0495597_0021450 | |||
| 745 | Ga0495597_0077676 | |||
| 746 | Ga0495645_0136787 | |||
| 747 | Ga0495622_0000001 | |||
| 748 | Ga0495622_0000131 | |||
| 749 | Ga0495622_0017966 | |||
| 750 | Ga0495633_0000106 | |||
| 751 | Ga0495633_0000675 | |||
| 752 | Ga0495633_0022630 | |||
| 753 | Ga0495633_0034438 | |||
| 754 | Ga0495633_0054698 | |||
| 755 | Ga0495656_0023597 | |||
| 756 | Ga0495668_0000190 | |||
| 757 | Ga0495668_0000666 | |||
| 758 | Ga0495668_0000686 | |||
| 759 | Ga0495668_0001174 | |||
| 760 | Ga0495668_0001982 | |||
| 761 | Ga0495668_0002092 | |||
| 762 | Ga0495668_0002207 | |||
| 763 | Ga0495668_0159284 | |||
| 764 | Ga0495611_0000151 | |||
| 765 | Ga0495625_0000035 | |||
| 766 | Ga0495625_0000391 | |||
| 767 | Ga0495625_0005884 | |||
| 768 | Ga0495625_0032458 | |||
| 769 | Ga0495625_0048352 | |||
| 770 | Ga0495625_0153739 | |||
| 771 | Ga0495661_0000408 | |||
| 772 | Ga0495661_0003698 | |||
| 773 | Ga0495661_0010298 | |||
| 774 | Ga0495661_0012654 | |||
| 775 | Ga0495661_0015295 | |||
| 776 | Ga0495661_0025710 | |||
| 777 | Ga0495661_0064420 | |||
| 778 | Ga0495661_0138462 | |||
| 779 | Ga0495661_0147323 | |||
| 780 | Ga0495661_0172485 | |||
| 781 | Ga0495661_0188850 | |||
| 782 | Ga0495588_0000139 | |||
| 783 | Ga0495669_0004286 | |||
| 784 | Ga0495670_0020058 | |||
| 785 | Ga0495671_0000010 | |||
| 786 | Ga0495671_0004463 | |||
| 787 | Ga0495671_0024354 | |||
| 788 | Ga0495649_0002113 | |||
| 789 | Ga0495649_0069162 | |||
| 790 | Ga0495589_0000073 | |||
| 791 | Ga0495589_0000100 | |||
| 792 | Ga0495589_0012082 | |||
| 793 | Ga0495660_0000027 | |||
| 794 | Ga0495660_0000187 | |||
| 795 | Ga0495660_0000335 | |||
| 796 | Ga0495660_0000555 | |||
| 797 | Ga0495660_0000752 | |||
| 798 | Ga0495660_0004846 | |||
| 799 | Ga0495660_0011293 | |||
| 800 | Ga0495660_0016170 | |||
| 801 | Ga0495660_0020359 | |||
| 802 | Ga0495660_0021900 | |||
| 803 | Ga0495660_0113468 | |||
| 804 | Ga0495672_0000165 | |||
| 805 | Ga0495672_0000400 | |||
| 806 | Ga0495672_0045448 | |||
| 807 | Ga0495680_0057298 | |||
| 808 | Ga0495683_0014282 | |||
| 809 | Ga0495683_0023605 | |||
| 810 | Ga0495687_000012 | |||
| 811 | Ga0495687_000037 | |||
| 812 | Ga0495687_000122 | |||
| 813 | Ga0495687_001008 | |||
| 814 | Ga0495687_001859 | |||
| 815 | Ga0495687_002318 | |||
| 816 | Ga0495687_049876 | |||
| 817 | Ga0495675_0048443 | |||
| 818 | Ga0495677_0000014 | |||
| 819 | Ga0495677_0002215 | |||
| 820 | Ga0495677_0011273 | |||
| 821 | Ga0495679_000603 | |||
| 822 | Ga0495679_003356 | |||
| 823 | Ga0495679_017325 | |||
| 824 | Ga0495685_056855 | |||
| 825 | Ga0495673_0000003 | |||
| 826 | Ga0495673_0000016 | |||
| 827 | Ga0495673_0000035 | |||
| 828 | Ga0495681_0000021 | |||
| 829 | Ga0495681_0003295 | |||
| 830 | Ga0495681_0003738 | |||
| 831 | Ga0495681_0007118 | |||
| 832 | Ga0495681_0054731 | |||
| 833 | Ga0495686_0032283 | |||
| 834 | Ga0495686_0213153 | |||
| 835 | Ga0495626_0000222 | |||
| 836 | Ga0495626_0003930 | |||
| 837 | Ga0495626_0015346 | |||
| 838 | Ga0495626_0023441 | |||
| 839 | Ga0495626_0028683 | |||
| 840 | Ga0495626_0030870 | |||
| 841 | Ga0495626_0039987 | |||
| 842 | Ga0495626_0066055 | |||
| 843 | Ga0495626_0079461 | |||
| 844 | Ga0496100_0321177 | |||
| 845 | Ga0496103_0003052 | |||
| 846 | Ga0496103_0072931 | |||
| 847 | Ga0496105_0353669 | |||
| 848 | Ga0496106_0007416 | |||
| 849 | Ga0496107_0177834 | |||
| 850 | Ga0496107_0185306 | |||
| 851 | Ga0496109_0278338 | |||
| 852 | Ga0496110_0000026 | |||
| 853 | Ga0496113_0007190 | |||
| 854 | Ga0496116_0026414 | |||
| 855 | Ga0496117_0000005 | |||
| 856 | Ga0496118_0000022 | |||
| 857 | Ga0496119_0159158 | |||
| 858 | Ga0496121_0011949 | |||
| 859 | Ga0496121_0017125 | |||
| 860 | Ga0496121_0083355 | |||
| 861 | Ga0496122_0001081 | |||
| 862 | Ga0496122_0016946 | |||
| 863 | Ga0496122_0021359 | |||
| 864 | Ga0496122_0042580 | |||
| 865 | Ga0496123_0001385 | |||
| 866 | Ga0496123_0003098 | |||
| 867 | Ga0496123_0004351 | |||
| 868 | Ga0496123_0041420 | |||
| 869 | Ga0496124_0029154 | |||
| 870 | Ga0496124_0038593 | |||
| 871 | Ga0496124_0054723 | |||
| 872 | Ga0496124_0112439 | |||
| 873 | Ga0496124_0138455 | |||
| 874 | Ga0496125_0070349 | |||
| 875 | Ga0495678_000002 | |||
| 876 | Ga0495678_000010 | |||
| 877 | Ga0495678_000029 | |||
| 878 | Ga0495678_000045 | |||
| 879 | Ga0495678_001464 | |||
| 880 | Ga0495678_008318 | |||
| 881 | Ga0495682_0000082 | |||
| 882 | Ga0495682_0002171 | |||
| 883 | Ga0501249_000002 | |||
| 884 | Ga0501249_001714 | |||
| 885 | Ga0501269_000010 | |||
| 886 | Ga0500644_0000021 | |||
| 887 | Ga0500651_0026394 | |||
| 888 | Ga0500641_0000142 | |||
| 889 | Ga0500562_000033 | |||
| 890 | Ga0500618_000068 | |||
| 891 | Ga0500618_035483 | |||
| 892 | Ga0500658_0000015 | |||
| 893 | Ga0500586_000133 | |||
| 894 | Ga0500586_053653 | |||
| 895 | Ga0500584_017230 | |||
| 896 | 2601671300 | |||
| 897 | 2643801485 | |||
| 898 | 2644012070 | |||
| 899 | 2644471453 | |||
| 900 | 2738733850 | |||
| 901 | 2738759337 | |||
| 902 | 2738766193 | |||
| 903 | 2738829899 | |||
| 904 | 2739153695 | |||
| 905 | 2739195615 | |||
| 906 | 2739215431 | |||
| 907 | 2739303194 | |||
| 908 | 2739322091 | |||
| 909 | 2739340332 | |||
| 910 | 2739617141 | |||
| 911 | 2739644649 | |||
| 912 | 2833641822 | |||
| 913 | 2842715533 | |||
| 914 | 2857548860 | |||
| 915 | 2857555910 | |||
| 916 | 2857557819 | |||
| 917 | 2857566922 | |||
| 918 | 2857621450 | |||
| 919 | 2881361500 | |||
| 920 | 2885080341 | |||
| 921 | 2886851939 | |||
| 922 | 2904425705 | |||
| 923 | 2914761378 | |||
| 924 | 2919478244 | |||
| 925 | 2932415443 | |||
| 926 | 2932421396 | |||
| 927 | 2958512636 | |||
| 928 | 8047677211 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3qee-assembly2.cif.gz_B | the structure and function of an arabinan-specific alpha-1,2-arabinofuranosidase identified from screening the activities of bacterial gh43 glycoside hydrolases | 0.9761 | 30 | 322 |
| 3qef-assembly1.cif.gz_A | the structure and function of an arabinan-specific alpha-1,2-arabinofuranosidase identified from screening the activities of bacterial gh43 glycoside hydrolases | 0.9737 | 31 | 322 |
| 3qef-assembly1.cif.gz_A | the structure and function of an arabinan-specific alpha-1,2-arabinofuranosidase identified from screening the activities of bacterial gh43 glycoside hydrolases | 0.9576 | 31 | 322 |
| 3qee-assembly2.cif.gz_B | the structure and function of an arabinan-specific alpha-1,2-arabinofuranosidase identified from screening the activities of bacterial gh43 glycoside hydrolases | 0.9536 | 30 | 322 |
| 8hcj-assembly2.cif.gz_F | structure of gh43 family enzyme, xylan 1, 4 beta- xylosidase from pseudopedobacter saltans | 0.9116 | 31 | 320 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3qefB00 | Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 | 0.9735 | 30 | 322 | 2.115.10.20 |
| 3qefB00 | Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 | 0.9574 | 30 | 322 | 2.115.10.20 |
| 4novA00 | Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 | 0.8704 | 23 | 320 | 2.115.10.20 |
| 4novA00 | Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 | 0.862 | 23 | 320 | 2.115.10.20 |
| 5glmA00 | Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 | 0.8589 | 24 | 310 | 2.115.10.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-S0DDZ8-F1-model_v4 | non-reducing end alpha-L-arabinofuranosidase (EC 3.2.1.55) | 0.9839 | 22 | 318 |
GO:0046373
GO:0046556 |
| AF-A0A1B9DYK2-F1-model_v4 | Glycoside hydrolase | 0.9836 | 31 | 319 |
GO:0004553
GO:0045493 |
| AF-A0A4Q5QWV5-F1-model_v4 | Glycoside hydrolase | 0.9827 | 31 | 261 |
GO:0004553
GO:0045493 |
| AF-A0A7K1SZ81-F1-model_v4 | Family 43 glycosylhydrolase | 0.9822 | 23 | 322 |
GO:0004553
GO:0045493 |
| AF-A0A4Q5YTP3-F1-model_v4 | Glycoside hydrolase | 0.9821 | 54 | 322 |
GO:0004553
GO:0045493 |