F449398

General Info

Members Datasets Scaffolds Average Seq Length
464 338 928 750

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221584|2643928918
Length 905
Sequence RSPKSSKFPAASPKGGKVAKPPAGLPDRETLLAFLRDAGESGKADIARHFGLKGADRRALREMLRALEADGSLGKRGRRGFAEAGSLPPVGVVDVVERDADGDLYVRLTKGGEDLPQVRLAPGKGEAAGGAPGMGDRLLVHFEQLESGETEARLIKRLGQSAHKLLGVVRKHRRETRVEPVDRKSKESLLIDNQAAEGLKEGDLVLAQVSGAGARYGPKFGKILEVLGSEDDPRAASLIAIHSHGIPTGFSEEAEAEAGAAQPPTLEGRDDLRDLPFVTIDPVDARDHDDAVYAHPDPDAGNVGGWVVWVAIADVAAYVRPGSALDRDAREKGNSVYFPDRVEPMLPETLSNGLCSLREGENRATLAVRMVFDATGRKKSHKFVRGLMRSAAKLSYEQAQAAIDGVAPPDGQDADKAGPLLDPILKPLWTAFRLMGKGREARSPLAIESDERRIVIREGEIQSITRRASLEAHKLIEEMMIQANVSAAETLEAKRLPLIYRVHDTPSQEKVMSLVEFLQTLEIKWSKGEAPTTARFNKLLDDTRESPHAAIINEVVLRTQMQAHYSSDNLGHFGLNLARYAHFTSPIRRYADLIVHRALIRALNLGTDGLTDQDISQIKDTAEVITHAERRAMAAERDATDRYIAAFLADRVGATFTGRITGVTRFGLFVKLDETGADGLVPVSTLGEEYFVHDDRMHALVGERTGKRFPLGLAVEVRLREATPVTGGLLFEMLTDALPADPKAPRPRLGVRARTPVKPRGGLPKGVRRGKRKXXXXXGGGGGGGYTLTDFTRPLCRHAVGRFTPSPSQASLGPLPLPMGEGSQGRTVRAAASSRSAIIVWSAIDGCQSQALRSMPVIRTGVARPGVSASTAWTTASTSAAKLSPAISRNFAWGWRRARSRMKPA

Samples

Sample ID Description Type Environment
1 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
2 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
98 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
162 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
165 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
172 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
185 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
186 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
187 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
191 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
197 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
198 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
199 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
200 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
203 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
204 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
205 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
206 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
214 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
217 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
218 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
219 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
220 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
234 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
235 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
242 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
258 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
259 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
260 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
261 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
269 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
270 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
271 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
275 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
276 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
277 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
278 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
279 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
280 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
281 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
282 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
283 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
284 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
285 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
286 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
287 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
288 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
289 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
290 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
291 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
292 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
293 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
294 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
295 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
296 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
298 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
299 2643221584 Caulobacter sp. Root656 Isolate Unclassified
300 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
301 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
302 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
303 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
304 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
305 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
306 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
307 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
308 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
309 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
310 2643221583 Caulobacter sp. Root655 Isolate Unclassified
311 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
312 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
313 2643221640 Caulobacter sp. Root342 Isolate Unclassified
314 2643221642 Caulobacter sp. Root343 Isolate Unclassified
315 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
316 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
317 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
318 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
319 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
320 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
321 2818991435 Caulobacter henricii 536 Isolate Unclassified
322 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
323 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
324 2849560528 Caulobacter zeae 410 Isolate Unclassified
325 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
326 2851153111 Caulobacter radicis 736 Isolate Unclassified
327 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
328 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
329 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
330 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
331 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
332 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
333 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
334 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
335 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
336 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
337 641522639 Methylobacterium sp. 4-46 Isolate Nodule
338 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.16
Metatranscriptomes 0
Isolates 8.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.28
Nodule 0.65
Rhizoplane 5.39
Rhizosphere 72.2
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055536_1000987 3300003781 Bacteria 18050
2 Ga0055530_10001456 3300003791 Bacteria 17252
3 Ga0055531_10001343 3300003794 Bacteria 18367
4 Ga0055531_10007312 3300003794 Bacteria 6053
5 Ga0065165_1000210 3300005262 Bacteria 101721
6 Ga0065165_1001315 3300005262 Bacteria 27750
7 Ga0070658_10009327 3300005327 Bacteria 7888
8 Ga0070690_100009151 3300005330 Bacteria 5732
9 Ga0070670_100020452 3300005331 Bacteria 5690
10 Ga0070670_100071813 3300005331 Bacteria 2972
11 Ga0070666_10001864 3300005335 Bacteria 12823
12 Ga0070680_100007270 3300005336 Bacteria 8439
13 Ga0070680_100030191 3300005336 Bacteria 4354
14 Ga0070682_100000573 3300005337 Bacteria 22607
15 Ga0070689_100000136 3300005340 Bacteria 42853
16 Ga0070691_10000418 3300005341 Bacteria 15566
17 Ga0070687_100002559 3300005343 Bacteria 6862
18 Ga0070661_100002616 3300005344 Bacteria 12337
19 Ga0070692_10002091 3300005345 Bacteria 7619
20 Ga0070668_100000188 3300005347 Bacteria 40404
21 Ga0070668_100004770 3300005347 Bacteria 10057
22 Ga0070668_100008308 3300005347 Bacteria 7706
23 Ga0070668_100011123 3300005347 Bacteria 6700
24 Ga0070668_100057108 3300005347 Bacteria 3016
25 Ga0070669_100001556 3300005353 Bacteria 16608
26 Ga0070675_100003757 3300005354 Bacteria 11530
27 Ga0070671_100002522 3300005355 Bacteria 14189
28 Ga0070671_100014389 3300005355 Bacteria 6392
29 Ga0070671_100049487 3300005355 Bacteria 3496
30 Ga0070674_100000832 3300005356 Bacteria 15947
31 Ga0070673_100007489 3300005364 Bacteria 7206
32 Ga0070688_100000981 3300005365 Bacteria 14298
33 Ga0070659_100003308 3300005366 Bacteria 11481
34 Ga0070659_100018771 3300005366 Bacteria 5220
35 Ga0070667_100001681 3300005367 Bacteria 19789
36 Ga0070667_100073353 3300005367 Bacteria 2918
37 Ga0070709_10006653 3300005434 Bacteria 6309
38 Ga0070714_100021168 3300005435 Bacteria 5318
39 Ga0070713_100004713 3300005436 Bacteria 9214
40 Ga0070710_10001222 3300005437 Bacteria 12161
41 Ga0070711_100000961 3300005439 Bacteria 15267
42 Ga0070705_100000300 3300005440 Bacteria 29369
43 Ga0070694_100000659 3300005444 Bacteria 19066
44 Ga0070663_100001220 3300005455 Bacteria 14123
45 Ga0070678_100000123 3300005456 Bacteria 30745
46 Ga0070678_100059622 3300005456 Bacteria 2806
47 Ga0070662_100000339 3300005457 Bacteria 28034
48 Ga0070681_10018656 3300005458 Bacteria 6938
49 Ga0070681_10048740 3300005458 Bacteria 4232
50 Ga0070681_10052521 3300005458 Bacteria 4065
51 Ga0068867_100005776 3300005459 Bacteria 8778
52 Ga0070699_100049738 3300005518 Bacteria 3628
53 Ga0070679_100004727 3300005530 Bacteria 12560
54 Ga0070679_100113678 3300005530 Bacteria 2692
55 Ga0070684_100014306 3300005535 Bacteria 6424
56 Ga0070697_100003199 3300005536 Bacteria 12577
57 Ga0068853_100002127 3300005539 Bacteria 14736
58 Ga0068853_100037667 3300005539 Bacteria 4115
59 Ga0068853_100060126 3300005539 Bacteria 3282
60 Ga0070686_100003722 3300005544 Bacteria 8381
61 Ga0070695_100000995 3300005545 Bacteria 15425
62 Ga0070693_100000993 3300005547 Bacteria 12644
63 Ga0070665_100000121 3300005548 Bacteria 147683
64 Ga0070665_100011802 3300005548 Bacteria 8824
65 Ga0070665_100064235 3300005548 Bacteria 3681
66 Ga0070704_100000607 3300005549 Bacteria 17259
67 Ga0070704_100037711 3300005549 Bacteria 3305
68 Ga0068855_100003471 3300005563 Bacteria 19298
69 Ga0068855_100029068 3300005563 Bacteria 6610
70 Ga0070664_100017429 3300005564 Bacteria 5897
71 Ga0068856_100004777 3300005614 Bacteria 13428
72 Ga0070702_100000022 3300005615 Bacteria 44333
73 Ga0070702_100007136 3300005615 Bacteria 5336
74 Ga0068859_100000401 3300005617 Bacteria 43052
75 Ga0068859_100007821 3300005617 Bacteria 10850
76 Ga0068859_100008488 3300005617 Bacteria 10394
77 Ga0068864_100001763 3300005618 Bacteria 17776
78 Ga0068864_100004252 3300005618 Bacteria 11784
79 Ga0068866_10004814 3300005718 Bacteria 5542
80 Ga0068861_100001574 3300005719 Bacteria 14514
81 Ga0068863_100000367 3300005841 Bacteria 45948
82 Ga0068863_100001307 3300005841 Bacteria 24847
83 Ga0068863_100012729 3300005841 Bacteria 8112
84 Ga0068858_100000219 3300005842 Bacteria 61717
85 Ga0068858_100001450 3300005842 Bacteria 24400
86 Ga0068860_100000055 3300005843 Bacteria 203538
87 Ga0068860_100001852 3300005843 Bacteria 22494
88 Ga0068862_100002363 3300005844 Bacteria 16799
89 Ga0081455_10002778 3300005937 Bacteria 20623
90 Ga0081455_10014016 3300005937 Bacteria 7879
91 Ga0075364_10001667 3300006051 Bacteria 12181
92 Ga0070715_10000079 3300006163 Bacteria 26581
93 Ga0070716_100001144 3300006173 Bacteria 11698
94 Ga0070712_100011410 3300006175 Bacteria 5633
95 Ga0075367_10003590 3300006178 Bacteria 7427
96 Ga0075366_10005401 3300006195 Bacteria 6924
97 Ga0075428_100064350 3300006844 Bacteria 4016
98 Ga0075429_100056071 3300006880 Bacteria 3429
99 Ga0068865_100001515 3300006881 Bacteria 13546
100 Ga0068865_100002767 3300006881 Bacteria 10421
101 Ga0075436_100007838 3300006914 Bacteria 7305
102 Ga0097620_100000401 3300006931 Bacteria 43052
103 Ga0097620_100007821 3300006931 Bacteria 10850
104 Ga0097620_100008488 3300006931 Bacteria 10394
105 Ga0105240_10059050 3300009093 Bacteria 4788
106 Ga0105240_10084081 3300009093 Bacteria 3903
107 Ga0105245_10002367 3300009098 Bacteria 17040
108 Ga0105247_10001141 3300009101 Bacteria 19671
109 Ga0105247_10026785 3300009101 Bacteria 3484
110 Ga0114129_10134978 3300009147 Bacteria 3386
111 Ga0105243_10000417 3300009148 Bacteria 44794
112 Ga0105241_10000456 3300009174 Bacteria 30774
113 Ga0105242_10002247 3300009176 Bacteria 15232
114 Ga0105248_10000293 3300009177 Bacteria 59383
115 Ga0105248_10001413 3300009177 Bacteria 26833
116 Ga0105248_10015712 3300009177 Bacteria 8344
117 Ga0105248_10028939 3300009177 Bacteria 6177
118 Ga0105237_10000712 3300009545 Bacteria 46011
119 Ga0105238_10056706 3300009551 Bacteria 3929
120 Ga0105249_10000591 3300009553 Bacteria 33149
121 Ga0105239_10036997 3300010375 Bacteria 5354
122 Ga0105239_10041715 3300010375 Bacteria 5028
123 Ga0105239_10073938 3300010375 Bacteria 3747
124 Ga0105246_10000118 3300011119 Bacteria 35893
125 Ga0157373_10001230 3300013100 Bacteria 19573
126 Ga0157373_10001673 3300013100 Bacteria 16931
127 Ga0157371_10002724 3300013102 Bacteria 16644
128 Ga0157371_10005561 3300013102 Bacteria 10597
129 Ga0157369_10032544 3300013105 Bacteria 5733
130 Ga0157374_10004169 3300013296 Bacteria 12136
131 Ga0157378_10000643 3300013297 Bacteria 32822
132 Ga0163162_10018088 3300013306 Bacteria 6898
133 Ga0163162_10094427 3300013306 Bacteria 3077
134 Ga0157372_10001248 3300013307 Bacteria 27510
135 Ga0157375_10002203 3300013308 Bacteria 16841
136 Ga0157375_10002372 3300013308 Bacteria 16296
137 Ga0163163_10005028 3300014325 Bacteria 11396
138 Ga0163163_10007000 3300014325 Bacteria 9906
139 Ga0157379_10000531 3300014968 Bacteria 30814
140 Ga0157379_10000933 3300014968 Bacteria 23653
141 Ga0157379_10071208 3300014968 Bacteria 3111
142 Ga0157376_10001069 3300014969 Bacteria 17936
143 Ga0163161_10003267 3300017792 Bacteria 11395
144 Ga0213876_10000108 3300021384 Bacteria 91222
145 Ga0209026_1003240 3300025250 Bacteria 5476
146 Ga0209565_1000469 3300025263 Bacteria 30315
147 Ga0209673_1001526 3300025273 Bacteria 21165
148 Ga0209675_1006670 3300025291 Bacteria 4583
149 Ga0209676_1000444 3300025292 Bacteria 70611
150 Ga0209676_1000691 3300025292 Bacteria 47509
151 Ga0209676_1001269 3300025292 Bacteria 26245
152 Ga0209676_1002398 3300025292 Bacteria 13402
153 Ga0209676_1005965 3300025292 Bacteria 6159
154 Ga0209564_1001610 3300025295 Bacteria 21907
155 Ga0209758_1001228 3300025297 Bacteria 32082
156 Ga0209758_1002410 3300025297 Bacteria 19155
157 Ga0209050_1000101 3300025298 Bacteria 230076
158 Ga0209050_1001896 3300025298 Bacteria 20030
159 Ga0209050_1005582 3300025298 Bacteria 7814
160 Ga0209256_1004179 3300025299 Bacteria 9305
161 Ga0209256_1004748 3300025299 Bacteria 8300
162 Ga0209256_1007832 3300025299 Bacteria 5135
163 Ga0209051_1005103 3300025303 Bacteria 7797
164 Ga0209257_1000187 3300025304 Bacteria 154077
165 Ga0209257_1000284 3300025304 Bacteria 112773
166 Ga0209257_1003467 3300025304 Bacteria 13476
167 Ga0209257_1005485 3300025304 Bacteria 8874
168 Ga0207692_10002406 3300025898 Bacteria 7175
169 Ga0207710_10001630 3300025900 Bacteria 10960
170 Ga0207688_10000764 3300025901 Bacteria 15995
171 Ga0207680_10007037 3300025903 Bacteria 5465
172 Ga0207647_10000924 3300025904 Bacteria 22626
173 Ga0207645_10004812 3300025907 Bacteria 9921
174 Ga0207705_10034512 3300025909 Bacteria 3617
175 Ga0207654_10019680 3300025911 Bacteria 3568
176 Ga0207707_10016493 3300025912 Bacteria 6441
177 Ga0207695_10001328 3300025913 Bacteria 41985
178 Ga0207695_10002756 3300025913 Bacteria 25626
179 Ga0207695_10009972 3300025913 Bacteria 11669
180 Ga0207695_10042812 3300025913 Bacteria 4831
181 Ga0207671_10007807 3300025914 Bacteria 9202
182 Ga0207693_10000703 3300025915 Bacteria 30046
183 Ga0207663_10001248 3300025916 Bacteria 11772
184 Ga0207662_10002213 3300025918 Bacteria 9693
185 Ga0207657_10000304 3300025919 Bacteria 52135
186 Ga0207649_10002403 3300025920 Bacteria 10501
187 Ga0207681_10002820 3300025923 Bacteria 11001
188 Ga0207681_10030272 3300025923 Bacteria 3527
189 Ga0207650_10015427 3300025925 Bacteria 5321
190 Ga0207687_10001882 3300025927 Bacteria 14454
191 Ga0207700_10057712 3300025928 Bacteria 2929
192 Ga0207664_10019851 3300025929 Bacteria 4974
193 Ga0207644_10001379 3300025931 Bacteria 15649
194 Ga0207644_10001431 3300025931 Bacteria 15367
195 Ga0207690_10003254 3300025932 Bacteria 9744
196 Ga0207690_10004214 3300025932 Bacteria 8497
197 Ga0207706_10000263 3300025933 Bacteria 57106
198 Ga0207686_10017602 3300025934 Bacteria 4030
199 Ga0207709_10004092 3300025935 Bacteria 8489
200 Ga0207669_10001156 3300025937 Bacteria 11247
201 Ga0207704_10002589 3300025938 Bacteria 8161
202 Ga0207665_10000219 3300025939 Bacteria 38754
203 Ga0207711_10000482 3300025941 Bacteria 41192
204 Ga0207711_10005353 3300025941 Bacteria 10870
205 Ga0207711_10019643 3300025941 Bacteria 5625
206 Ga0207661_10027776 3300025944 Bacteria 4327
207 Ga0207679_10006703 3300025945 Bacteria 7290
208 Ga0207667_10013210 3300025949 Bacteria 9468
209 Ga0207667_10015747 3300025949 Bacteria 8575
210 Ga0207651_10000820 3300025960 Bacteria 13434
211 Ga0207712_10008836 3300025961 Bacteria 6370
212 Ga0207668_10001837 3300025972 Bacteria 12384
213 Ga0207668_10018672 3300025972 Bacteria 4370
214 Ga0207668_10027208 3300025972 Bacteria 3724
215 Ga0207640_10016518 3300025981 Bacteria 4295
216 Ga0207658_10025129 3300025986 Bacteria 4169
217 Ga0207658_10029654 3300025986 Bacteria 3867
218 Ga0207703_10000659 3300026035 Bacteria 34587
219 Ga0207703_10005045 3300026035 Bacteria 10699
220 Ga0207703_10037175 3300026035 Bacteria 3879
221 Ga0207639_10001097 3300026041 Bacteria 18401
222 Ga0207678_10000209 3300026067 Bacteria 51832
223 Ga0207702_10007071 3300026078 Bacteria 9599
224 Ga0207641_10000070 3300026088 Bacteria 152598
225 Ga0207641_10002297 3300026088 Bacteria 17780
226 Ga0207641_10007322 3300026088 Bacteria 9193
227 Ga0207648_10013547 3300026089 Bacteria 7581
228 Ga0207676_10011604 3300026095 Bacteria 6299
229 Ga0207674_10000719 3300026116 Bacteria 43313
230 Ga0207675_100000482 3300026118 Bacteria 38782
231 Ga0207683_10000405 3300026121 Bacteria 39678
232 Ga0207698_10003577 3300026142 Bacteria 9380
233 Ga0209998_10003648 3300027717 Bacteria 3342
234 Ga0268266_10000106 3300028379 Bacteria 175109
235 Ga0268266_10012465 3300028379 Bacteria 7347
236 Ga0268265_10003719 3300028380 Bacteria 10850
237 Ga0268265_10011541 3300028380 Bacteria 5972
238 Ga0268264_10000112 3300028381 Bacteria 203742
239 Ga0307517_10009198 3300028786 Bacteria 14052
240 Ga0307515_10076207 3300028794 Bacteria 4455
241 Ga0265338_10022923 3300028800 Bacteria 6441
242 Ga0265327_10000568 3300031251 Bacteria 62780
243 Ga0265316_10040482 3300031344 Bacteria 3736
244 Ga0307513_10000162 3300031456 Bacteria 96000
245 Ga0307513_10002892 3300031456 Bacteria 23491
246 Ga0307513_10004143 3300031456 Bacteria 19418
247 Ga0307513_10033858 3300031456 Bacteria 5738
248 Ga0265314_10008757 3300031711 Bacteria 8650
249 Ga0307516_10000154 3300031730 Bacteria 85753
250 Ga0307406_10001747 3300031901 Bacteria 11912
251 Ga0307414_10030432 3300032004 Bacteria 3526
252 Ga0307414_10032967 3300032004 Bacteria 3417
253 Ga0307510_10074058 3300033180 Bacteria 3368
254 Ga0316574_0001826 3300035398 Bacteria 10358
255 Ga0373931_0007659 3300035691 Bacteria 5093
256 Ga0373931_0012143 3300035691 Bacteria 4170
257 Ga0373935_0073643 3300035692 Bacteria 2207
258 Ga0373927_0014733 3300035695 Bacteria 5170
259 Ga0373947_0002766 3300035725 Bacteria 10498
260 Ga0373925_0009090 3300037068 Bacteria 7232
261 Ga0395899_0000105 3300037312 Bacteria 146163
262 Ga0395899_0000187 3300037312 Bacteria 90916
263 Ga0395899_0054973 3300037312 Bacteria 2945
264 Ga0395900_0000009 3300037418 Bacteria 476249
265 Ga0395898_0003798 3300037466 Bacteria 16721
266 Ga0395898_0031278 3300037466 Bacteria 5320
267 Ga0395898_0047271 3300037466 Bacteria 4224
268 Ga0395905_0010042 3300037471 Bacteria 9227
269 Ga0395905_0027293 3300037471 Bacteria 5384
270 Ga0395901_0000412 3300038443 Bacteria 50385
271 Ga0395901_0027857 3300038443 Bacteria 5810
272 Ga0436365_1544656 3300039437 Bacteria 122419
273 Ga0436361_0196619 3300039447 Bacteria 31824
274 Ga0495627_001069 3300046453 Bacteria 18121
275 Ga0495603_0006609 3300046455 Bacteria 6955
276 Ga0495590_0004125 3300046457 Bacteria 5888
277 Ga0495629_0047944 3300046459 Bacteria 2996
278 Ga0495638_0000845 3300046460 Bacteria 32033
279 Ga0495638_0002190 3300046460 Bacteria 16335
280 Ga0495638_0007957 3300046460 Bacteria 7561
281 Ga0495641_0014235 3300046461 Bacteria 4314
282 Ga0495650_0000030 3300046471 Bacteria 436318
283 Ga0495580_0000835 3300046472 Bacteria 26710
284 Ga0495582_0013002 3300046473 Bacteria 4585
285 Ga0495639_0003675 3300046475 Bacteria 6606
286 Ga0495594_0000613 3300046499 Bacteria 18380
287 Ga0495583_0000002 3300046506 Bacteria 782521
288 Ga0495610_0000091 3300046512 Bacteria 105916
289 Ga0495610_0015694 3300046512 Bacteria 4391
290 Ga0495616_0000094 3300046513 Bacteria 75611
291 Ga0495631_0004438 3300046518 Bacteria 7473
292 Ga0495632_0005026 3300046519 Bacteria 8859
293 Ga0495643_0006008 3300046522 Bacteria 8098
294 Ga0495648_0000154 3300046524 Bacteria 81679
295 Ga0495654_0000048 3300046530 Bacteria 147348
296 Ga0495640_0057631 3300046533 Bacteria 2651
297 Ga0495622_0000576 3300046557 Bacteria 22007
298 Ga0495622_0011792 3300046557 Bacteria 4041
299 Ga0495633_0000683 3300046558 Bacteria 31294
300 Ga0495668_0000703 3300046616 Bacteria 40297
301 Ga0495634_0021531 3300046642 Bacteria 4555
302 Ga0495625_0000058 3300046660 Bacteria 180863
303 Ga0495625_0017730 3300046660 Bacteria 5569
304 Ga0495658_0005032 3300046683 Bacteria 6494
305 Ga0495669_0000196 3300046684 Bacteria 37390
306 Ga0495669_0000440 3300046684 Bacteria 19763
307 Ga0495613_0003198 3300046689 Bacteria 12258
308 Ga0495649_0000137 3300046694 Bacteria 63846
309 Ga0495672_0025974 3300047320 Bacteria 3743
310 Ga0495676_0006996 3300047321 Bacteria 10354
311 Ga0495680_0022388 3300047322 Bacteria 5267
312 Ga0495673_0001111 3300047469 Bacteria 23151
313 Ga0495686_0000023 3300047472 Bacteria 400457
314 Ga0495686_0004001 3300047472 Bacteria 12338
315 Ga0495686_0009196 3300047472 Bacteria 7153
316 Ga0495593_0005747 3300047673 Bacteria 7320
317 Ga0495614_0012165 3300048089 Bacteria 3778
318 Ga0496100_0010657 3300048903 Bacteria 5210
319 Ga0496100_0012620 3300048903 Bacteria 4848
320 Ga0496101_0011414 3300048904 Bacteria 5892
321 Ga0496102_0025967 3300048905 Bacteria 5219
322 Ga0496103_0017170 3300048906 Bacteria 4327
323 Ga0496103_0018370 3300048906 Bacteria 4194
324 Ga0496104_0038842 3300048907 Bacteria 4455
325 Ga0496105_0016729 3300048908 Bacteria 5861
326 Ga0496105_0017926 3300048908 Bacteria 5682
327 Ga0496106_0007857 3300048909 Bacteria 7891
328 Ga0496106_0041824 3300048909 Bacteria 3435
329 Ga0496107_0000188 3300048910 Bacteria 32167
330 Ga0496107_0012751 3300048910 Bacteria 5873
331 Ga0496107_0014751 3300048910 Bacteria 5472
332 Ga0496107_0020025 3300048910 Bacteria 4725
333 Ga0496110_0012468 3300048913 Bacteria 6990
334 Ga0496112_0015861 3300048915 Bacteria 7041
335 Ga0496112_0020962 3300048915 Bacteria 6206
336 Ga0496114_0005457 3300048917 Bacteria 9946
337 Ga0496114_0010185 3300048917 Bacteria 7480
338 Ga0496115_0003924 3300048918 Bacteria 10719
339 Ga0496115_0004007 3300048918 Bacteria 10628
340 Ga0496115_0005793 3300048918 Bacteria 8995
341 Ga0496115_0020360 3300048918 Bacteria 5117
342 Ga0496116_0026493 3300048919 Bacteria 4239
343 Ga0496116_0054440 3300048919 Bacteria 2636
344 Ga0496117_0025858 3300048920 Bacteria 4603
345 Ga0496118_0005250 3300048921 Bacteria 14796
346 Ga0496121_0000855 3300048924 Bacteria 55079
347 Ga0496123_0003500 3300048926 Bacteria 17502
348 Ga0496124_0022711 3300048927 Bacteria 5745
349 Ga0496125_0004967 3300048928 Bacteria 15042
350 Ga0496126_0012930 3300048929 Bacteria 8522
351 Ga0495678_001825 3300049459 Bacteria 15648
352 Ga0501032_0025677 3300049569 Bacteria 4060
353 Ga0501033_0003581 3300049570 Bacteria 12702
354 Ga0501034_0010715 3300049571 Bacteria 9524
355 Ga0501034_0089768 3300049571 Bacteria 3071
356 Ga0501037_0016277 3300049573 Bacteria 5474
357 Ga0501037_0025999 3300049573 Bacteria 4325
358 Ga0501038_0109959 3300049574 Bacteria 2284
359 Ga0501039_0003564 3300049575 Bacteria 11665
360 Ga0501040_0028466 3300049576 Bacteria 3767
361 Ga0501041_0035157 3300049577 Bacteria 3035
362 Ga0501042_0003871 3300049578 Bacteria 9460
363 Ga0501043_0005504 3300049579 Bacteria 10226
364 Ga0501046_0009297 3300049580 Bacteria 8509
365 Ga0501046_0050580 3300049580 Bacteria 3282
366 Ga0501047_0005187 3300049581 Bacteria 12228
367 Ga0501048_0041058 3300049582 Bacteria 3314
368 Ga0501067_0011273 3300049583 Bacteria 4948
369 Ga0501070_0052142 3300049586 Bacteria 3396
370 Ga0501072_0028771 3300049588 Bacteria 4338
371 Ga0501073_0006543 3300049589 Bacteria 8671
372 Ga0501074_0015706 3300049590 Bacteria 5505
373 Ga0501074_0017508 3300049590 Bacteria 5201
374 Ga0501076_0024237 3300049592 Bacteria 4687
375 Ga0501077_0017215 3300049593 Bacteria 4558
376 Ga0501079_0011192 3300049741 Bacteria 6844
377 Ga0501080_0001120 3300049742 Bacteria 22070
378 Ga0501080_0018941 3300049742 Bacteria 6376
379 Ga0501080_0038100 3300049742 Bacteria 4490
380 Ga0501081_0012348 3300049743 Bacteria 5610
381 Ga0501083_0011443 3300049744 Bacteria 6224
382 Ga0501083_0013378 3300049744 Bacteria 5735
383 Ga0501035_0059285 3300049822 Bacteria 3409
384 Ga0501044_0001454 3300049823 Bacteria 27833
385 Ga0501044_0006211 3300049823 Bacteria 13205
386 Ga0501044_0026763 3300049823 Bacteria 6103
387 Ga0501044_0058172 3300049823 Bacteria 3965
388 nmdc:mga0k408_14951_c1 3300050493 Bacteria 4286
389 nmdc:mga06z11_8169_c1 3300050494 Bacteria 4348
390 nmdc:mga07m45_9353_c1 3300050496 Bacteria 5081
391 nmdc:mga09592_11742_c1 3300050508 Bacteria 7121
392 nmdc:mga0rr50_36238_c1 3300050513 Bacteria 3551
393 nmdc:mga0a205_42056_c1 3300050515 Bacteria 4403
394 Ga0500635_0000102 3300053080 Bacteria 51023
395 Ga0495655_0000470 3300053083 Bacteria 6771
396 Ga0495619_0003486 3300053085 Bacteria 10155
397 Ga0500578_0001504 3300053086 Bacteria 23136
398 Ga0500644_0000340 3300053088 Bacteria 23717
399 Ga0500651_0016514 3300053093 Bacteria 4543
400 Ga0500562_000533 3300053108 Bacteria 9246
401 Ga0500562_004027 3300053108 Bacteria 3702
402 Ga0500572_000654 3300053111 Bacteria 11472
403 Ga0500594_0000137 3300053118 Bacteria 20341
404 Ga0500608_000007 3300053122 Bacteria 100296
405 Ga0500608_019259 3300053122 Bacteria 3126
406 Ga0500614_004558 3300053123 Bacteria 2922
407 Ga0500618_000064 3300053125 Bacteria 91120
408 Ga0500658_0004233 3300053134 Bacteria 5383
409 Ga0500559_0000062 3300053136 Bacteria 87142
410 Ga0500559_0001041 3300053136 Bacteria 16972
411 Ga0500564_022578 3300053138 Bacteria 2879
412 Ga0500573_0009968 3300053140 Bacteria 5294
413 Ga0500577_0003591 3300053142 Bacteria 4037
414 Ga0500622_0005194 3300053156 Bacteria 7883
415 Ga0500627_0012039 3300053158 Bacteria 3224
416 Ga0500636_0022627 3300053177 Bacteria 3715
417 Ga0500645_006395 3300053730 Bacteria 4209
418 Ga0500596_000375 3300053735 Bacteria 8109
419 Ga0501084_0006333 3300054114 Bacteria 9721
420 Ga0501084_0046214 3300054114 Bacteria 3647
421 Ga0501082_0052603 3300060353 Bacteria 3510
422 Ga0530510_0006954 3300061734 Bacteria 7884
423 Ga0530510_0010600 3300061734 Bacteria 6463
424 2643928918 2643221584 Bacteria 5511711
425 2511124832 2510917020 Bacteria 5657507
426 2545678670 2545555834 Bacteria 8130841
427 2561466209 2558860983 Bacteria 4133860
428 2585146882 2582581279 Bacteria 4980720
429 2585151422 2582581280 Bacteria 5994497
430 2585196135 2582581293 Bacteria 5907401
431 2587919447 2585428106 Bacteria 5179711
432 2643749507 2643221545 Bacteria 5083237
433 2643782706 2643221552 Bacteria 5708754
434 2643883078 2643221574 Bacteria 2789653
435 2643926479 2643221583 Bacteria 5218014
436 2644000446 2643221598 Bacteria 4578346
437 2644084777 2643221614 Bacteria 4260023
438 2644225278 2643221640 Bacteria 5258820
439 2644232586 2643221642 Bacteria 5357871
440 2644342329 2643221661 Bacteria 4267604
441 2644352354 2643221663 Bacteria 3425771
442 2644365629 2643221666 Bacteria 4265935
443 2644508463 2643221691 Bacteria 5093099
444 2644550018 2643221699 Bacteria 5731501
445 2644552503 2643221699 Bacteria 5731501
446 2792463466 2791355048 Bacteria 5832535
447 2819536992 2818991435 Bacteria 5433759
448 2819645404 2818991454 Bacteria 5563326
449 2843748935 2843744320 Bacteria 5659202
450 2849563018 2849560528 Bacteria 5393480
451 2849575219 2849573788 Bacteria 5421256
452 2851157601 2851153111 Bacteria 5542585
453 2854685229 2854681122 Bacteria 4548679
454 2857504591 2857504554 Bacteria 5369913
455 2884960696 2884960567 Bacteria 5437054
456 2898333510 2898329390 Bacteria 5168154
457 2898795415 2898795034 Bacteria 4294459
458 2928534406 2928531327 Bacteria 5101314
459 2928972577 2928972540 Bacteria 3058286
460 2941487153 2941485952 Bacteria 3591484
461 2977242357 2977240413 Bacteria 3191065
462 3003666246 3003665799 Bacteria 7279786
463 641646758 641522639 Bacteria 7737025
464 643604965 643348564 Bacteria 8839022
465 Ga0055536_1000987
466 Ga0055530_10001456
467 Ga0055531_10001343
468 Ga0055531_10007312
469 Ga0065165_1000210
470 Ga0065165_1001315
471 Ga0070658_10009327
472 Ga0070690_100009151
473 Ga0070670_100020452
474 Ga0070670_100071813
475 Ga0070666_10001864
476 Ga0070680_100007270
477 Ga0070680_100030191
478 Ga0070682_100000573
479 Ga0070689_100000136
480 Ga0070691_10000418
481 Ga0070687_100002559
482 Ga0070661_100002616
483 Ga0070692_10002091
484 Ga0070668_100000188
485 Ga0070668_100004770
486 Ga0070668_100008308
487 Ga0070668_100011123
488 Ga0070668_100057108
489 Ga0070669_100001556
490 Ga0070675_100003757
491 Ga0070671_100002522
492 Ga0070671_100014389
493 Ga0070671_100049487
494 Ga0070674_100000832
495 Ga0070673_100007489
496 Ga0070688_100000981
497 Ga0070659_100003308
498 Ga0070659_100018771
499 Ga0070667_100001681
500 Ga0070667_100073353
501 Ga0070709_10006653
502 Ga0070714_100021168
503 Ga0070713_100004713
504 Ga0070710_10001222
505 Ga0070711_100000961
506 Ga0070705_100000300
507 Ga0070694_100000659
508 Ga0070663_100001220
509 Ga0070678_100000123
510 Ga0070678_100059622
511 Ga0070662_100000339
512 Ga0070681_10018656
513 Ga0070681_10048740
514 Ga0070681_10052521
515 Ga0068867_100005776
516 Ga0070699_100049738
517 Ga0070679_100004727
518 Ga0070679_100113678
519 Ga0070684_100014306
520 Ga0070697_100003199
521 Ga0068853_100002127
522 Ga0068853_100037667
523 Ga0068853_100060126
524 Ga0070686_100003722
525 Ga0070695_100000995
526 Ga0070693_100000993
527 Ga0070665_100000121
528 Ga0070665_100011802
529 Ga0070665_100064235
530 Ga0070704_100000607
531 Ga0070704_100037711
532 Ga0068855_100003471
533 Ga0068855_100029068
534 Ga0070664_100017429
535 Ga0068856_100004777
536 Ga0070702_100000022
537 Ga0070702_100007136
538 Ga0068859_100000401
539 Ga0068859_100007821
540 Ga0068859_100008488
541 Ga0068864_100001763
542 Ga0068864_100004252
543 Ga0068866_10004814
544 Ga0068861_100001574
545 Ga0068863_100000367
546 Ga0068863_100001307
547 Ga0068863_100012729
548 Ga0068858_100000219
549 Ga0068858_100001450
550 Ga0068860_100000055
551 Ga0068860_100001852
552 Ga0068862_100002363
553 Ga0081455_10002778
554 Ga0081455_10014016
555 Ga0075364_10001667
556 Ga0070715_10000079
557 Ga0070716_100001144
558 Ga0070712_100011410
559 Ga0075367_10003590
560 Ga0075366_10005401
561 Ga0075428_100064350
562 Ga0075429_100056071
563 Ga0068865_100001515
564 Ga0068865_100002767
565 Ga0075436_100007838
566 Ga0097620_100000401
567 Ga0097620_100007821
568 Ga0097620_100008488
569 Ga0105240_10059050
570 Ga0105240_10084081
571 Ga0105245_10002367
572 Ga0105247_10001141
573 Ga0105247_10026785
574 Ga0114129_10134978
575 Ga0105243_10000417
576 Ga0105241_10000456
577 Ga0105242_10002247
578 Ga0105248_10000293
579 Ga0105248_10001413
580 Ga0105248_10015712
581 Ga0105248_10028939
582 Ga0105237_10000712
583 Ga0105238_10056706
584 Ga0105249_10000591
585 Ga0105239_10036997
586 Ga0105239_10041715
587 Ga0105239_10073938
588 Ga0105246_10000118
589 Ga0157373_10001230
590 Ga0157373_10001673
591 Ga0157371_10002724
592 Ga0157371_10005561
593 Ga0157369_10032544
594 Ga0157374_10004169
595 Ga0157378_10000643
596 Ga0163162_10018088
597 Ga0163162_10094427
598 Ga0157372_10001248
599 Ga0157375_10002203
600 Ga0157375_10002372
601 Ga0163163_10005028
602 Ga0163163_10007000
603 Ga0157379_10000531
604 Ga0157379_10000933
605 Ga0157379_10071208
606 Ga0157376_10001069
607 Ga0163161_10003267
608 Ga0213876_10000108
609 Ga0209026_1003240
610 Ga0209565_1000469
611 Ga0209673_1001526
612 Ga0209675_1006670
613 Ga0209676_1000444
614 Ga0209676_1000691
615 Ga0209676_1001269
616 Ga0209676_1002398
617 Ga0209676_1005965
618 Ga0209564_1001610
619 Ga0209758_1001228
620 Ga0209758_1002410
621 Ga0209050_1000101
622 Ga0209050_1001896
623 Ga0209050_1005582
624 Ga0209256_1004179
625 Ga0209256_1004748
626 Ga0209256_1007832
627 Ga0209051_1005103
628 Ga0209257_1000187
629 Ga0209257_1000284
630 Ga0209257_1003467
631 Ga0209257_1005485
632 Ga0207692_10002406
633 Ga0207710_10001630
634 Ga0207688_10000764
635 Ga0207680_10007037
636 Ga0207647_10000924
637 Ga0207645_10004812
638 Ga0207705_10034512
639 Ga0207654_10019680
640 Ga0207707_10016493
641 Ga0207695_10001328
642 Ga0207695_10002756
643 Ga0207695_10009972
644 Ga0207695_10042812
645 Ga0207671_10007807
646 Ga0207693_10000703
647 Ga0207663_10001248
648 Ga0207662_10002213
649 Ga0207657_10000304
650 Ga0207649_10002403
651 Ga0207681_10002820
652 Ga0207681_10030272
653 Ga0207650_10015427
654 Ga0207687_10001882
655 Ga0207700_10057712
656 Ga0207664_10019851
657 Ga0207644_10001379
658 Ga0207644_10001431
659 Ga0207690_10003254
660 Ga0207690_10004214
661 Ga0207706_10000263
662 Ga0207686_10017602
663 Ga0207709_10004092
664 Ga0207669_10001156
665 Ga0207704_10002589
666 Ga0207665_10000219
667 Ga0207711_10000482
668 Ga0207711_10005353
669 Ga0207711_10019643
670 Ga0207661_10027776
671 Ga0207679_10006703
672 Ga0207667_10013210
673 Ga0207667_10015747
674 Ga0207651_10000820
675 Ga0207712_10008836
676 Ga0207668_10001837
677 Ga0207668_10018672
678 Ga0207668_10027208
679 Ga0207640_10016518
680 Ga0207658_10025129
681 Ga0207658_10029654
682 Ga0207703_10000659
683 Ga0207703_10005045
684 Ga0207703_10037175
685 Ga0207639_10001097
686 Ga0207678_10000209
687 Ga0207702_10007071
688 Ga0207641_10000070
689 Ga0207641_10002297
690 Ga0207641_10007322
691 Ga0207648_10013547
692 Ga0207676_10011604
693 Ga0207674_10000719
694 Ga0207675_100000482
695 Ga0207683_10000405
696 Ga0207698_10003577
697 Ga0209998_10003648
698 Ga0268266_10000106
699 Ga0268266_10012465
700 Ga0268265_10003719
701 Ga0268265_10011541
702 Ga0268264_10000112
703 Ga0307517_10009198
704 Ga0307515_10076207
705 Ga0265338_10022923
706 Ga0265327_10000568
707 Ga0265316_10040482
708 Ga0307513_10000162
709 Ga0307513_10002892
710 Ga0307513_10004143
711 Ga0307513_10033858
712 Ga0265314_10008757
713 Ga0307516_10000154
714 Ga0307406_10001747
715 Ga0307414_10030432
716 Ga0307414_10032967
717 Ga0307510_10074058
718 Ga0316574_0001826
719 Ga0373931_0007659
720 Ga0373931_0012143
721 Ga0373935_0073643
722 Ga0373927_0014733
723 Ga0373947_0002766
724 Ga0373925_0009090
725 Ga0395899_0000105
726 Ga0395899_0000187
727 Ga0395899_0054973
728 Ga0395900_0000009
729 Ga0395898_0003798
730 Ga0395898_0031278
731 Ga0395898_0047271
732 Ga0395905_0010042
733 Ga0395905_0027293
734 Ga0395901_0000412
735 Ga0395901_0027857
736 Ga0436365_1544656
737 Ga0436361_0196619
738 Ga0495627_001069
739 Ga0495603_0006609
740 Ga0495590_0004125
741 Ga0495629_0047944
742 Ga0495638_0000845
743 Ga0495638_0002190
744 Ga0495638_0007957
745 Ga0495641_0014235
746 Ga0495650_0000030
747 Ga0495580_0000835
748 Ga0495582_0013002
749 Ga0495639_0003675
750 Ga0495594_0000613
751 Ga0495583_0000002
752 Ga0495610_0000091
753 Ga0495610_0015694
754 Ga0495616_0000094
755 Ga0495631_0004438
756 Ga0495632_0005026
757 Ga0495643_0006008
758 Ga0495648_0000154
759 Ga0495654_0000048
760 Ga0495640_0057631
761 Ga0495622_0000576
762 Ga0495622_0011792
763 Ga0495633_0000683
764 Ga0495668_0000703
765 Ga0495634_0021531
766 Ga0495625_0000058
767 Ga0495625_0017730
768 Ga0495658_0005032
769 Ga0495669_0000196
770 Ga0495669_0000440
771 Ga0495613_0003198
772 Ga0495649_0000137
773 Ga0495672_0025974
774 Ga0495676_0006996
775 Ga0495680_0022388
776 Ga0495673_0001111
777 Ga0495686_0000023
778 Ga0495686_0004001
779 Ga0495686_0009196
780 Ga0495593_0005747
781 Ga0495614_0012165
782 Ga0496100_0010657
783 Ga0496100_0012620
784 Ga0496101_0011414
785 Ga0496102_0025967
786 Ga0496103_0017170
787 Ga0496103_0018370
788 Ga0496104_0038842
789 Ga0496105_0016729
790 Ga0496105_0017926
791 Ga0496106_0007857
792 Ga0496106_0041824
793 Ga0496107_0000188
794 Ga0496107_0012751
795 Ga0496107_0014751
796 Ga0496107_0020025
797 Ga0496110_0012468
798 Ga0496112_0015861
799 Ga0496112_0020962
800 Ga0496114_0005457
801 Ga0496114_0010185
802 Ga0496115_0003924
803 Ga0496115_0004007
804 Ga0496115_0005793
805 Ga0496115_0020360
806 Ga0496116_0026493
807 Ga0496116_0054440
808 Ga0496117_0025858
809 Ga0496118_0005250
810 Ga0496121_0000855
811 Ga0496123_0003500
812 Ga0496124_0022711
813 Ga0496125_0004967
814 Ga0496126_0012930
815 Ga0495678_001825
816 Ga0501032_0025677
817 Ga0501033_0003581
818 Ga0501034_0010715
819 Ga0501034_0089768
820 Ga0501037_0016277
821 Ga0501037_0025999
822 Ga0501038_0109959
823 Ga0501039_0003564
824 Ga0501040_0028466
825 Ga0501041_0035157
826 Ga0501042_0003871
827 Ga0501043_0005504
828 Ga0501046_0009297
829 Ga0501046_0050580
830 Ga0501047_0005187
831 Ga0501048_0041058
832 Ga0501067_0011273
833 Ga0501070_0052142
834 Ga0501072_0028771
835 Ga0501073_0006543
836 Ga0501074_0015706
837 Ga0501074_0017508
838 Ga0501076_0024237
839 Ga0501077_0017215
840 Ga0501079_0011192
841 Ga0501080_0001120
842 Ga0501080_0018941
843 Ga0501080_0038100
844 Ga0501081_0012348
845 Ga0501083_0011443
846 Ga0501083_0013378
847 Ga0501035_0059285
848 Ga0501044_0001454
849 Ga0501044_0006211
850 Ga0501044_0026763
851 Ga0501044_0058172
852 nmdc:mga0k408_14951_c1
853 nmdc:mga06z11_8169_c1
854 nmdc:mga07m45_9353_c1
855 nmdc:mga09592_11742_c1
856 nmdc:mga0rr50_36238_c1
857 nmdc:mga0a205_42056_c1
858 Ga0500635_0000102
859 Ga0495655_0000470
860 Ga0495619_0003486
861 Ga0500578_0001504
862 Ga0500644_0000340
863 Ga0500651_0016514
864 Ga0500562_000533
865 Ga0500562_004027
866 Ga0500572_000654
867 Ga0500594_0000137
868 Ga0500608_000007
869 Ga0500608_019259
870 Ga0500614_004558
871 Ga0500618_000064
872 Ga0500658_0004233
873 Ga0500559_0000062
874 Ga0500559_0001041
875 Ga0500564_022578
876 Ga0500573_0009968
877 Ga0500577_0003591
878 Ga0500622_0005194
879 Ga0500627_0012039
880 Ga0500636_0022627
881 Ga0500645_006395
882 Ga0500596_000375
883 Ga0501084_0006333
884 Ga0501084_0046214
885 Ga0501082_0052603
886 Ga0530510_0006954
887 Ga0530510_0010600
888 2643928918
889 2511124832
890 2545678670
891 2561466209
892 2585146882
893 2585151422
894 2585196135
895 2587919447
896 2643749507
897 2643782706
898 2643883078
899 2643926479
900 2644000446
901 2644084777
902 2644225278
903 2644232586
904 2644342329
905 2644352354
906 2644365629
907 2644508463
908 2644550018
909 2644552503
910 2792463466
911 2819536992
912 2819645404
913 2843748935
914 2849563018
915 2849575219
916 2851157601
917 2854685229
918 2857504591
919 2884960696
920 2898333510
921 2898795415
922 2928534406
923 2928972577
924 2941487153
925 2977242357
926 3003666246
927 641646758
928 643604965

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17876

CSD2

Cold shock domain

178

251

0.95

PF00773

RNB

RNB domain

269

605

0.92

PF00575

S1

S1 RNA binding domain

649

708

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dol-assembly1.cif.gz_A mycoplasma genitalium rnase r in complex with double-stranded rna 0.9134 140 715
1kl9-assembly1.cif.gz_A crystal structure of the n-terminal segment of human eukaryotic initiation factor 2alpha 0.9042 633 713
8cdv-assembly1.cif.gz_C rnase r bound to a 30s degradation intermediate (state ii) 0.8946 225 620
2a1a-assembly1.cif.gz_A pkr kinase domain-eif2alpha complex 0.8901 633 713
7dol-assembly1.cif.gz_A mycoplasma genitalium rnase r in complex with double-stranded rna 0.8807 140 715
ID Description Score Start End Superfamily
af_P39360_5_75_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9174 16 70 1.10.10.10
af_Q9VCX7_866_936_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9004 633 716 2.40.50.140
2a1aA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8901 633 713 2.40.50.140
af_Q0D7X0_220_310_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8622 633 714 2.40.50.140
af_Q9N4L5_667_744_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.858 634 715 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A258CTA0-F1-model_v4 Ribonuclease R 0.989 211 571 GO:0003723
GO:0004540
GO:0005829
GO:0006402
AF-A0A4Q3RVN0-F1-model_v4 exoribonuclease II (EC 3.1.13.1) 0.9882 244 731 GO:0003723
GO:0005829
GO:0006402
GO:0008859
AF-A0A4Q3RVN0-F1-model_v4 exoribonuclease II (EC 3.1.13.1) 0.9842 244 731 GO:0003723
GO:0005829
GO:0006402
GO:0008859
AF-A0A520HCW5-F1-model_v4 RNB domain-containing ribonuclease 0.9792 264 687 GO:0003723
GO:0004527
GO:0004540
GO:0005829
GO:0006402
AF-A0A258CTA0-F1-model_v4 Ribonuclease R 0.9783 211 571 GO:0003723
GO:0004540
GO:0005829
GO:0006402

Map