F449398
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 464 | 338 | 928 | 750 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2643221584|2643928918 |
| Length | 905 |
| Sequence | RSPKSSKFPAASPKGGKVAKPPAGLPDRETLLAFLRDAGESGKADIARHFGLKGADRRALREMLRALEADGSLGKRGRRGFAEAGSLPPVGVVDVVERDADGDLYVRLTKGGEDLPQVRLAPGKGEAAGGAPGMGDRLLVHFEQLESGETEARLIKRLGQSAHKLLGVVRKHRRETRVEPVDRKSKESLLIDNQAAEGLKEGDLVLAQVSGAGARYGPKFGKILEVLGSEDDPRAASLIAIHSHGIPTGFSEEAEAEAGAAQPPTLEGRDDLRDLPFVTIDPVDARDHDDAVYAHPDPDAGNVGGWVVWVAIADVAAYVRPGSALDRDAREKGNSVYFPDRVEPMLPETLSNGLCSLREGENRATLAVRMVFDATGRKKSHKFVRGLMRSAAKLSYEQAQAAIDGVAPPDGQDADKAGPLLDPILKPLWTAFRLMGKGREARSPLAIESDERRIVIREGEIQSITRRASLEAHKLIEEMMIQANVSAAETLEAKRLPLIYRVHDTPSQEKVMSLVEFLQTLEIKWSKGEAPTTARFNKLLDDTRESPHAAIINEVVLRTQMQAHYSSDNLGHFGLNLARYAHFTSPIRRYADLIVHRALIRALNLGTDGLTDQDISQIKDTAEVITHAERRAMAAERDATDRYIAAFLADRVGATFTGRITGVTRFGLFVKLDETGADGLVPVSTLGEEYFVHDDRMHALVGERTGKRFPLGLAVEVRLREATPVTGGLLFEMLTDALPADPKAPRPRLGVRARTPVKPRGGLPKGVRRGKRKXXXXXGGGGGGGYTLTDFTRPLCRHAVGRFTPSPSQASLGPLPLPMGEGSQGRTVRAAASSRSAIIVWSAIDGCQSQALRSMPVIRTGVARPGVSASTAWTTASTSAAKLSPAISRNFAWGWRRARSRMKPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 2 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 3 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 4 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 97 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 98 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 162 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 163 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 165 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 166 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 167 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 169 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 170 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 171 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 172 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 173 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 174 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 175 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 176 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 177 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 179 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 180 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 181 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 182 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 183 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 184 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 185 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 224 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 225 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 226 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 227 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 228 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 229 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 230 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 231 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 232 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 233 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 234 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 235 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 236 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 237 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 238 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 239 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 240 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 241 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 269 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 270 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 271 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 275 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 278 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 279 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 280 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 281 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 282 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 283 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 284 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 285 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 286 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 287 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 288 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 289 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 290 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 291 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 292 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 293 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 294 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 295 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 296 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 299 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 300 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 301 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 302 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 303 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 304 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 305 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 306 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 307 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 308 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 309 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 310 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 311 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 312 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 313 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 314 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 315 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 316 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 317 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 318 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 319 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 320 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 321 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 322 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 323 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 324 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 325 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 326 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 327 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 328 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 329 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 330 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 331 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 332 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 333 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 334 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 335 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 336 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 337 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 338 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.16 |
| Metatranscriptomes | 0 |
| Isolates | 8.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.28 |
| Nodule | 0.65 |
| Rhizoplane | 5.39 |
| Rhizosphere | 72.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055536_1000987 | 3300003781 | Bacteria | 18050 |
| 2 | Ga0055530_10001456 | 3300003791 | Bacteria | 17252 |
| 3 | Ga0055531_10001343 | 3300003794 | Bacteria | 18367 |
| 4 | Ga0055531_10007312 | 3300003794 | Bacteria | 6053 |
| 5 | Ga0065165_1000210 | 3300005262 | Bacteria | 101721 |
| 6 | Ga0065165_1001315 | 3300005262 | Bacteria | 27750 |
| 7 | Ga0070658_10009327 | 3300005327 | Bacteria | 7888 |
| 8 | Ga0070690_100009151 | 3300005330 | Bacteria | 5732 |
| 9 | Ga0070670_100020452 | 3300005331 | Bacteria | 5690 |
| 10 | Ga0070670_100071813 | 3300005331 | Bacteria | 2972 |
| 11 | Ga0070666_10001864 | 3300005335 | Bacteria | 12823 |
| 12 | Ga0070680_100007270 | 3300005336 | Bacteria | 8439 |
| 13 | Ga0070680_100030191 | 3300005336 | Bacteria | 4354 |
| 14 | Ga0070682_100000573 | 3300005337 | Bacteria | 22607 |
| 15 | Ga0070689_100000136 | 3300005340 | Bacteria | 42853 |
| 16 | Ga0070691_10000418 | 3300005341 | Bacteria | 15566 |
| 17 | Ga0070687_100002559 | 3300005343 | Bacteria | 6862 |
| 18 | Ga0070661_100002616 | 3300005344 | Bacteria | 12337 |
| 19 | Ga0070692_10002091 | 3300005345 | Bacteria | 7619 |
| 20 | Ga0070668_100000188 | 3300005347 | Bacteria | 40404 |
| 21 | Ga0070668_100004770 | 3300005347 | Bacteria | 10057 |
| 22 | Ga0070668_100008308 | 3300005347 | Bacteria | 7706 |
| 23 | Ga0070668_100011123 | 3300005347 | Bacteria | 6700 |
| 24 | Ga0070668_100057108 | 3300005347 | Bacteria | 3016 |
| 25 | Ga0070669_100001556 | 3300005353 | Bacteria | 16608 |
| 26 | Ga0070675_100003757 | 3300005354 | Bacteria | 11530 |
| 27 | Ga0070671_100002522 | 3300005355 | Bacteria | 14189 |
| 28 | Ga0070671_100014389 | 3300005355 | Bacteria | 6392 |
| 29 | Ga0070671_100049487 | 3300005355 | Bacteria | 3496 |
| 30 | Ga0070674_100000832 | 3300005356 | Bacteria | 15947 |
| 31 | Ga0070673_100007489 | 3300005364 | Bacteria | 7206 |
| 32 | Ga0070688_100000981 | 3300005365 | Bacteria | 14298 |
| 33 | Ga0070659_100003308 | 3300005366 | Bacteria | 11481 |
| 34 | Ga0070659_100018771 | 3300005366 | Bacteria | 5220 |
| 35 | Ga0070667_100001681 | 3300005367 | Bacteria | 19789 |
| 36 | Ga0070667_100073353 | 3300005367 | Bacteria | 2918 |
| 37 | Ga0070709_10006653 | 3300005434 | Bacteria | 6309 |
| 38 | Ga0070714_100021168 | 3300005435 | Bacteria | 5318 |
| 39 | Ga0070713_100004713 | 3300005436 | Bacteria | 9214 |
| 40 | Ga0070710_10001222 | 3300005437 | Bacteria | 12161 |
| 41 | Ga0070711_100000961 | 3300005439 | Bacteria | 15267 |
| 42 | Ga0070705_100000300 | 3300005440 | Bacteria | 29369 |
| 43 | Ga0070694_100000659 | 3300005444 | Bacteria | 19066 |
| 44 | Ga0070663_100001220 | 3300005455 | Bacteria | 14123 |
| 45 | Ga0070678_100000123 | 3300005456 | Bacteria | 30745 |
| 46 | Ga0070678_100059622 | 3300005456 | Bacteria | 2806 |
| 47 | Ga0070662_100000339 | 3300005457 | Bacteria | 28034 |
| 48 | Ga0070681_10018656 | 3300005458 | Bacteria | 6938 |
| 49 | Ga0070681_10048740 | 3300005458 | Bacteria | 4232 |
| 50 | Ga0070681_10052521 | 3300005458 | Bacteria | 4065 |
| 51 | Ga0068867_100005776 | 3300005459 | Bacteria | 8778 |
| 52 | Ga0070699_100049738 | 3300005518 | Bacteria | 3628 |
| 53 | Ga0070679_100004727 | 3300005530 | Bacteria | 12560 |
| 54 | Ga0070679_100113678 | 3300005530 | Bacteria | 2692 |
| 55 | Ga0070684_100014306 | 3300005535 | Bacteria | 6424 |
| 56 | Ga0070697_100003199 | 3300005536 | Bacteria | 12577 |
| 57 | Ga0068853_100002127 | 3300005539 | Bacteria | 14736 |
| 58 | Ga0068853_100037667 | 3300005539 | Bacteria | 4115 |
| 59 | Ga0068853_100060126 | 3300005539 | Bacteria | 3282 |
| 60 | Ga0070686_100003722 | 3300005544 | Bacteria | 8381 |
| 61 | Ga0070695_100000995 | 3300005545 | Bacteria | 15425 |
| 62 | Ga0070693_100000993 | 3300005547 | Bacteria | 12644 |
| 63 | Ga0070665_100000121 | 3300005548 | Bacteria | 147683 |
| 64 | Ga0070665_100011802 | 3300005548 | Bacteria | 8824 |
| 65 | Ga0070665_100064235 | 3300005548 | Bacteria | 3681 |
| 66 | Ga0070704_100000607 | 3300005549 | Bacteria | 17259 |
| 67 | Ga0070704_100037711 | 3300005549 | Bacteria | 3305 |
| 68 | Ga0068855_100003471 | 3300005563 | Bacteria | 19298 |
| 69 | Ga0068855_100029068 | 3300005563 | Bacteria | 6610 |
| 70 | Ga0070664_100017429 | 3300005564 | Bacteria | 5897 |
| 71 | Ga0068856_100004777 | 3300005614 | Bacteria | 13428 |
| 72 | Ga0070702_100000022 | 3300005615 | Bacteria | 44333 |
| 73 | Ga0070702_100007136 | 3300005615 | Bacteria | 5336 |
| 74 | Ga0068859_100000401 | 3300005617 | Bacteria | 43052 |
| 75 | Ga0068859_100007821 | 3300005617 | Bacteria | 10850 |
| 76 | Ga0068859_100008488 | 3300005617 | Bacteria | 10394 |
| 77 | Ga0068864_100001763 | 3300005618 | Bacteria | 17776 |
| 78 | Ga0068864_100004252 | 3300005618 | Bacteria | 11784 |
| 79 | Ga0068866_10004814 | 3300005718 | Bacteria | 5542 |
| 80 | Ga0068861_100001574 | 3300005719 | Bacteria | 14514 |
| 81 | Ga0068863_100000367 | 3300005841 | Bacteria | 45948 |
| 82 | Ga0068863_100001307 | 3300005841 | Bacteria | 24847 |
| 83 | Ga0068863_100012729 | 3300005841 | Bacteria | 8112 |
| 84 | Ga0068858_100000219 | 3300005842 | Bacteria | 61717 |
| 85 | Ga0068858_100001450 | 3300005842 | Bacteria | 24400 |
| 86 | Ga0068860_100000055 | 3300005843 | Bacteria | 203538 |
| 87 | Ga0068860_100001852 | 3300005843 | Bacteria | 22494 |
| 88 | Ga0068862_100002363 | 3300005844 | Bacteria | 16799 |
| 89 | Ga0081455_10002778 | 3300005937 | Bacteria | 20623 |
| 90 | Ga0081455_10014016 | 3300005937 | Bacteria | 7879 |
| 91 | Ga0075364_10001667 | 3300006051 | Bacteria | 12181 |
| 92 | Ga0070715_10000079 | 3300006163 | Bacteria | 26581 |
| 93 | Ga0070716_100001144 | 3300006173 | Bacteria | 11698 |
| 94 | Ga0070712_100011410 | 3300006175 | Bacteria | 5633 |
| 95 | Ga0075367_10003590 | 3300006178 | Bacteria | 7427 |
| 96 | Ga0075366_10005401 | 3300006195 | Bacteria | 6924 |
| 97 | Ga0075428_100064350 | 3300006844 | Bacteria | 4016 |
| 98 | Ga0075429_100056071 | 3300006880 | Bacteria | 3429 |
| 99 | Ga0068865_100001515 | 3300006881 | Bacteria | 13546 |
| 100 | Ga0068865_100002767 | 3300006881 | Bacteria | 10421 |
| 101 | Ga0075436_100007838 | 3300006914 | Bacteria | 7305 |
| 102 | Ga0097620_100000401 | 3300006931 | Bacteria | 43052 |
| 103 | Ga0097620_100007821 | 3300006931 | Bacteria | 10850 |
| 104 | Ga0097620_100008488 | 3300006931 | Bacteria | 10394 |
| 105 | Ga0105240_10059050 | 3300009093 | Bacteria | 4788 |
| 106 | Ga0105240_10084081 | 3300009093 | Bacteria | 3903 |
| 107 | Ga0105245_10002367 | 3300009098 | Bacteria | 17040 |
| 108 | Ga0105247_10001141 | 3300009101 | Bacteria | 19671 |
| 109 | Ga0105247_10026785 | 3300009101 | Bacteria | 3484 |
| 110 | Ga0114129_10134978 | 3300009147 | Bacteria | 3386 |
| 111 | Ga0105243_10000417 | 3300009148 | Bacteria | 44794 |
| 112 | Ga0105241_10000456 | 3300009174 | Bacteria | 30774 |
| 113 | Ga0105242_10002247 | 3300009176 | Bacteria | 15232 |
| 114 | Ga0105248_10000293 | 3300009177 | Bacteria | 59383 |
| 115 | Ga0105248_10001413 | 3300009177 | Bacteria | 26833 |
| 116 | Ga0105248_10015712 | 3300009177 | Bacteria | 8344 |
| 117 | Ga0105248_10028939 | 3300009177 | Bacteria | 6177 |
| 118 | Ga0105237_10000712 | 3300009545 | Bacteria | 46011 |
| 119 | Ga0105238_10056706 | 3300009551 | Bacteria | 3929 |
| 120 | Ga0105249_10000591 | 3300009553 | Bacteria | 33149 |
| 121 | Ga0105239_10036997 | 3300010375 | Bacteria | 5354 |
| 122 | Ga0105239_10041715 | 3300010375 | Bacteria | 5028 |
| 123 | Ga0105239_10073938 | 3300010375 | Bacteria | 3747 |
| 124 | Ga0105246_10000118 | 3300011119 | Bacteria | 35893 |
| 125 | Ga0157373_10001230 | 3300013100 | Bacteria | 19573 |
| 126 | Ga0157373_10001673 | 3300013100 | Bacteria | 16931 |
| 127 | Ga0157371_10002724 | 3300013102 | Bacteria | 16644 |
| 128 | Ga0157371_10005561 | 3300013102 | Bacteria | 10597 |
| 129 | Ga0157369_10032544 | 3300013105 | Bacteria | 5733 |
| 130 | Ga0157374_10004169 | 3300013296 | Bacteria | 12136 |
| 131 | Ga0157378_10000643 | 3300013297 | Bacteria | 32822 |
| 132 | Ga0163162_10018088 | 3300013306 | Bacteria | 6898 |
| 133 | Ga0163162_10094427 | 3300013306 | Bacteria | 3077 |
| 134 | Ga0157372_10001248 | 3300013307 | Bacteria | 27510 |
| 135 | Ga0157375_10002203 | 3300013308 | Bacteria | 16841 |
| 136 | Ga0157375_10002372 | 3300013308 | Bacteria | 16296 |
| 137 | Ga0163163_10005028 | 3300014325 | Bacteria | 11396 |
| 138 | Ga0163163_10007000 | 3300014325 | Bacteria | 9906 |
| 139 | Ga0157379_10000531 | 3300014968 | Bacteria | 30814 |
| 140 | Ga0157379_10000933 | 3300014968 | Bacteria | 23653 |
| 141 | Ga0157379_10071208 | 3300014968 | Bacteria | 3111 |
| 142 | Ga0157376_10001069 | 3300014969 | Bacteria | 17936 |
| 143 | Ga0163161_10003267 | 3300017792 | Bacteria | 11395 |
| 144 | Ga0213876_10000108 | 3300021384 | Bacteria | 91222 |
| 145 | Ga0209026_1003240 | 3300025250 | Bacteria | 5476 |
| 146 | Ga0209565_1000469 | 3300025263 | Bacteria | 30315 |
| 147 | Ga0209673_1001526 | 3300025273 | Bacteria | 21165 |
| 148 | Ga0209675_1006670 | 3300025291 | Bacteria | 4583 |
| 149 | Ga0209676_1000444 | 3300025292 | Bacteria | 70611 |
| 150 | Ga0209676_1000691 | 3300025292 | Bacteria | 47509 |
| 151 | Ga0209676_1001269 | 3300025292 | Bacteria | 26245 |
| 152 | Ga0209676_1002398 | 3300025292 | Bacteria | 13402 |
| 153 | Ga0209676_1005965 | 3300025292 | Bacteria | 6159 |
| 154 | Ga0209564_1001610 | 3300025295 | Bacteria | 21907 |
| 155 | Ga0209758_1001228 | 3300025297 | Bacteria | 32082 |
| 156 | Ga0209758_1002410 | 3300025297 | Bacteria | 19155 |
| 157 | Ga0209050_1000101 | 3300025298 | Bacteria | 230076 |
| 158 | Ga0209050_1001896 | 3300025298 | Bacteria | 20030 |
| 159 | Ga0209050_1005582 | 3300025298 | Bacteria | 7814 |
| 160 | Ga0209256_1004179 | 3300025299 | Bacteria | 9305 |
| 161 | Ga0209256_1004748 | 3300025299 | Bacteria | 8300 |
| 162 | Ga0209256_1007832 | 3300025299 | Bacteria | 5135 |
| 163 | Ga0209051_1005103 | 3300025303 | Bacteria | 7797 |
| 164 | Ga0209257_1000187 | 3300025304 | Bacteria | 154077 |
| 165 | Ga0209257_1000284 | 3300025304 | Bacteria | 112773 |
| 166 | Ga0209257_1003467 | 3300025304 | Bacteria | 13476 |
| 167 | Ga0209257_1005485 | 3300025304 | Bacteria | 8874 |
| 168 | Ga0207692_10002406 | 3300025898 | Bacteria | 7175 |
| 169 | Ga0207710_10001630 | 3300025900 | Bacteria | 10960 |
| 170 | Ga0207688_10000764 | 3300025901 | Bacteria | 15995 |
| 171 | Ga0207680_10007037 | 3300025903 | Bacteria | 5465 |
| 172 | Ga0207647_10000924 | 3300025904 | Bacteria | 22626 |
| 173 | Ga0207645_10004812 | 3300025907 | Bacteria | 9921 |
| 174 | Ga0207705_10034512 | 3300025909 | Bacteria | 3617 |
| 175 | Ga0207654_10019680 | 3300025911 | Bacteria | 3568 |
| 176 | Ga0207707_10016493 | 3300025912 | Bacteria | 6441 |
| 177 | Ga0207695_10001328 | 3300025913 | Bacteria | 41985 |
| 178 | Ga0207695_10002756 | 3300025913 | Bacteria | 25626 |
| 179 | Ga0207695_10009972 | 3300025913 | Bacteria | 11669 |
| 180 | Ga0207695_10042812 | 3300025913 | Bacteria | 4831 |
| 181 | Ga0207671_10007807 | 3300025914 | Bacteria | 9202 |
| 182 | Ga0207693_10000703 | 3300025915 | Bacteria | 30046 |
| 183 | Ga0207663_10001248 | 3300025916 | Bacteria | 11772 |
| 184 | Ga0207662_10002213 | 3300025918 | Bacteria | 9693 |
| 185 | Ga0207657_10000304 | 3300025919 | Bacteria | 52135 |
| 186 | Ga0207649_10002403 | 3300025920 | Bacteria | 10501 |
| 187 | Ga0207681_10002820 | 3300025923 | Bacteria | 11001 |
| 188 | Ga0207681_10030272 | 3300025923 | Bacteria | 3527 |
| 189 | Ga0207650_10015427 | 3300025925 | Bacteria | 5321 |
| 190 | Ga0207687_10001882 | 3300025927 | Bacteria | 14454 |
| 191 | Ga0207700_10057712 | 3300025928 | Bacteria | 2929 |
| 192 | Ga0207664_10019851 | 3300025929 | Bacteria | 4974 |
| 193 | Ga0207644_10001379 | 3300025931 | Bacteria | 15649 |
| 194 | Ga0207644_10001431 | 3300025931 | Bacteria | 15367 |
| 195 | Ga0207690_10003254 | 3300025932 | Bacteria | 9744 |
| 196 | Ga0207690_10004214 | 3300025932 | Bacteria | 8497 |
| 197 | Ga0207706_10000263 | 3300025933 | Bacteria | 57106 |
| 198 | Ga0207686_10017602 | 3300025934 | Bacteria | 4030 |
| 199 | Ga0207709_10004092 | 3300025935 | Bacteria | 8489 |
| 200 | Ga0207669_10001156 | 3300025937 | Bacteria | 11247 |
| 201 | Ga0207704_10002589 | 3300025938 | Bacteria | 8161 |
| 202 | Ga0207665_10000219 | 3300025939 | Bacteria | 38754 |
| 203 | Ga0207711_10000482 | 3300025941 | Bacteria | 41192 |
| 204 | Ga0207711_10005353 | 3300025941 | Bacteria | 10870 |
| 205 | Ga0207711_10019643 | 3300025941 | Bacteria | 5625 |
| 206 | Ga0207661_10027776 | 3300025944 | Bacteria | 4327 |
| 207 | Ga0207679_10006703 | 3300025945 | Bacteria | 7290 |
| 208 | Ga0207667_10013210 | 3300025949 | Bacteria | 9468 |
| 209 | Ga0207667_10015747 | 3300025949 | Bacteria | 8575 |
| 210 | Ga0207651_10000820 | 3300025960 | Bacteria | 13434 |
| 211 | Ga0207712_10008836 | 3300025961 | Bacteria | 6370 |
| 212 | Ga0207668_10001837 | 3300025972 | Bacteria | 12384 |
| 213 | Ga0207668_10018672 | 3300025972 | Bacteria | 4370 |
| 214 | Ga0207668_10027208 | 3300025972 | Bacteria | 3724 |
| 215 | Ga0207640_10016518 | 3300025981 | Bacteria | 4295 |
| 216 | Ga0207658_10025129 | 3300025986 | Bacteria | 4169 |
| 217 | Ga0207658_10029654 | 3300025986 | Bacteria | 3867 |
| 218 | Ga0207703_10000659 | 3300026035 | Bacteria | 34587 |
| 219 | Ga0207703_10005045 | 3300026035 | Bacteria | 10699 |
| 220 | Ga0207703_10037175 | 3300026035 | Bacteria | 3879 |
| 221 | Ga0207639_10001097 | 3300026041 | Bacteria | 18401 |
| 222 | Ga0207678_10000209 | 3300026067 | Bacteria | 51832 |
| 223 | Ga0207702_10007071 | 3300026078 | Bacteria | 9599 |
| 224 | Ga0207641_10000070 | 3300026088 | Bacteria | 152598 |
| 225 | Ga0207641_10002297 | 3300026088 | Bacteria | 17780 |
| 226 | Ga0207641_10007322 | 3300026088 | Bacteria | 9193 |
| 227 | Ga0207648_10013547 | 3300026089 | Bacteria | 7581 |
| 228 | Ga0207676_10011604 | 3300026095 | Bacteria | 6299 |
| 229 | Ga0207674_10000719 | 3300026116 | Bacteria | 43313 |
| 230 | Ga0207675_100000482 | 3300026118 | Bacteria | 38782 |
| 231 | Ga0207683_10000405 | 3300026121 | Bacteria | 39678 |
| 232 | Ga0207698_10003577 | 3300026142 | Bacteria | 9380 |
| 233 | Ga0209998_10003648 | 3300027717 | Bacteria | 3342 |
| 234 | Ga0268266_10000106 | 3300028379 | Bacteria | 175109 |
| 235 | Ga0268266_10012465 | 3300028379 | Bacteria | 7347 |
| 236 | Ga0268265_10003719 | 3300028380 | Bacteria | 10850 |
| 237 | Ga0268265_10011541 | 3300028380 | Bacteria | 5972 |
| 238 | Ga0268264_10000112 | 3300028381 | Bacteria | 203742 |
| 239 | Ga0307517_10009198 | 3300028786 | Bacteria | 14052 |
| 240 | Ga0307515_10076207 | 3300028794 | Bacteria | 4455 |
| 241 | Ga0265338_10022923 | 3300028800 | Bacteria | 6441 |
| 242 | Ga0265327_10000568 | 3300031251 | Bacteria | 62780 |
| 243 | Ga0265316_10040482 | 3300031344 | Bacteria | 3736 |
| 244 | Ga0307513_10000162 | 3300031456 | Bacteria | 96000 |
| 245 | Ga0307513_10002892 | 3300031456 | Bacteria | 23491 |
| 246 | Ga0307513_10004143 | 3300031456 | Bacteria | 19418 |
| 247 | Ga0307513_10033858 | 3300031456 | Bacteria | 5738 |
| 248 | Ga0265314_10008757 | 3300031711 | Bacteria | 8650 |
| 249 | Ga0307516_10000154 | 3300031730 | Bacteria | 85753 |
| 250 | Ga0307406_10001747 | 3300031901 | Bacteria | 11912 |
| 251 | Ga0307414_10030432 | 3300032004 | Bacteria | 3526 |
| 252 | Ga0307414_10032967 | 3300032004 | Bacteria | 3417 |
| 253 | Ga0307510_10074058 | 3300033180 | Bacteria | 3368 |
| 254 | Ga0316574_0001826 | 3300035398 | Bacteria | 10358 |
| 255 | Ga0373931_0007659 | 3300035691 | Bacteria | 5093 |
| 256 | Ga0373931_0012143 | 3300035691 | Bacteria | 4170 |
| 257 | Ga0373935_0073643 | 3300035692 | Bacteria | 2207 |
| 258 | Ga0373927_0014733 | 3300035695 | Bacteria | 5170 |
| 259 | Ga0373947_0002766 | 3300035725 | Bacteria | 10498 |
| 260 | Ga0373925_0009090 | 3300037068 | Bacteria | 7232 |
| 261 | Ga0395899_0000105 | 3300037312 | Bacteria | 146163 |
| 262 | Ga0395899_0000187 | 3300037312 | Bacteria | 90916 |
| 263 | Ga0395899_0054973 | 3300037312 | Bacteria | 2945 |
| 264 | Ga0395900_0000009 | 3300037418 | Bacteria | 476249 |
| 265 | Ga0395898_0003798 | 3300037466 | Bacteria | 16721 |
| 266 | Ga0395898_0031278 | 3300037466 | Bacteria | 5320 |
| 267 | Ga0395898_0047271 | 3300037466 | Bacteria | 4224 |
| 268 | Ga0395905_0010042 | 3300037471 | Bacteria | 9227 |
| 269 | Ga0395905_0027293 | 3300037471 | Bacteria | 5384 |
| 270 | Ga0395901_0000412 | 3300038443 | Bacteria | 50385 |
| 271 | Ga0395901_0027857 | 3300038443 | Bacteria | 5810 |
| 272 | Ga0436365_1544656 | 3300039437 | Bacteria | 122419 |
| 273 | Ga0436361_0196619 | 3300039447 | Bacteria | 31824 |
| 274 | Ga0495627_001069 | 3300046453 | Bacteria | 18121 |
| 275 | Ga0495603_0006609 | 3300046455 | Bacteria | 6955 |
| 276 | Ga0495590_0004125 | 3300046457 | Bacteria | 5888 |
| 277 | Ga0495629_0047944 | 3300046459 | Bacteria | 2996 |
| 278 | Ga0495638_0000845 | 3300046460 | Bacteria | 32033 |
| 279 | Ga0495638_0002190 | 3300046460 | Bacteria | 16335 |
| 280 | Ga0495638_0007957 | 3300046460 | Bacteria | 7561 |
| 281 | Ga0495641_0014235 | 3300046461 | Bacteria | 4314 |
| 282 | Ga0495650_0000030 | 3300046471 | Bacteria | 436318 |
| 283 | Ga0495580_0000835 | 3300046472 | Bacteria | 26710 |
| 284 | Ga0495582_0013002 | 3300046473 | Bacteria | 4585 |
| 285 | Ga0495639_0003675 | 3300046475 | Bacteria | 6606 |
| 286 | Ga0495594_0000613 | 3300046499 | Bacteria | 18380 |
| 287 | Ga0495583_0000002 | 3300046506 | Bacteria | 782521 |
| 288 | Ga0495610_0000091 | 3300046512 | Bacteria | 105916 |
| 289 | Ga0495610_0015694 | 3300046512 | Bacteria | 4391 |
| 290 | Ga0495616_0000094 | 3300046513 | Bacteria | 75611 |
| 291 | Ga0495631_0004438 | 3300046518 | Bacteria | 7473 |
| 292 | Ga0495632_0005026 | 3300046519 | Bacteria | 8859 |
| 293 | Ga0495643_0006008 | 3300046522 | Bacteria | 8098 |
| 294 | Ga0495648_0000154 | 3300046524 | Bacteria | 81679 |
| 295 | Ga0495654_0000048 | 3300046530 | Bacteria | 147348 |
| 296 | Ga0495640_0057631 | 3300046533 | Bacteria | 2651 |
| 297 | Ga0495622_0000576 | 3300046557 | Bacteria | 22007 |
| 298 | Ga0495622_0011792 | 3300046557 | Bacteria | 4041 |
| 299 | Ga0495633_0000683 | 3300046558 | Bacteria | 31294 |
| 300 | Ga0495668_0000703 | 3300046616 | Bacteria | 40297 |
| 301 | Ga0495634_0021531 | 3300046642 | Bacteria | 4555 |
| 302 | Ga0495625_0000058 | 3300046660 | Bacteria | 180863 |
| 303 | Ga0495625_0017730 | 3300046660 | Bacteria | 5569 |
| 304 | Ga0495658_0005032 | 3300046683 | Bacteria | 6494 |
| 305 | Ga0495669_0000196 | 3300046684 | Bacteria | 37390 |
| 306 | Ga0495669_0000440 | 3300046684 | Bacteria | 19763 |
| 307 | Ga0495613_0003198 | 3300046689 | Bacteria | 12258 |
| 308 | Ga0495649_0000137 | 3300046694 | Bacteria | 63846 |
| 309 | Ga0495672_0025974 | 3300047320 | Bacteria | 3743 |
| 310 | Ga0495676_0006996 | 3300047321 | Bacteria | 10354 |
| 311 | Ga0495680_0022388 | 3300047322 | Bacteria | 5267 |
| 312 | Ga0495673_0001111 | 3300047469 | Bacteria | 23151 |
| 313 | Ga0495686_0000023 | 3300047472 | Bacteria | 400457 |
| 314 | Ga0495686_0004001 | 3300047472 | Bacteria | 12338 |
| 315 | Ga0495686_0009196 | 3300047472 | Bacteria | 7153 |
| 316 | Ga0495593_0005747 | 3300047673 | Bacteria | 7320 |
| 317 | Ga0495614_0012165 | 3300048089 | Bacteria | 3778 |
| 318 | Ga0496100_0010657 | 3300048903 | Bacteria | 5210 |
| 319 | Ga0496100_0012620 | 3300048903 | Bacteria | 4848 |
| 320 | Ga0496101_0011414 | 3300048904 | Bacteria | 5892 |
| 321 | Ga0496102_0025967 | 3300048905 | Bacteria | 5219 |
| 322 | Ga0496103_0017170 | 3300048906 | Bacteria | 4327 |
| 323 | Ga0496103_0018370 | 3300048906 | Bacteria | 4194 |
| 324 | Ga0496104_0038842 | 3300048907 | Bacteria | 4455 |
| 325 | Ga0496105_0016729 | 3300048908 | Bacteria | 5861 |
| 326 | Ga0496105_0017926 | 3300048908 | Bacteria | 5682 |
| 327 | Ga0496106_0007857 | 3300048909 | Bacteria | 7891 |
| 328 | Ga0496106_0041824 | 3300048909 | Bacteria | 3435 |
| 329 | Ga0496107_0000188 | 3300048910 | Bacteria | 32167 |
| 330 | Ga0496107_0012751 | 3300048910 | Bacteria | 5873 |
| 331 | Ga0496107_0014751 | 3300048910 | Bacteria | 5472 |
| 332 | Ga0496107_0020025 | 3300048910 | Bacteria | 4725 |
| 333 | Ga0496110_0012468 | 3300048913 | Bacteria | 6990 |
| 334 | Ga0496112_0015861 | 3300048915 | Bacteria | 7041 |
| 335 | Ga0496112_0020962 | 3300048915 | Bacteria | 6206 |
| 336 | Ga0496114_0005457 | 3300048917 | Bacteria | 9946 |
| 337 | Ga0496114_0010185 | 3300048917 | Bacteria | 7480 |
| 338 | Ga0496115_0003924 | 3300048918 | Bacteria | 10719 |
| 339 | Ga0496115_0004007 | 3300048918 | Bacteria | 10628 |
| 340 | Ga0496115_0005793 | 3300048918 | Bacteria | 8995 |
| 341 | Ga0496115_0020360 | 3300048918 | Bacteria | 5117 |
| 342 | Ga0496116_0026493 | 3300048919 | Bacteria | 4239 |
| 343 | Ga0496116_0054440 | 3300048919 | Bacteria | 2636 |
| 344 | Ga0496117_0025858 | 3300048920 | Bacteria | 4603 |
| 345 | Ga0496118_0005250 | 3300048921 | Bacteria | 14796 |
| 346 | Ga0496121_0000855 | 3300048924 | Bacteria | 55079 |
| 347 | Ga0496123_0003500 | 3300048926 | Bacteria | 17502 |
| 348 | Ga0496124_0022711 | 3300048927 | Bacteria | 5745 |
| 349 | Ga0496125_0004967 | 3300048928 | Bacteria | 15042 |
| 350 | Ga0496126_0012930 | 3300048929 | Bacteria | 8522 |
| 351 | Ga0495678_001825 | 3300049459 | Bacteria | 15648 |
| 352 | Ga0501032_0025677 | 3300049569 | Bacteria | 4060 |
| 353 | Ga0501033_0003581 | 3300049570 | Bacteria | 12702 |
| 354 | Ga0501034_0010715 | 3300049571 | Bacteria | 9524 |
| 355 | Ga0501034_0089768 | 3300049571 | Bacteria | 3071 |
| 356 | Ga0501037_0016277 | 3300049573 | Bacteria | 5474 |
| 357 | Ga0501037_0025999 | 3300049573 | Bacteria | 4325 |
| 358 | Ga0501038_0109959 | 3300049574 | Bacteria | 2284 |
| 359 | Ga0501039_0003564 | 3300049575 | Bacteria | 11665 |
| 360 | Ga0501040_0028466 | 3300049576 | Bacteria | 3767 |
| 361 | Ga0501041_0035157 | 3300049577 | Bacteria | 3035 |
| 362 | Ga0501042_0003871 | 3300049578 | Bacteria | 9460 |
| 363 | Ga0501043_0005504 | 3300049579 | Bacteria | 10226 |
| 364 | Ga0501046_0009297 | 3300049580 | Bacteria | 8509 |
| 365 | Ga0501046_0050580 | 3300049580 | Bacteria | 3282 |
| 366 | Ga0501047_0005187 | 3300049581 | Bacteria | 12228 |
| 367 | Ga0501048_0041058 | 3300049582 | Bacteria | 3314 |
| 368 | Ga0501067_0011273 | 3300049583 | Bacteria | 4948 |
| 369 | Ga0501070_0052142 | 3300049586 | Bacteria | 3396 |
| 370 | Ga0501072_0028771 | 3300049588 | Bacteria | 4338 |
| 371 | Ga0501073_0006543 | 3300049589 | Bacteria | 8671 |
| 372 | Ga0501074_0015706 | 3300049590 | Bacteria | 5505 |
| 373 | Ga0501074_0017508 | 3300049590 | Bacteria | 5201 |
| 374 | Ga0501076_0024237 | 3300049592 | Bacteria | 4687 |
| 375 | Ga0501077_0017215 | 3300049593 | Bacteria | 4558 |
| 376 | Ga0501079_0011192 | 3300049741 | Bacteria | 6844 |
| 377 | Ga0501080_0001120 | 3300049742 | Bacteria | 22070 |
| 378 | Ga0501080_0018941 | 3300049742 | Bacteria | 6376 |
| 379 | Ga0501080_0038100 | 3300049742 | Bacteria | 4490 |
| 380 | Ga0501081_0012348 | 3300049743 | Bacteria | 5610 |
| 381 | Ga0501083_0011443 | 3300049744 | Bacteria | 6224 |
| 382 | Ga0501083_0013378 | 3300049744 | Bacteria | 5735 |
| 383 | Ga0501035_0059285 | 3300049822 | Bacteria | 3409 |
| 384 | Ga0501044_0001454 | 3300049823 | Bacteria | 27833 |
| 385 | Ga0501044_0006211 | 3300049823 | Bacteria | 13205 |
| 386 | Ga0501044_0026763 | 3300049823 | Bacteria | 6103 |
| 387 | Ga0501044_0058172 | 3300049823 | Bacteria | 3965 |
| 388 | nmdc:mga0k408_14951_c1 | 3300050493 | Bacteria | 4286 |
| 389 | nmdc:mga06z11_8169_c1 | 3300050494 | Bacteria | 4348 |
| 390 | nmdc:mga07m45_9353_c1 | 3300050496 | Bacteria | 5081 |
| 391 | nmdc:mga09592_11742_c1 | 3300050508 | Bacteria | 7121 |
| 392 | nmdc:mga0rr50_36238_c1 | 3300050513 | Bacteria | 3551 |
| 393 | nmdc:mga0a205_42056_c1 | 3300050515 | Bacteria | 4403 |
| 394 | Ga0500635_0000102 | 3300053080 | Bacteria | 51023 |
| 395 | Ga0495655_0000470 | 3300053083 | Bacteria | 6771 |
| 396 | Ga0495619_0003486 | 3300053085 | Bacteria | 10155 |
| 397 | Ga0500578_0001504 | 3300053086 | Bacteria | 23136 |
| 398 | Ga0500644_0000340 | 3300053088 | Bacteria | 23717 |
| 399 | Ga0500651_0016514 | 3300053093 | Bacteria | 4543 |
| 400 | Ga0500562_000533 | 3300053108 | Bacteria | 9246 |
| 401 | Ga0500562_004027 | 3300053108 | Bacteria | 3702 |
| 402 | Ga0500572_000654 | 3300053111 | Bacteria | 11472 |
| 403 | Ga0500594_0000137 | 3300053118 | Bacteria | 20341 |
| 404 | Ga0500608_000007 | 3300053122 | Bacteria | 100296 |
| 405 | Ga0500608_019259 | 3300053122 | Bacteria | 3126 |
| 406 | Ga0500614_004558 | 3300053123 | Bacteria | 2922 |
| 407 | Ga0500618_000064 | 3300053125 | Bacteria | 91120 |
| 408 | Ga0500658_0004233 | 3300053134 | Bacteria | 5383 |
| 409 | Ga0500559_0000062 | 3300053136 | Bacteria | 87142 |
| 410 | Ga0500559_0001041 | 3300053136 | Bacteria | 16972 |
| 411 | Ga0500564_022578 | 3300053138 | Bacteria | 2879 |
| 412 | Ga0500573_0009968 | 3300053140 | Bacteria | 5294 |
| 413 | Ga0500577_0003591 | 3300053142 | Bacteria | 4037 |
| 414 | Ga0500622_0005194 | 3300053156 | Bacteria | 7883 |
| 415 | Ga0500627_0012039 | 3300053158 | Bacteria | 3224 |
| 416 | Ga0500636_0022627 | 3300053177 | Bacteria | 3715 |
| 417 | Ga0500645_006395 | 3300053730 | Bacteria | 4209 |
| 418 | Ga0500596_000375 | 3300053735 | Bacteria | 8109 |
| 419 | Ga0501084_0006333 | 3300054114 | Bacteria | 9721 |
| 420 | Ga0501084_0046214 | 3300054114 | Bacteria | 3647 |
| 421 | Ga0501082_0052603 | 3300060353 | Bacteria | 3510 |
| 422 | Ga0530510_0006954 | 3300061734 | Bacteria | 7884 |
| 423 | Ga0530510_0010600 | 3300061734 | Bacteria | 6463 |
| 424 | 2643928918 | 2643221584 | Bacteria | 5511711 |
| 425 | 2511124832 | 2510917020 | Bacteria | 5657507 |
| 426 | 2545678670 | 2545555834 | Bacteria | 8130841 |
| 427 | 2561466209 | 2558860983 | Bacteria | 4133860 |
| 428 | 2585146882 | 2582581279 | Bacteria | 4980720 |
| 429 | 2585151422 | 2582581280 | Bacteria | 5994497 |
| 430 | 2585196135 | 2582581293 | Bacteria | 5907401 |
| 431 | 2587919447 | 2585428106 | Bacteria | 5179711 |
| 432 | 2643749507 | 2643221545 | Bacteria | 5083237 |
| 433 | 2643782706 | 2643221552 | Bacteria | 5708754 |
| 434 | 2643883078 | 2643221574 | Bacteria | 2789653 |
| 435 | 2643926479 | 2643221583 | Bacteria | 5218014 |
| 436 | 2644000446 | 2643221598 | Bacteria | 4578346 |
| 437 | 2644084777 | 2643221614 | Bacteria | 4260023 |
| 438 | 2644225278 | 2643221640 | Bacteria | 5258820 |
| 439 | 2644232586 | 2643221642 | Bacteria | 5357871 |
| 440 | 2644342329 | 2643221661 | Bacteria | 4267604 |
| 441 | 2644352354 | 2643221663 | Bacteria | 3425771 |
| 442 | 2644365629 | 2643221666 | Bacteria | 4265935 |
| 443 | 2644508463 | 2643221691 | Bacteria | 5093099 |
| 444 | 2644550018 | 2643221699 | Bacteria | 5731501 |
| 445 | 2644552503 | 2643221699 | Bacteria | 5731501 |
| 446 | 2792463466 | 2791355048 | Bacteria | 5832535 |
| 447 | 2819536992 | 2818991435 | Bacteria | 5433759 |
| 448 | 2819645404 | 2818991454 | Bacteria | 5563326 |
| 449 | 2843748935 | 2843744320 | Bacteria | 5659202 |
| 450 | 2849563018 | 2849560528 | Bacteria | 5393480 |
| 451 | 2849575219 | 2849573788 | Bacteria | 5421256 |
| 452 | 2851157601 | 2851153111 | Bacteria | 5542585 |
| 453 | 2854685229 | 2854681122 | Bacteria | 4548679 |
| 454 | 2857504591 | 2857504554 | Bacteria | 5369913 |
| 455 | 2884960696 | 2884960567 | Bacteria | 5437054 |
| 456 | 2898333510 | 2898329390 | Bacteria | 5168154 |
| 457 | 2898795415 | 2898795034 | Bacteria | 4294459 |
| 458 | 2928534406 | 2928531327 | Bacteria | 5101314 |
| 459 | 2928972577 | 2928972540 | Bacteria | 3058286 |
| 460 | 2941487153 | 2941485952 | Bacteria | 3591484 |
| 461 | 2977242357 | 2977240413 | Bacteria | 3191065 |
| 462 | 3003666246 | 3003665799 | Bacteria | 7279786 |
| 463 | 641646758 | 641522639 | Bacteria | 7737025 |
| 464 | 643604965 | 643348564 | Bacteria | 8839022 |
| 465 | Ga0055536_1000987 | |||
| 466 | Ga0055530_10001456 | |||
| 467 | Ga0055531_10001343 | |||
| 468 | Ga0055531_10007312 | |||
| 469 | Ga0065165_1000210 | |||
| 470 | Ga0065165_1001315 | |||
| 471 | Ga0070658_10009327 | |||
| 472 | Ga0070690_100009151 | |||
| 473 | Ga0070670_100020452 | |||
| 474 | Ga0070670_100071813 | |||
| 475 | Ga0070666_10001864 | |||
| 476 | Ga0070680_100007270 | |||
| 477 | Ga0070680_100030191 | |||
| 478 | Ga0070682_100000573 | |||
| 479 | Ga0070689_100000136 | |||
| 480 | Ga0070691_10000418 | |||
| 481 | Ga0070687_100002559 | |||
| 482 | Ga0070661_100002616 | |||
| 483 | Ga0070692_10002091 | |||
| 484 | Ga0070668_100000188 | |||
| 485 | Ga0070668_100004770 | |||
| 486 | Ga0070668_100008308 | |||
| 487 | Ga0070668_100011123 | |||
| 488 | Ga0070668_100057108 | |||
| 489 | Ga0070669_100001556 | |||
| 490 | Ga0070675_100003757 | |||
| 491 | Ga0070671_100002522 | |||
| 492 | Ga0070671_100014389 | |||
| 493 | Ga0070671_100049487 | |||
| 494 | Ga0070674_100000832 | |||
| 495 | Ga0070673_100007489 | |||
| 496 | Ga0070688_100000981 | |||
| 497 | Ga0070659_100003308 | |||
| 498 | Ga0070659_100018771 | |||
| 499 | Ga0070667_100001681 | |||
| 500 | Ga0070667_100073353 | |||
| 501 | Ga0070709_10006653 | |||
| 502 | Ga0070714_100021168 | |||
| 503 | Ga0070713_100004713 | |||
| 504 | Ga0070710_10001222 | |||
| 505 | Ga0070711_100000961 | |||
| 506 | Ga0070705_100000300 | |||
| 507 | Ga0070694_100000659 | |||
| 508 | Ga0070663_100001220 | |||
| 509 | Ga0070678_100000123 | |||
| 510 | Ga0070678_100059622 | |||
| 511 | Ga0070662_100000339 | |||
| 512 | Ga0070681_10018656 | |||
| 513 | Ga0070681_10048740 | |||
| 514 | Ga0070681_10052521 | |||
| 515 | Ga0068867_100005776 | |||
| 516 | Ga0070699_100049738 | |||
| 517 | Ga0070679_100004727 | |||
| 518 | Ga0070679_100113678 | |||
| 519 | Ga0070684_100014306 | |||
| 520 | Ga0070697_100003199 | |||
| 521 | Ga0068853_100002127 | |||
| 522 | Ga0068853_100037667 | |||
| 523 | Ga0068853_100060126 | |||
| 524 | Ga0070686_100003722 | |||
| 525 | Ga0070695_100000995 | |||
| 526 | Ga0070693_100000993 | |||
| 527 | Ga0070665_100000121 | |||
| 528 | Ga0070665_100011802 | |||
| 529 | Ga0070665_100064235 | |||
| 530 | Ga0070704_100000607 | |||
| 531 | Ga0070704_100037711 | |||
| 532 | Ga0068855_100003471 | |||
| 533 | Ga0068855_100029068 | |||
| 534 | Ga0070664_100017429 | |||
| 535 | Ga0068856_100004777 | |||
| 536 | Ga0070702_100000022 | |||
| 537 | Ga0070702_100007136 | |||
| 538 | Ga0068859_100000401 | |||
| 539 | Ga0068859_100007821 | |||
| 540 | Ga0068859_100008488 | |||
| 541 | Ga0068864_100001763 | |||
| 542 | Ga0068864_100004252 | |||
| 543 | Ga0068866_10004814 | |||
| 544 | Ga0068861_100001574 | |||
| 545 | Ga0068863_100000367 | |||
| 546 | Ga0068863_100001307 | |||
| 547 | Ga0068863_100012729 | |||
| 548 | Ga0068858_100000219 | |||
| 549 | Ga0068858_100001450 | |||
| 550 | Ga0068860_100000055 | |||
| 551 | Ga0068860_100001852 | |||
| 552 | Ga0068862_100002363 | |||
| 553 | Ga0081455_10002778 | |||
| 554 | Ga0081455_10014016 | |||
| 555 | Ga0075364_10001667 | |||
| 556 | Ga0070715_10000079 | |||
| 557 | Ga0070716_100001144 | |||
| 558 | Ga0070712_100011410 | |||
| 559 | Ga0075367_10003590 | |||
| 560 | Ga0075366_10005401 | |||
| 561 | Ga0075428_100064350 | |||
| 562 | Ga0075429_100056071 | |||
| 563 | Ga0068865_100001515 | |||
| 564 | Ga0068865_100002767 | |||
| 565 | Ga0075436_100007838 | |||
| 566 | Ga0097620_100000401 | |||
| 567 | Ga0097620_100007821 | |||
| 568 | Ga0097620_100008488 | |||
| 569 | Ga0105240_10059050 | |||
| 570 | Ga0105240_10084081 | |||
| 571 | Ga0105245_10002367 | |||
| 572 | Ga0105247_10001141 | |||
| 573 | Ga0105247_10026785 | |||
| 574 | Ga0114129_10134978 | |||
| 575 | Ga0105243_10000417 | |||
| 576 | Ga0105241_10000456 | |||
| 577 | Ga0105242_10002247 | |||
| 578 | Ga0105248_10000293 | |||
| 579 | Ga0105248_10001413 | |||
| 580 | Ga0105248_10015712 | |||
| 581 | Ga0105248_10028939 | |||
| 582 | Ga0105237_10000712 | |||
| 583 | Ga0105238_10056706 | |||
| 584 | Ga0105249_10000591 | |||
| 585 | Ga0105239_10036997 | |||
| 586 | Ga0105239_10041715 | |||
| 587 | Ga0105239_10073938 | |||
| 588 | Ga0105246_10000118 | |||
| 589 | Ga0157373_10001230 | |||
| 590 | Ga0157373_10001673 | |||
| 591 | Ga0157371_10002724 | |||
| 592 | Ga0157371_10005561 | |||
| 593 | Ga0157369_10032544 | |||
| 594 | Ga0157374_10004169 | |||
| 595 | Ga0157378_10000643 | |||
| 596 | Ga0163162_10018088 | |||
| 597 | Ga0163162_10094427 | |||
| 598 | Ga0157372_10001248 | |||
| 599 | Ga0157375_10002203 | |||
| 600 | Ga0157375_10002372 | |||
| 601 | Ga0163163_10005028 | |||
| 602 | Ga0163163_10007000 | |||
| 603 | Ga0157379_10000531 | |||
| 604 | Ga0157379_10000933 | |||
| 605 | Ga0157379_10071208 | |||
| 606 | Ga0157376_10001069 | |||
| 607 | Ga0163161_10003267 | |||
| 608 | Ga0213876_10000108 | |||
| 609 | Ga0209026_1003240 | |||
| 610 | Ga0209565_1000469 | |||
| 611 | Ga0209673_1001526 | |||
| 612 | Ga0209675_1006670 | |||
| 613 | Ga0209676_1000444 | |||
| 614 | Ga0209676_1000691 | |||
| 615 | Ga0209676_1001269 | |||
| 616 | Ga0209676_1002398 | |||
| 617 | Ga0209676_1005965 | |||
| 618 | Ga0209564_1001610 | |||
| 619 | Ga0209758_1001228 | |||
| 620 | Ga0209758_1002410 | |||
| 621 | Ga0209050_1000101 | |||
| 622 | Ga0209050_1001896 | |||
| 623 | Ga0209050_1005582 | |||
| 624 | Ga0209256_1004179 | |||
| 625 | Ga0209256_1004748 | |||
| 626 | Ga0209256_1007832 | |||
| 627 | Ga0209051_1005103 | |||
| 628 | Ga0209257_1000187 | |||
| 629 | Ga0209257_1000284 | |||
| 630 | Ga0209257_1003467 | |||
| 631 | Ga0209257_1005485 | |||
| 632 | Ga0207692_10002406 | |||
| 633 | Ga0207710_10001630 | |||
| 634 | Ga0207688_10000764 | |||
| 635 | Ga0207680_10007037 | |||
| 636 | Ga0207647_10000924 | |||
| 637 | Ga0207645_10004812 | |||
| 638 | Ga0207705_10034512 | |||
| 639 | Ga0207654_10019680 | |||
| 640 | Ga0207707_10016493 | |||
| 641 | Ga0207695_10001328 | |||
| 642 | Ga0207695_10002756 | |||
| 643 | Ga0207695_10009972 | |||
| 644 | Ga0207695_10042812 | |||
| 645 | Ga0207671_10007807 | |||
| 646 | Ga0207693_10000703 | |||
| 647 | Ga0207663_10001248 | |||
| 648 | Ga0207662_10002213 | |||
| 649 | Ga0207657_10000304 | |||
| 650 | Ga0207649_10002403 | |||
| 651 | Ga0207681_10002820 | |||
| 652 | Ga0207681_10030272 | |||
| 653 | Ga0207650_10015427 | |||
| 654 | Ga0207687_10001882 | |||
| 655 | Ga0207700_10057712 | |||
| 656 | Ga0207664_10019851 | |||
| 657 | Ga0207644_10001379 | |||
| 658 | Ga0207644_10001431 | |||
| 659 | Ga0207690_10003254 | |||
| 660 | Ga0207690_10004214 | |||
| 661 | Ga0207706_10000263 | |||
| 662 | Ga0207686_10017602 | |||
| 663 | Ga0207709_10004092 | |||
| 664 | Ga0207669_10001156 | |||
| 665 | Ga0207704_10002589 | |||
| 666 | Ga0207665_10000219 | |||
| 667 | Ga0207711_10000482 | |||
| 668 | Ga0207711_10005353 | |||
| 669 | Ga0207711_10019643 | |||
| 670 | Ga0207661_10027776 | |||
| 671 | Ga0207679_10006703 | |||
| 672 | Ga0207667_10013210 | |||
| 673 | Ga0207667_10015747 | |||
| 674 | Ga0207651_10000820 | |||
| 675 | Ga0207712_10008836 | |||
| 676 | Ga0207668_10001837 | |||
| 677 | Ga0207668_10018672 | |||
| 678 | Ga0207668_10027208 | |||
| 679 | Ga0207640_10016518 | |||
| 680 | Ga0207658_10025129 | |||
| 681 | Ga0207658_10029654 | |||
| 682 | Ga0207703_10000659 | |||
| 683 | Ga0207703_10005045 | |||
| 684 | Ga0207703_10037175 | |||
| 685 | Ga0207639_10001097 | |||
| 686 | Ga0207678_10000209 | |||
| 687 | Ga0207702_10007071 | |||
| 688 | Ga0207641_10000070 | |||
| 689 | Ga0207641_10002297 | |||
| 690 | Ga0207641_10007322 | |||
| 691 | Ga0207648_10013547 | |||
| 692 | Ga0207676_10011604 | |||
| 693 | Ga0207674_10000719 | |||
| 694 | Ga0207675_100000482 | |||
| 695 | Ga0207683_10000405 | |||
| 696 | Ga0207698_10003577 | |||
| 697 | Ga0209998_10003648 | |||
| 698 | Ga0268266_10000106 | |||
| 699 | Ga0268266_10012465 | |||
| 700 | Ga0268265_10003719 | |||
| 701 | Ga0268265_10011541 | |||
| 702 | Ga0268264_10000112 | |||
| 703 | Ga0307517_10009198 | |||
| 704 | Ga0307515_10076207 | |||
| 705 | Ga0265338_10022923 | |||
| 706 | Ga0265327_10000568 | |||
| 707 | Ga0265316_10040482 | |||
| 708 | Ga0307513_10000162 | |||
| 709 | Ga0307513_10002892 | |||
| 710 | Ga0307513_10004143 | |||
| 711 | Ga0307513_10033858 | |||
| 712 | Ga0265314_10008757 | |||
| 713 | Ga0307516_10000154 | |||
| 714 | Ga0307406_10001747 | |||
| 715 | Ga0307414_10030432 | |||
| 716 | Ga0307414_10032967 | |||
| 717 | Ga0307510_10074058 | |||
| 718 | Ga0316574_0001826 | |||
| 719 | Ga0373931_0007659 | |||
| 720 | Ga0373931_0012143 | |||
| 721 | Ga0373935_0073643 | |||
| 722 | Ga0373927_0014733 | |||
| 723 | Ga0373947_0002766 | |||
| 724 | Ga0373925_0009090 | |||
| 725 | Ga0395899_0000105 | |||
| 726 | Ga0395899_0000187 | |||
| 727 | Ga0395899_0054973 | |||
| 728 | Ga0395900_0000009 | |||
| 729 | Ga0395898_0003798 | |||
| 730 | Ga0395898_0031278 | |||
| 731 | Ga0395898_0047271 | |||
| 732 | Ga0395905_0010042 | |||
| 733 | Ga0395905_0027293 | |||
| 734 | Ga0395901_0000412 | |||
| 735 | Ga0395901_0027857 | |||
| 736 | Ga0436365_1544656 | |||
| 737 | Ga0436361_0196619 | |||
| 738 | Ga0495627_001069 | |||
| 739 | Ga0495603_0006609 | |||
| 740 | Ga0495590_0004125 | |||
| 741 | Ga0495629_0047944 | |||
| 742 | Ga0495638_0000845 | |||
| 743 | Ga0495638_0002190 | |||
| 744 | Ga0495638_0007957 | |||
| 745 | Ga0495641_0014235 | |||
| 746 | Ga0495650_0000030 | |||
| 747 | Ga0495580_0000835 | |||
| 748 | Ga0495582_0013002 | |||
| 749 | Ga0495639_0003675 | |||
| 750 | Ga0495594_0000613 | |||
| 751 | Ga0495583_0000002 | |||
| 752 | Ga0495610_0000091 | |||
| 753 | Ga0495610_0015694 | |||
| 754 | Ga0495616_0000094 | |||
| 755 | Ga0495631_0004438 | |||
| 756 | Ga0495632_0005026 | |||
| 757 | Ga0495643_0006008 | |||
| 758 | Ga0495648_0000154 | |||
| 759 | Ga0495654_0000048 | |||
| 760 | Ga0495640_0057631 | |||
| 761 | Ga0495622_0000576 | |||
| 762 | Ga0495622_0011792 | |||
| 763 | Ga0495633_0000683 | |||
| 764 | Ga0495668_0000703 | |||
| 765 | Ga0495634_0021531 | |||
| 766 | Ga0495625_0000058 | |||
| 767 | Ga0495625_0017730 | |||
| 768 | Ga0495658_0005032 | |||
| 769 | Ga0495669_0000196 | |||
| 770 | Ga0495669_0000440 | |||
| 771 | Ga0495613_0003198 | |||
| 772 | Ga0495649_0000137 | |||
| 773 | Ga0495672_0025974 | |||
| 774 | Ga0495676_0006996 | |||
| 775 | Ga0495680_0022388 | |||
| 776 | Ga0495673_0001111 | |||
| 777 | Ga0495686_0000023 | |||
| 778 | Ga0495686_0004001 | |||
| 779 | Ga0495686_0009196 | |||
| 780 | Ga0495593_0005747 | |||
| 781 | Ga0495614_0012165 | |||
| 782 | Ga0496100_0010657 | |||
| 783 | Ga0496100_0012620 | |||
| 784 | Ga0496101_0011414 | |||
| 785 | Ga0496102_0025967 | |||
| 786 | Ga0496103_0017170 | |||
| 787 | Ga0496103_0018370 | |||
| 788 | Ga0496104_0038842 | |||
| 789 | Ga0496105_0016729 | |||
| 790 | Ga0496105_0017926 | |||
| 791 | Ga0496106_0007857 | |||
| 792 | Ga0496106_0041824 | |||
| 793 | Ga0496107_0000188 | |||
| 794 | Ga0496107_0012751 | |||
| 795 | Ga0496107_0014751 | |||
| 796 | Ga0496107_0020025 | |||
| 797 | Ga0496110_0012468 | |||
| 798 | Ga0496112_0015861 | |||
| 799 | Ga0496112_0020962 | |||
| 800 | Ga0496114_0005457 | |||
| 801 | Ga0496114_0010185 | |||
| 802 | Ga0496115_0003924 | |||
| 803 | Ga0496115_0004007 | |||
| 804 | Ga0496115_0005793 | |||
| 805 | Ga0496115_0020360 | |||
| 806 | Ga0496116_0026493 | |||
| 807 | Ga0496116_0054440 | |||
| 808 | Ga0496117_0025858 | |||
| 809 | Ga0496118_0005250 | |||
| 810 | Ga0496121_0000855 | |||
| 811 | Ga0496123_0003500 | |||
| 812 | Ga0496124_0022711 | |||
| 813 | Ga0496125_0004967 | |||
| 814 | Ga0496126_0012930 | |||
| 815 | Ga0495678_001825 | |||
| 816 | Ga0501032_0025677 | |||
| 817 | Ga0501033_0003581 | |||
| 818 | Ga0501034_0010715 | |||
| 819 | Ga0501034_0089768 | |||
| 820 | Ga0501037_0016277 | |||
| 821 | Ga0501037_0025999 | |||
| 822 | Ga0501038_0109959 | |||
| 823 | Ga0501039_0003564 | |||
| 824 | Ga0501040_0028466 | |||
| 825 | Ga0501041_0035157 | |||
| 826 | Ga0501042_0003871 | |||
| 827 | Ga0501043_0005504 | |||
| 828 | Ga0501046_0009297 | |||
| 829 | Ga0501046_0050580 | |||
| 830 | Ga0501047_0005187 | |||
| 831 | Ga0501048_0041058 | |||
| 832 | Ga0501067_0011273 | |||
| 833 | Ga0501070_0052142 | |||
| 834 | Ga0501072_0028771 | |||
| 835 | Ga0501073_0006543 | |||
| 836 | Ga0501074_0015706 | |||
| 837 | Ga0501074_0017508 | |||
| 838 | Ga0501076_0024237 | |||
| 839 | Ga0501077_0017215 | |||
| 840 | Ga0501079_0011192 | |||
| 841 | Ga0501080_0001120 | |||
| 842 | Ga0501080_0018941 | |||
| 843 | Ga0501080_0038100 | |||
| 844 | Ga0501081_0012348 | |||
| 845 | Ga0501083_0011443 | |||
| 846 | Ga0501083_0013378 | |||
| 847 | Ga0501035_0059285 | |||
| 848 | Ga0501044_0001454 | |||
| 849 | Ga0501044_0006211 | |||
| 850 | Ga0501044_0026763 | |||
| 851 | Ga0501044_0058172 | |||
| 852 | nmdc:mga0k408_14951_c1 | |||
| 853 | nmdc:mga06z11_8169_c1 | |||
| 854 | nmdc:mga07m45_9353_c1 | |||
| 855 | nmdc:mga09592_11742_c1 | |||
| 856 | nmdc:mga0rr50_36238_c1 | |||
| 857 | nmdc:mga0a205_42056_c1 | |||
| 858 | Ga0500635_0000102 | |||
| 859 | Ga0495655_0000470 | |||
| 860 | Ga0495619_0003486 | |||
| 861 | Ga0500578_0001504 | |||
| 862 | Ga0500644_0000340 | |||
| 863 | Ga0500651_0016514 | |||
| 864 | Ga0500562_000533 | |||
| 865 | Ga0500562_004027 | |||
| 866 | Ga0500572_000654 | |||
| 867 | Ga0500594_0000137 | |||
| 868 | Ga0500608_000007 | |||
| 869 | Ga0500608_019259 | |||
| 870 | Ga0500614_004558 | |||
| 871 | Ga0500618_000064 | |||
| 872 | Ga0500658_0004233 | |||
| 873 | Ga0500559_0000062 | |||
| 874 | Ga0500559_0001041 | |||
| 875 | Ga0500564_022578 | |||
| 876 | Ga0500573_0009968 | |||
| 877 | Ga0500577_0003591 | |||
| 878 | Ga0500622_0005194 | |||
| 879 | Ga0500627_0012039 | |||
| 880 | Ga0500636_0022627 | |||
| 881 | Ga0500645_006395 | |||
| 882 | Ga0500596_000375 | |||
| 883 | Ga0501084_0006333 | |||
| 884 | Ga0501084_0046214 | |||
| 885 | Ga0501082_0052603 | |||
| 886 | Ga0530510_0006954 | |||
| 887 | Ga0530510_0010600 | |||
| 888 | 2643928918 | |||
| 889 | 2511124832 | |||
| 890 | 2545678670 | |||
| 891 | 2561466209 | |||
| 892 | 2585146882 | |||
| 893 | 2585151422 | |||
| 894 | 2585196135 | |||
| 895 | 2587919447 | |||
| 896 | 2643749507 | |||
| 897 | 2643782706 | |||
| 898 | 2643883078 | |||
| 899 | 2643926479 | |||
| 900 | 2644000446 | |||
| 901 | 2644084777 | |||
| 902 | 2644225278 | |||
| 903 | 2644232586 | |||
| 904 | 2644342329 | |||
| 905 | 2644352354 | |||
| 906 | 2644365629 | |||
| 907 | 2644508463 | |||
| 908 | 2644550018 | |||
| 909 | 2644552503 | |||
| 910 | 2792463466 | |||
| 911 | 2819536992 | |||
| 912 | 2819645404 | |||
| 913 | 2843748935 | |||
| 914 | 2849563018 | |||
| 915 | 2849575219 | |||
| 916 | 2851157601 | |||
| 917 | 2854685229 | |||
| 918 | 2857504591 | |||
| 919 | 2884960696 | |||
| 920 | 2898333510 | |||
| 921 | 2898795415 | |||
| 922 | 2928534406 | |||
| 923 | 2928972577 | |||
| 924 | 2941487153 | |||
| 925 | 2977242357 | |||
| 926 | 3003666246 | |||
| 927 | 641646758 | |||
| 928 | 643604965 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7dol-assembly1.cif.gz_A | mycoplasma genitalium rnase r in complex with double-stranded rna | 0.9134 | 140 | 715 |
| 1kl9-assembly1.cif.gz_A | crystal structure of the n-terminal segment of human eukaryotic initiation factor 2alpha | 0.9042 | 633 | 713 |
| 8cdv-assembly1.cif.gz_C | rnase r bound to a 30s degradation intermediate (state ii) | 0.8946 | 225 | 620 |
| 2a1a-assembly1.cif.gz_A | pkr kinase domain-eif2alpha complex | 0.8901 | 633 | 713 |
| 7dol-assembly1.cif.gz_A | mycoplasma genitalium rnase r in complex with double-stranded rna | 0.8807 | 140 | 715 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P39360_5_75_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9174 | 16 | 70 | 1.10.10.10 |
| af_Q9VCX7_866_936_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9004 | 633 | 716 | 2.40.50.140 |
| 2a1aA01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8901 | 633 | 713 | 2.40.50.140 |
| af_Q0D7X0_220_310_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8622 | 633 | 714 | 2.40.50.140 |
| af_Q9N4L5_667_744_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.858 | 634 | 715 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258CTA0-F1-model_v4 | Ribonuclease R | 0.989 | 211 | 571 |
GO:0003723
GO:0004540 GO:0005829 GO:0006402 |
| AF-A0A4Q3RVN0-F1-model_v4 | exoribonuclease II (EC 3.1.13.1) | 0.9882 | 244 | 731 |
GO:0003723
GO:0005829 GO:0006402 GO:0008859 |
| AF-A0A4Q3RVN0-F1-model_v4 | exoribonuclease II (EC 3.1.13.1) | 0.9842 | 244 | 731 |
GO:0003723
GO:0005829 GO:0006402 GO:0008859 |
| AF-A0A520HCW5-F1-model_v4 | RNB domain-containing ribonuclease | 0.9792 | 264 | 687 |
GO:0003723
GO:0004527 GO:0004540 GO:0005829 GO:0006402 |
| AF-A0A258CTA0-F1-model_v4 | Ribonuclease R | 0.9783 | 211 | 571 |
GO:0003723
GO:0004540 GO:0005829 GO:0006402 |