F449459

General Info

Members Datasets Scaffolds Average Seq Length
465 273 930 212

Family's Representative Sequence

Representative Sequence 3300006177|Ga0075362_10015087|Ga0075362_100150873
Length 232
Sequence MAMPRMLQRPTGCGAAPRYTGAMLEKLPEVIGHALHGMRAGLDKIIFNTLGMRQGMASIALTSVAFADHAPLPPRYTADGEGVSPPLQWTDLPAETTSLVLVVEDADSPTPNPLVHAIVVGLRPSEGKLDEAAIPSRDNDGAAGLHVGRNSALQAAWLPPDPPPGHGAHRYAFQIFALGAAPLFSATPGRDEVFNALREHALASGLLIGTWERPDGSIKIEETAPAGPLATG

Samples

Sample ID Description Type Environment
1 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
97 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
98 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
156 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
157 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
158 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
159 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
160 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
161 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
162 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
163 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
164 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
176 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
181 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
182 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
183 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
184 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
185 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
186 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
187 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
188 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
189 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
190 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
191 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
192 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
193 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
194 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
195 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
196 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
197 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
198 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
199 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
202 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
208 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
228 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
229 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
230 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
234 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
235 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
236 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
237 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
238 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
239 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
245 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
246 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
247 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
248 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
249 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
250 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
251 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
252 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
253 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
254 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
255 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
256 2738541277 Variovorax sp. GV051 Isolate Unclassified
257 2738543019 Variovorax sp. GV040 Isolate Unclassified
258 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
259 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
260 2842677519 Variovorax sp. R-72495 Isolate Unclassified
261 2842747753 Variovorax sp. R-72060 Isolate Unclassified
262 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
263 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
264 2904456579 Variovorax sp. 2002 Isolate Unclassified
265 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
266 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
267 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
268 2929520902 Variovorax beijingensis 502 Isolate Unclassified
269 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
270 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
271 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
272 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
273 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.48
Metatranscriptomes 0.22
Isolates 4.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.62
Nodule 0.65
Rhizoplane 9.68
Rhizosphere 67.96
Stem 0
Stem Tuber 0
Unclassified 1.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075362_10015087 3300006177 Bacteria 3136
2 JGI24737J22298_10005122 3300001990 Bacteria 4537
3 JGI24748J21848_1008525 3300002074 Bacteria 1204
4 JGI25151J46595_10002845 3300003187 Bacteria 9965
5 JGI25153J46596_10000073 3300003215 Bacteria 115166
6 Ga0006562J51391_1094908 3300003578 Bacteria 970
7 Ga0055526_1003249 3300003771 Bacteria 10465
8 Ga0055537_1000163 3300003773 Bacteria 49422
9 Ga0055534_1000150 3300003784 Bacteria 51661
10 Ga0055528_1002757 3300003790 Bacteria 9203
11 Ga0055540_1002120 3300003792 Bacteria 10835
12 Ga0065714_10066000 3300005288 Bacteria 7848
13 Ga0070676_10009760 3300005328 Bacteria 5193
14 Ga0070676_10263427 3300005328 Bacteria 1155
15 Ga0070683_100101861 3300005329 Bacteria 2704
16 Ga0070690_100035961 3300005330 Bacteria 3111
17 Ga0070670_100013527 3300005331 Bacteria 6993
18 Ga0070670_100064981 3300005331 Bacteria 3130
19 Ga0070677_10004316 3300005333 Bacteria 4630
20 Ga0070677_10013450 3300005333 Bacteria 2862
21 Ga0070677_10117296 3300005333 Bacteria 1197
22 Ga0068869_100001761 3300005334 Bacteria 12948
23 Ga0068869_100011965 3300005334 Bacteria 5711
24 Ga0070666_10002852 3300005335 Bacteria 10445
25 Ga0068868_100001350 3300005338 Bacteria 16911
26 Ga0070660_100041404 3300005339 Bacteria 3511
27 Ga0070689_100063897 3300005340 Bacteria 2864
28 Ga0070661_100084149 3300005344 Bacteria 2350
29 Ga0070661_100526683 3300005344 Bacteria 948
30 Ga0070692_10121018 3300005345 Bacteria 1460
31 Ga0070668_100071140 3300005347 Bacteria 2709
32 Ga0070669_100064786 3300005353 Bacteria 2691
33 Ga0070669_100340458 3300005353 Unclassified 1215
34 Ga0070669_100595105 3300005353 Bacteria 926
35 Ga0070675_100002027 3300005354 Bacteria 15027
36 Ga0070675_100003621 3300005354 Bacteria 11755
37 Ga0070675_100091797 3300005354 Bacteria 2545
38 Ga0070675_100192438 3300005354 Bacteria 1768
39 Ga0070675_100451201 3300005354 Bacteria 1153
40 Ga0070671_100002683 3300005355 Bacteria 13793
41 Ga0070671_100103636 3300005355 Bacteria 2387
42 Ga0070671_100206647 3300005355 Bacteria 1665
43 Ga0070671_100243866 3300005355 Bacteria 1526
44 Ga0070671_100298815 3300005355 Bacteria 1371
45 Ga0070674_100035202 3300005356 Bacteria 3352
46 Ga0070673_100000957 3300005364 Bacteria 16367
47 Ga0070673_100899301 3300005364 Bacteria 821
48 Ga0070673_100910153 3300005364 Bacteria 816
49 Ga0070688_100018553 3300005365 Bacteria 4017
50 Ga0070659_100013023 3300005366 Bacteria 6184
51 Ga0070659_100044961 3300005366 Bacteria 3459
52 Ga0070667_100028276 3300005367 Bacteria 4667
53 Ga0070667_100052577 3300005367 Bacteria 3438
54 Ga0070678_100001838 3300005456 Bacteria 11462
55 Ga0070678_100016903 3300005456 Bacteria 4680
56 Ga0070678_100148247 3300005456 Bacteria 1886
57 Ga0070662_100011864 3300005457 Bacteria 5761
58 Ga0070662_100124425 3300005457 Bacteria 1980
59 Ga0070662_100575516 3300005457 Bacteria 945
60 Ga0068867_100025408 3300005459 Bacteria 4250
61 Ga0070685_10075224 3300005466 Bacteria 2011
62 Ga0070684_100005675 3300005535 Bacteria 9589
63 Ga0068853_100007126 3300005539 Bacteria 8941
64 Ga0068853_100036888 3300005539 Bacteria 4158
65 Ga0070672_100057210 3300005543 Bacteria 3060
66 Ga0070672_100316914 3300005543 Bacteria 1325
67 Ga0070686_100259070 3300005544 Bacteria 1274
68 Ga0070693_100061787 3300005547 Bacteria 2179
69 Ga0070693_100067547 3300005547 Bacteria 2096
70 Ga0070693_100072761 3300005547 Bacteria 2028
71 Ga0070693_100149453 3300005547 Bacteria 1478
72 Ga0070665_100105581 3300005548 Bacteria 2819
73 Ga0070665_101169638 3300005548 Bacteria 780
74 Ga0068855_100029336 3300005563 Bacteria 6578
75 Ga0068855_100256804 3300005563 Bacteria 1948
76 Ga0070664_100002594 3300005564 Bacteria 14577
77 Ga0068857_100013558 3300005577 Bacteria 7100
78 Ga0068857_100025125 3300005577 Bacteria 5246
79 Ga0068854_100025406 3300005578 Bacteria 4064
80 Ga0068854_100153267 3300005578 Bacteria 1779
81 Ga0068856_100011448 3300005614 Bacteria 8608
82 Ga0068856_100022941 3300005614 Bacteria 6068
83 Ga0068856_100046468 3300005614 Bacteria 4276
84 Ga0070702_100237100 3300005615 Bacteria 1229
85 Ga0068852_100027482 3300005616 Bacteria 4638
86 Ga0068852_100032556 3300005616 Bacteria 4317
87 Ga0068852_100112050 3300005616 Bacteria 2482
88 Ga0068859_100038962 3300005617 Bacteria 4767
89 Ga0068864_100002677 3300005618 Bacteria 14698
90 Ga0068864_100003775 3300005618 Bacteria 12497
91 Ga0068864_100018919 3300005618 Bacteria 5759
92 Ga0068861_100000852 3300005719 Bacteria 18473
93 Ga0068863_100004802 3300005841 Bacteria 13310
94 Ga0068863_100126379 3300005841 Bacteria 2439
95 Ga0068863_100571601 3300005841 Unclassified 1117
96 Ga0068858_100003848 3300005842 Bacteria 14837
97 Ga0068858_100020636 3300005842 Bacteria 6156
98 Ga0068858_100870757 3300005842 Bacteria 880
99 Ga0068860_100019226 3300005843 Bacteria 6630
100 Ga0068862_100041684 3300005844 Bacteria 3907
101 Ga0068862_100054132 3300005844 Bacteria 3436
102 Ga0075365_10004684 3300006038 Bacteria 7291
103 Ga0075365_10028179 3300006038 Bacteria 3580
104 Ga0075363_100013433 3300006048 Bacteria 3970
105 Ga0075363_100022739 3300006048 Bacteria 3172
106 Ga0075363_100175262 3300006048 Bacteria 1219
107 Ga0075364_10190087 3300006051 Bacteria 1390
108 Ga0075432_10005605 3300006058 Bacteria 4275
109 Ga0075432_10102601 3300006058 Bacteria 1058
110 Ga0075362_10106456 3300006177 Bacteria 1316
111 Ga0075362_10129715 3300006177 Bacteria 1198
112 Ga0075367_10085619 3300006178 Bacteria 1912
113 Ga0075367_10194099 3300006178 Bacteria 1267
114 Ga0075369_10048857 3300006186 Bacteria 1826
115 Ga0075369_10085292 3300006186 Bacteria 1404
116 Ga0075366_10089240 3300006195 Bacteria 1846
117 Ga0075366_10215950 3300006195 Bacteria 1168
118 Ga0097621_100021800 3300006237 Bacteria 4964
119 Ga0097621_100260165 3300006237 Bacteria 1522
120 Ga0075370_10001974 3300006353 Bacteria 9286
121 Ga0075370_10002696 3300006353 Bacteria 8310
122 Ga0075370_10005973 3300006353 Bacteria 6094
123 Ga0075370_10024048 3300006353 Bacteria 3361
124 Ga0075370_10237447 3300006353 Bacteria 1079
125 Ga0068871_100251484 3300006358 Bacteria 1539
126 Ga0068871_100560294 3300006358 Bacteria 1036
127 Ga0097620_100038962 3300006931 Bacteria 4767
128 Ga0097620_100483853 3300006931 Bacteria 1333
129 Ga0099826_10000055 3300006948 Bacteria 70119
130 Ga0099826_10037924 3300006948 Bacteria 3391
131 Ga0105240_10070344 3300009093 Bacteria 4329
132 Ga0105245_10022042 3300009098 Bacteria 5590
133 Ga0105243_10168681 3300009148 Bacteria 1894
134 Ga0105243_10345833 3300009148 Bacteria 1364
135 Ga0105241_10405418 3300009174 Bacteria 1197
136 Ga0105242_10307250 3300009176 Bacteria 1450
137 Ga0105248_10041026 3300009177 Bacteria 5189
138 Ga0105248_10172650 3300009177 Unclassified 2437
139 Ga0105237_10010466 3300009545 Bacteria 9859
140 Ga0105237_10069178 3300009545 Bacteria 3525
141 Ga0105237_10655459 3300009545 Bacteria 1056
142 Ga0105238_10006779 3300009551 Bacteria 11443
143 Ga0105238_10042558 3300009551 Bacteria 4599
144 Ga0105238_11088489 3300009551 Bacteria 822
145 Ga0105239_10143715 3300010375 Bacteria 2659
146 Ga0105246_10186409 3300011119 Bacteria 1602
147 Ga0157370_10258433 3300013104 Bacteria 1610
148 Ga0157369_10006148 3300013105 Bacteria 13931
149 Ga0157374_10051165 3300013296 Bacteria 3843
150 Ga0157374_10129115 3300013296 Bacteria 2445
151 Ga0157378_10152838 3300013297 Bacteria 2151
152 Ga0163162_10019378 3300013306 Bacteria 6673
153 Ga0163162_10019663 3300013306 Bacteria 6629
154 Ga0163162_10032178 3300013306 Bacteria 5207
155 Ga0163162_10077543 3300013306 Bacteria 3387
156 Ga0157372_10019500 3300013307 Bacteria 7313
157 Ga0157372_10037066 3300013307 Bacteria 5375
158 Ga0157375_10003094 3300013308 Bacteria 14445
159 Ga0157375_10127747 3300013308 Bacteria 2659
160 Ga0163163_10019043 3300014325 Bacteria 6441
161 Ga0163163_10541360 3300014325 Bacteria 1226
162 Ga0157380_10081149 3300014326 Bacteria 2652
163 Ga0157380_10114083 3300014326 Bacteria 2276
164 Ga0182008_10009182 3300014497 Bacteria 5346
165 Ga0157377_10000433 3300014745 Bacteria 18071
166 Ga0157379_10007064 3300014968 Bacteria 9706
167 Ga0157379_10033274 3300014968 Bacteria 4598
168 Ga0157376_10009056 3300014969 Bacteria 7212
169 Ga0157376_10091350 3300014969 Bacteria 2637
170 Ga0157376_10309181 3300014969 Bacteria 1499
171 Ga0183362_10014 3300015683 Bacteria 40122
172 Ga0163161_10009688 3300017792 Bacteria 6668
173 Ga0163161_10017052 3300017792 Bacteria 5080
174 Ga0163161_10068197 3300017792 Bacteria 2599
175 Ga0213875_10112911 3300021388 Bacteria 1269
176 Ga0207425_1000005 3300025245 Bacteria 900502
177 Ga0209129_1001321 3300025258 Bacteria 14017
178 Ga0209565_1000120 3300025263 Bacteria 111458
179 Ga0209673_1000099 3300025273 Bacteria 193248
180 Ga0209673_1003387 3300025273 Bacteria 9476
181 Ga0209675_1000054 3300025291 Bacteria 193248
182 Ga0209025_1000477 3300025294 Bacteria 77692
183 Ga0209025_1001070 3300025294 Bacteria 39701
184 Ga0209025_1029213 3300025294 Bacteria 2676
185 Ga0209758_1000002 3300025297 Bacteria 1400310
186 Ga0209050_1000059 3300025298 Bacteria 325258
187 Ga0209256_1042352 3300025299 Bacteria 1151
188 Ga0209051_1000510 3300025303 Bacteria 49177
189 Ga0209257_1017533 3300025304 Bacteria 2813
190 Ga0207697_10033225 3300025315 Bacteria 2111
191 Ga0207682_10008457 3300025893 Bacteria 4070
192 Ga0207682_10036566 3300025893 Bacteria 1987
193 Ga0207682_10115385 3300025893 Bacteria 1186
194 Ga0207688_10182189 3300025901 Bacteria 1253
195 Ga0207688_10373344 3300025901 Bacteria 881
196 Ga0207688_10477473 3300025901 Bacteria 779
197 Ga0207680_10010356 3300025903 Bacteria 4662
198 Ga0207645_10041422 3300025907 Bacteria 2948
199 Ga0207645_10158729 3300025907 Bacteria 1479
200 Ga0207643_10158489 3300025908 Bacteria 1361
201 Ga0207654_10248978 3300025911 Bacteria 1190
202 Ga0207695_10286770 3300025913 Bacteria 1539
203 Ga0207671_10008206 3300025914 Bacteria 8898
204 Ga0207671_10043198 3300025914 Bacteria 3333
205 Ga0207657_10015459 3300025919 Bacteria 7393
206 Ga0207657_10082573 3300025919 Bacteria 2697
207 Ga0207649_10223713 3300025920 Bacteria 1342
208 Ga0207681_10036105 3300025923 Bacteria 3259
209 Ga0207681_10110686 3300025923 Bacteria 1997
210 Ga0207694_10143390 3300025924 Bacteria 1922
211 Ga0207650_10270322 3300025925 Bacteria 1381
212 Ga0207650_10274286 3300025925 Bacteria 1371
213 Ga0207650_10875522 3300025925 Bacteria 762
214 Ga0207659_10000963 3300025926 Bacteria 17179
215 Ga0207659_10017700 3300025926 Bacteria 4657
216 Ga0207659_10169188 3300025926 Bacteria 1723
217 Ga0207659_10242954 3300025926 Bacteria 1457
218 Ga0207659_10302194 3300025926 Bacteria 1315
219 Ga0207687_10013851 3300025927 Bacteria 5267
220 Ga0207644_10005009 3300025931 Bacteria 8649
221 Ga0207644_10060348 3300025931 Bacteria 2744
222 Ga0207644_10161344 3300025931 Bacteria 1743
223 Ga0207690_10097008 3300025932 Bacteria 2097
224 Ga0207690_10262678 3300025932 Bacteria 1338
225 Ga0207706_10011458 3300025933 Bacteria 8075
226 Ga0207706_10093979 3300025933 Bacteria 2637
227 Ga0207706_10886217 3300025933 Bacteria 754
228 Ga0207709_10214428 3300025935 Bacteria 1384
229 Ga0207709_10333057 3300025935 Bacteria 1140
230 Ga0207704_10830160 3300025938 Bacteria 773
231 Ga0207691_10027389 3300025940 Bacteria 5343
232 Ga0207691_10344495 3300025940 Bacteria 1275
233 Ga0207711_10009959 3300025941 Bacteria 7898
234 Ga0207711_10064280 3300025941 Bacteria 3169
235 Ga0207711_10338369 3300025941 Bacteria 1392
236 Ga0207689_10000259 3300025942 Bacteria 47474
237 Ga0207689_10023521 3300025942 Bacteria 5170
238 Ga0207661_10078898 3300025944 Bacteria 2712
239 Ga0207661_10110644 3300025944 Bacteria 2322
240 Ga0207679_10273263 3300025945 Bacteria 1446
241 Ga0207679_10281639 3300025945 Bacteria 1426
242 Ga0207667_10021138 3300025949 Bacteria 7217
243 Ga0207651_10000390 3300025960 Bacteria 18670
244 Ga0207651_10053009 3300025960 Bacteria 2770
245 Ga0207651_10575101 3300025960 Bacteria 982
246 Ga0207668_10112972 3300025972 Bacteria 2042
247 Ga0207668_10252806 3300025972 Bacteria 1432
248 Ga0207668_10548501 3300025972 Bacteria 1001
249 Ga0207640_10028100 3300025981 Bacteria 3434
250 Ga0207640_10158408 3300025981 Bacteria 1672
251 Ga0207640_10652248 3300025981 Bacteria 897
252 Ga0207658_10034328 3300025986 Bacteria 3625
253 Ga0207658_10066293 3300025986 Bacteria 2715
254 Ga0207677_10000880 3300026023 Bacteria 16941
255 Ga0207677_10230635 3300026023 Bacteria 1491
256 Ga0207703_10000382 3300026035 Bacteria 47374
257 Ga0207639_10011765 3300026041 Bacteria 6087
258 Ga0207639_10444854 3300026041 Bacteria 1175
259 Ga0207678_10032180 3300026067 Bacteria 4571
260 Ga0207678_10235155 3300026067 Bacteria 1569
261 Ga0207702_10072887 3300026078 Bacteria 2961
262 Ga0207702_10087342 3300026078 Bacteria 2722
263 Ga0207702_10137998 3300026078 Bacteria 2203
264 Ga0207641_10014478 3300026088 Bacteria 6462
265 Ga0207641_10644372 3300026088 Unclassified 1040
266 Ga0207648_10059849 3300026089 Bacteria 3322
267 Ga0207676_10000221 3300026095 Bacteria 49106
268 Ga0207674_10012008 3300026116 Bacteria 9705
269 Ga0207674_10503611 3300026116 Bacteria 1170
270 Ga0207675_100000307 3300026118 Bacteria 46857
271 Ga0207675_100033255 3300026118 Bacteria 4805
272 Ga0207675_100094521 3300026118 Bacteria 2812
273 Ga0207683_10011351 3300026121 Bacteria 7601
274 Ga0207683_10256227 3300026121 Bacteria 1597
275 Ga0207683_10848896 3300026121 Bacteria 848
276 Ga0207698_10001108 3300026142 Bacteria 15701
277 Ga0207698_10042783 3300026142 Bacteria 3388
278 Ga0207698_10260973 3300026142 Bacteria 1591
279 Ga0209282_1000363 3300027666 Bacteria 22201
280 Ga0207428_10059883 3300027907 Bacteria 3017
281 Ga0268266_10112374 3300028379 Bacteria 2415
282 Ga0268265_10131870 3300028380 Bacteria 2078
283 Ga0268265_11095483 3300028380 Bacteria 790
284 Ga0268264_10039807 3300028381 Bacteria 3883
285 Ga0268264_10126503 3300028381 Bacteria 2259
286 Ga0307517_10330007 3300028786 Bacteria 839
287 Ga0307515_10087738 3300028794 Bacteria 3943
288 Ga0316177_1034265 3300030731 Bacteria 5901
289 Ga0316177_1210526 3300030731 Bacteria 1970
290 Ga0316176_1042615 3300030732 Bacteria 5779
291 Ga0314311_1116647 3300030733 Bacteria 19723
292 Ga0316179_1058719 3300030734 Bacteria 1609
293 Ga0316183_1031412 3300030742 Bacteria 9920
294 Ga0316181_1174844 3300030744 Bacteria 12394
295 Ga0316181_1272887 3300030744 Bacteria 996
296 Ga0316182_1030208 3300030745 Bacteria 5997
297 Ga0316182_1275715 3300030745 Bacteria 3068
298 Ga0265327_10093607 3300031251 Bacteria 1461
299 Ga0307513_10001772 3300031456 Bacteria 30727
300 Ga0307408_100004950 3300031548 Bacteria 8958
301 Ga0307408_100045670 3300031548 Bacteria 3129
302 Ga0307408_100151040 3300031548 Bacteria 1833
303 Ga0307408_100561479 3300031548 Bacteria 1009
304 Ga0307405_10467161 3300031731 Bacteria 1004
305 Ga0307413_10065054 3300031824 Bacteria 2269
306 Ga0307406_10000879 3300031901 Bacteria 16916
307 Ga0307406_10021511 3300031901 Bacteria 3815
308 Ga0307407_10075480 3300031903 Bacteria 2021
309 Ga0307412_10000104 3300031911 Bacteria 67823
310 Ga0307412_10027258 3300031911 Bacteria 3560
311 Ga0307412_10046397 3300031911 Bacteria 2847
312 Ga0307412_10396076 3300031911 Bacteria 1123
313 Ga0307412_10415171 3300031911 Bacteria 1099
314 Ga0307412_10506953 3300031911 Bacteria 1006
315 Ga0307416_100264646 3300032002 Bacteria 1683
316 Ga0307414_10026973 3300032004 Bacteria 3704
317 Ga0307411_10070122 3300032005 Bacteria 2370
318 Ga0307411_10748887 3300032005 Bacteria 856
319 Ga0373949_0000112 3300035090 Bacteria 30333
320 Ga0373942_0100573 3300035207 Bacteria 883
321 Ga0373931_0002215 3300035691 Bacteria 8584
322 Ga0395900_0325257 3300037418 Bacteria 1517
323 Ga0395905_0001035 3300037471 Bacteria 35298
324 Ga0436364_0380348 3300037853 Bacteria 1590
325 Ga0439436_0006136 3300041404 Bacteria 3690
326 Ga0439466_0042905 3300041411 Bacteria 1504
327 Ga0451791_1325871 3300041451 Bacteria 1149
328 Ga0451806_148390 3300041462 Bacteria 3795
329 Ga0451807_0170914 3300041486 Bacteria 1173
330 Ga0451807_0896779 3300041486 Bacteria 1378
331 Ga0439442_001828 3300042002 Bacteria 4164
332 Ga0439445_0054225 3300042004 Bacteria 1087
333 Ga0439448_0107932 3300042005 Bacteria 949
334 Ga0439450_024444 3300042008 Bacteria 1318
335 Ga0450919_008972 3300042121 Bacteria 1153
336 Ga0450923_002236 3300042125 Bacteria 2741
337 Ga0450890_023159 3300042127 Bacteria 852
338 Ga0450898_032019 3300042134 Bacteria 969
339 Ga0450906_012224 3300042145 Bacteria 1594
340 Ga0450908_001061 3300042184 Bacteria 5337
341 Ga0439434_0001272 3300042435 Bacteria 7258
342 Ga0495606_0029003 3300046507 Bacteria 3893
343 Ga0495610_0018682 3300046512 Bacteria 3905
344 Ga0495587_0157410 3300046536 Bacteria 1294
345 Ga0495645_0463854 3300046543 Bacteria 797
346 Ga0495656_0002670 3300046615 Bacteria 5953
347 Ga0495625_0000903 3300046660 Bacteria 39973
348 Ga0495635_0457927 3300046663 Bacteria 843
349 Ga0495658_0151153 3300046683 Bacteria 1426
350 Ga0495670_0000010 3300046691 Bacteria 174071
351 Ga0495670_0066387 3300046691 Bacteria 1820
352 Ga0495670_0092440 3300046691 Bacteria 1550
353 Ga0495680_0413028 3300047322 Bacteria 930
354 Ga0495687_017303 3300047443 Bacteria 3600
355 Ga0495626_0002647 3300048091 Bacteria 12158
356 Ga0496100_0056238 3300048903 Bacteria 2573
357 Ga0496100_0424905 3300048903 Bacteria 1015
358 Ga0496101_0008945 3300048904 Bacteria 6563
359 Ga0496101_0011100 3300048904 Bacteria 5969
360 Ga0496101_0044735 3300048904 Bacteria 3169
361 Ga0496101_0138366 3300048904 Bacteria 1854
362 Ga0496102_0004841 3300048905 Bacteria 11387
363 Ga0496102_0089971 3300048905 Unclassified 2840
364 Ga0496103_0039751 3300048906 Bacteria 2891
365 Ga0496103_0105775 3300048906 Bacteria 1784
366 Ga0496103_0164579 3300048906 Bacteria 1423
367 Ga0496104_0007556 3300048907 Bacteria 9614
368 Ga0496104_0052173 3300048907 Bacteria 3862
369 Ga0496104_0101940 3300048907 Bacteria 2749
370 Ga0496104_0749011 3300048907 Bacteria 884
371 Ga0496105_0004125 3300048908 Bacteria 10892
372 Ga0496105_0004423 3300048908 Bacteria 10581
373 Ga0496105_0044446 3300048908 Bacteria 3664
374 Ga0496105_0146069 3300048908 Bacteria 1945
375 Ga0496105_0195390 3300048908 Bacteria 1653
376 Ga0496106_0023347 3300048909 Bacteria 4594
377 Ga0496106_0040153 3300048909 Bacteria 3504
378 Ga0496106_0041041 3300048909 Bacteria 3467
379 Ga0496106_0043867 3300048909 Bacteria 3357
380 Ga0496107_0032775 3300048910 Bacteria 3714
381 Ga0496107_0038284 3300048910 Bacteria 3442
382 Ga0496108_0101828 3300048911 Bacteria 2450
383 Ga0496108_0313302 3300048911 Bacteria 1367
384 Ga0496109_0119540 3300048912 Bacteria 2454
385 Ga0496110_0027727 3300048913 Bacteria 4857
386 Ga0496110_0078166 3300048913 Bacteria 2946
387 Ga0496110_0122131 3300048913 Bacteria 2347
388 Ga0496111_0038981 3300048914 Unclassified 3405
389 Ga0496111_0404122 3300048914 Unclassified 1009
390 Ga0496113_0211738 3300048916 Bacteria 1543
391 Ga0496113_0585852 3300048916 Unclassified 893
392 Ga0496114_0039443 3300048917 Bacteria 3908
393 Ga0496114_0386477 3300048917 Bacteria 1239
394 Ga0496114_0490318 3300048917 Bacteria 1087
395 Ga0496115_0005403 3300048918 Bacteria 9291
396 Ga0496118_0028167 3300048921 Bacteria 4739
397 Ga0496120_0036302 3300048923 Bacteria 2936
398 Ga0496120_0184880 3300048923 Bacteria 1020
399 Ga0496121_0001013 3300048924 Bacteria 50222
400 Ga0496121_0020256 3300048924 Bacteria 6596
401 Ga0496122_0017354 3300048925 Bacteria 6736
402 Ga0496123_0014794 3300048926 Bacteria 6441
403 Ga0496123_0051814 3300048926 Bacteria 2730
404 Ga0496123_0087117 3300048926 Bacteria 1869
405 Ga0496124_0005643 3300048927 Bacteria 13989
406 Ga0496124_0007335 3300048927 Bacteria 11745
407 Ga0496124_0013021 3300048927 Bacteria 8151
408 Ga0496124_0293885 3300048927 Bacteria 1177
409 Ga0496124_0329624 3300048927 Bacteria 1089
410 Ga0496124_0388662 3300048927 Bacteria 973
411 Ga0496125_0095640 3300048928 Bacteria 2209
412 Ga0496126_0067180 3300048929 Bacteria 3204
413 Ga0501042_0077194 3300049578 Bacteria 2385
414 Ga0501249_001551 3300049679 Bacteria 4711
415 Ga0501252_005764 3300049682 Bacteria 1357
416 Ga0501225_0008697 3300049705 Bacteria 2907
417 Ga0501262_000112 3300049759 Bacteria 9999
418 nmdc:mga03683_1941_c2 3300050489 Bacteria 3578
419 nmdc:mga03683_41557_c1 3300050489 Bacteria 1889
420 nmdc:mga03683_752_c1 3300050489 Bacteria 9302
421 nmdc:mga03n38_12515_c1 3300050490 Bacteria 3196
422 nmdc:mga03n38_1379_c1 3300050490 Bacteria 6409
423 nmdc:mga03n38_39852_c1 3300050490 Bacteria 2039
424 nmdc:mga00v17_167555_c1 3300050491 Bacteria 1415
425 nmdc:mga00v17_2845_c1 3300050491 Bacteria 8881
426 nmdc:mga0yw44_23816_c1 3300050492 Bacteria 3455
427 nmdc:mga0k408_2591_c2 3300050493 Bacteria 4494
428 nmdc:mga0k408_51480_c1 3300050493 Bacteria 2386
429 nmdc:mga0k408_6140_c1 3300050493 Bacteria 6407
430 nmdc:mga07m45_2915_c1 3300050496 Bacteria 8112
431 nmdc:mga07m45_498_c1 3300050496 Bacteria 16631
432 nmdc:mga07m45_8196_c1 3300050496 Bacteria 5361
433 nmdc:mga07m45_9987_c1 3300050496 Bacteria 4942
434 nmdc:mga0rr50_696592_c1 3300050513 Bacteria 867
435 nmdc:mga0sz30_230062_c1 3300050516 Bacteria 825
436 nmdc:mga0sz30_78544_c1 3300050516 Bacteria 1426
437 Ga0500610_0102254 3300053079 Bacteria 1481
438 Ga0500660_106355 3300053100 Bacteria 1209
439 Ga0500562_009365 3300053108 Bacteria 2477
440 Ga0500595_001321 3300053119 Bacteria 13433
441 Ga0500618_029059 3300053125 Bacteria 1306
442 Ga0500652_188430 3300053131 Bacteria 842
443 Ga0500573_0000010 3300053140 Bacteria 210704
444 Ga0500588_0013375 3300053146 Bacteria 2058
445 Ga0500596_011994 3300053735 Bacteria 1320
446 2600228381 2599185359 Bacteria 4772316
447 2644162663 2643221628 Bacteria 5745828
448 2738719866 2738541277 Bacteria 7458140
449 2739279065 2738543019 Bacteria 7459457
450 2819551603 2818991438 Bacteria 5793701
451 2819715178 2818991466 Bacteria 4748179
452 2842677857 2842677519 Bacteria 5615038
453 2842749901 2842747753 Bacteria 5578255
454 2879163938 2879163058 Bacteria 4223965
455 2904450132 2904449895 Bacteria 6927402
456 2904457045 2904456579 Bacteria 6819253
457 2919464855 2919462493 Bacteria 5817112
458 2928528083 2928526807 Bacteria 4760224
459 2928971412 2928968154 Bacteria 4633371
460 2929525417 2929520902 Bacteria 6765052
461 2945913172 2945909444 Bacteria 7065066
462 2945948793 2945945610 Bacteria 5951079
463 2945972912 2945972063 Bacteria 6086495
464 2945984554 2945984333 Bacteria 7358892
465 2954772930 2954767861 Bacteria 5535784
466 Ga0075362_10015087
467 JGI24737J22298_10005122
468 JGI24748J21848_1008525
469 JGI25151J46595_10002845
470 JGI25153J46596_10000073
471 Ga0006562J51391_1094908
472 Ga0055526_1003249
473 Ga0055537_1000163
474 Ga0055534_1000150
475 Ga0055528_1002757
476 Ga0055540_1002120
477 Ga0065714_10066000
478 Ga0070676_10009760
479 Ga0070676_10263427
480 Ga0070683_100101861
481 Ga0070690_100035961
482 Ga0070670_100013527
483 Ga0070670_100064981
484 Ga0070677_10004316
485 Ga0070677_10013450
486 Ga0070677_10117296
487 Ga0068869_100001761
488 Ga0068869_100011965
489 Ga0070666_10002852
490 Ga0068868_100001350
491 Ga0070660_100041404
492 Ga0070689_100063897
493 Ga0070661_100084149
494 Ga0070661_100526683
495 Ga0070692_10121018
496 Ga0070668_100071140
497 Ga0070669_100064786
498 Ga0070669_100340458
499 Ga0070669_100595105
500 Ga0070675_100002027
501 Ga0070675_100003621
502 Ga0070675_100091797
503 Ga0070675_100192438
504 Ga0070675_100451201
505 Ga0070671_100002683
506 Ga0070671_100103636
507 Ga0070671_100206647
508 Ga0070671_100243866
509 Ga0070671_100298815
510 Ga0070674_100035202
511 Ga0070673_100000957
512 Ga0070673_100899301
513 Ga0070673_100910153
514 Ga0070688_100018553
515 Ga0070659_100013023
516 Ga0070659_100044961
517 Ga0070667_100028276
518 Ga0070667_100052577
519 Ga0070678_100001838
520 Ga0070678_100016903
521 Ga0070678_100148247
522 Ga0070662_100011864
523 Ga0070662_100124425
524 Ga0070662_100575516
525 Ga0068867_100025408
526 Ga0070685_10075224
527 Ga0070684_100005675
528 Ga0068853_100007126
529 Ga0068853_100036888
530 Ga0070672_100057210
531 Ga0070672_100316914
532 Ga0070686_100259070
533 Ga0070693_100061787
534 Ga0070693_100067547
535 Ga0070693_100072761
536 Ga0070693_100149453
537 Ga0070665_100105581
538 Ga0070665_101169638
539 Ga0068855_100029336
540 Ga0068855_100256804
541 Ga0070664_100002594
542 Ga0068857_100013558
543 Ga0068857_100025125
544 Ga0068854_100025406
545 Ga0068854_100153267
546 Ga0068856_100011448
547 Ga0068856_100022941
548 Ga0068856_100046468
549 Ga0070702_100237100
550 Ga0068852_100027482
551 Ga0068852_100032556
552 Ga0068852_100112050
553 Ga0068859_100038962
554 Ga0068864_100002677
555 Ga0068864_100003775
556 Ga0068864_100018919
557 Ga0068861_100000852
558 Ga0068863_100004802
559 Ga0068863_100126379
560 Ga0068863_100571601
561 Ga0068858_100003848
562 Ga0068858_100020636
563 Ga0068858_100870757
564 Ga0068860_100019226
565 Ga0068862_100041684
566 Ga0068862_100054132
567 Ga0075365_10004684
568 Ga0075365_10028179
569 Ga0075363_100013433
570 Ga0075363_100022739
571 Ga0075363_100175262
572 Ga0075364_10190087
573 Ga0075432_10005605
574 Ga0075432_10102601
575 Ga0075362_10106456
576 Ga0075362_10129715
577 Ga0075367_10085619
578 Ga0075367_10194099
579 Ga0075369_10048857
580 Ga0075369_10085292
581 Ga0075366_10089240
582 Ga0075366_10215950
583 Ga0097621_100021800
584 Ga0097621_100260165
585 Ga0075370_10001974
586 Ga0075370_10002696
587 Ga0075370_10005973
588 Ga0075370_10024048
589 Ga0075370_10237447
590 Ga0068871_100251484
591 Ga0068871_100560294
592 Ga0097620_100038962
593 Ga0097620_100483853
594 Ga0099826_10000055
595 Ga0099826_10037924
596 Ga0105240_10070344
597 Ga0105245_10022042
598 Ga0105243_10168681
599 Ga0105243_10345833
600 Ga0105241_10405418
601 Ga0105242_10307250
602 Ga0105248_10041026
603 Ga0105248_10172650
604 Ga0105237_10010466
605 Ga0105237_10069178
606 Ga0105237_10655459
607 Ga0105238_10006779
608 Ga0105238_10042558
609 Ga0105238_11088489
610 Ga0105239_10143715
611 Ga0105246_10186409
612 Ga0157370_10258433
613 Ga0157369_10006148
614 Ga0157374_10051165
615 Ga0157374_10129115
616 Ga0157378_10152838
617 Ga0163162_10019378
618 Ga0163162_10019663
619 Ga0163162_10032178
620 Ga0163162_10077543
621 Ga0157372_10019500
622 Ga0157372_10037066
623 Ga0157375_10003094
624 Ga0157375_10127747
625 Ga0163163_10019043
626 Ga0163163_10541360
627 Ga0157380_10081149
628 Ga0157380_10114083
629 Ga0182008_10009182
630 Ga0157377_10000433
631 Ga0157379_10007064
632 Ga0157379_10033274
633 Ga0157376_10009056
634 Ga0157376_10091350
635 Ga0157376_10309181
636 Ga0183362_10014
637 Ga0163161_10009688
638 Ga0163161_10017052
639 Ga0163161_10068197
640 Ga0213875_10112911
641 Ga0207425_1000005
642 Ga0209129_1001321
643 Ga0209565_1000120
644 Ga0209673_1000099
645 Ga0209673_1003387
646 Ga0209675_1000054
647 Ga0209025_1000477
648 Ga0209025_1001070
649 Ga0209025_1029213
650 Ga0209758_1000002
651 Ga0209050_1000059
652 Ga0209256_1042352
653 Ga0209051_1000510
654 Ga0209257_1017533
655 Ga0207697_10033225
656 Ga0207682_10008457
657 Ga0207682_10036566
658 Ga0207682_10115385
659 Ga0207688_10182189
660 Ga0207688_10373344
661 Ga0207688_10477473
662 Ga0207680_10010356
663 Ga0207645_10041422
664 Ga0207645_10158729
665 Ga0207643_10158489
666 Ga0207654_10248978
667 Ga0207695_10286770
668 Ga0207671_10008206
669 Ga0207671_10043198
670 Ga0207657_10015459
671 Ga0207657_10082573
672 Ga0207649_10223713
673 Ga0207681_10036105
674 Ga0207681_10110686
675 Ga0207694_10143390
676 Ga0207650_10270322
677 Ga0207650_10274286
678 Ga0207650_10875522
679 Ga0207659_10000963
680 Ga0207659_10017700
681 Ga0207659_10169188
682 Ga0207659_10242954
683 Ga0207659_10302194
684 Ga0207687_10013851
685 Ga0207644_10005009
686 Ga0207644_10060348
687 Ga0207644_10161344
688 Ga0207690_10097008
689 Ga0207690_10262678
690 Ga0207706_10011458
691 Ga0207706_10093979
692 Ga0207706_10886217
693 Ga0207709_10214428
694 Ga0207709_10333057
695 Ga0207704_10830160
696 Ga0207691_10027389
697 Ga0207691_10344495
698 Ga0207711_10009959
699 Ga0207711_10064280
700 Ga0207711_10338369
701 Ga0207689_10000259
702 Ga0207689_10023521
703 Ga0207661_10078898
704 Ga0207661_10110644
705 Ga0207679_10273263
706 Ga0207679_10281639
707 Ga0207667_10021138
708 Ga0207651_10000390
709 Ga0207651_10053009
710 Ga0207651_10575101
711 Ga0207668_10112972
712 Ga0207668_10252806
713 Ga0207668_10548501
714 Ga0207640_10028100
715 Ga0207640_10158408
716 Ga0207640_10652248
717 Ga0207658_10034328
718 Ga0207658_10066293
719 Ga0207677_10000880
720 Ga0207677_10230635
721 Ga0207703_10000382
722 Ga0207639_10011765
723 Ga0207639_10444854
724 Ga0207678_10032180
725 Ga0207678_10235155
726 Ga0207702_10072887
727 Ga0207702_10087342
728 Ga0207702_10137998
729 Ga0207641_10014478
730 Ga0207641_10644372
731 Ga0207648_10059849
732 Ga0207676_10000221
733 Ga0207674_10012008
734 Ga0207674_10503611
735 Ga0207675_100000307
736 Ga0207675_100033255
737 Ga0207675_100094521
738 Ga0207683_10011351
739 Ga0207683_10256227
740 Ga0207683_10848896
741 Ga0207698_10001108
742 Ga0207698_10042783
743 Ga0207698_10260973
744 Ga0209282_1000363
745 Ga0207428_10059883
746 Ga0268266_10112374
747 Ga0268265_10131870
748 Ga0268265_11095483
749 Ga0268264_10039807
750 Ga0268264_10126503
751 Ga0307517_10330007
752 Ga0307515_10087738
753 Ga0316177_1034265
754 Ga0316177_1210526
755 Ga0316176_1042615
756 Ga0314311_1116647
757 Ga0316179_1058719
758 Ga0316183_1031412
759 Ga0316181_1174844
760 Ga0316181_1272887
761 Ga0316182_1030208
762 Ga0316182_1275715
763 Ga0265327_10093607
764 Ga0307513_10001772
765 Ga0307408_100004950
766 Ga0307408_100045670
767 Ga0307408_100151040
768 Ga0307408_100561479
769 Ga0307405_10467161
770 Ga0307413_10065054
771 Ga0307406_10000879
772 Ga0307406_10021511
773 Ga0307407_10075480
774 Ga0307412_10000104
775 Ga0307412_10027258
776 Ga0307412_10046397
777 Ga0307412_10396076
778 Ga0307412_10415171
779 Ga0307412_10506953
780 Ga0307416_100264646
781 Ga0307414_10026973
782 Ga0307411_10070122
783 Ga0307411_10748887
784 Ga0373949_0000112
785 Ga0373942_0100573
786 Ga0373931_0002215
787 Ga0395900_0325257
788 Ga0395905_0001035
789 Ga0436364_0380348
790 Ga0439436_0006136
791 Ga0439466_0042905
792 Ga0451791_1325871
793 Ga0451806_148390
794 Ga0451807_0170914
795 Ga0451807_0896779
796 Ga0439442_001828
797 Ga0439445_0054225
798 Ga0439448_0107932
799 Ga0439450_024444
800 Ga0450919_008972
801 Ga0450923_002236
802 Ga0450890_023159
803 Ga0450898_032019
804 Ga0450906_012224
805 Ga0450908_001061
806 Ga0439434_0001272
807 Ga0495606_0029003
808 Ga0495610_0018682
809 Ga0495587_0157410
810 Ga0495645_0463854
811 Ga0495656_0002670
812 Ga0495625_0000903
813 Ga0495635_0457927
814 Ga0495658_0151153
815 Ga0495670_0000010
816 Ga0495670_0066387
817 Ga0495670_0092440
818 Ga0495680_0413028
819 Ga0495687_017303
820 Ga0495626_0002647
821 Ga0496100_0056238
822 Ga0496100_0424905
823 Ga0496101_0008945
824 Ga0496101_0011100
825 Ga0496101_0044735
826 Ga0496101_0138366
827 Ga0496102_0004841
828 Ga0496102_0089971
829 Ga0496103_0039751
830 Ga0496103_0105775
831 Ga0496103_0164579
832 Ga0496104_0007556
833 Ga0496104_0052173
834 Ga0496104_0101940
835 Ga0496104_0749011
836 Ga0496105_0004125
837 Ga0496105_0004423
838 Ga0496105_0044446
839 Ga0496105_0146069
840 Ga0496105_0195390
841 Ga0496106_0023347
842 Ga0496106_0040153
843 Ga0496106_0041041
844 Ga0496106_0043867
845 Ga0496107_0032775
846 Ga0496107_0038284
847 Ga0496108_0101828
848 Ga0496108_0313302
849 Ga0496109_0119540
850 Ga0496110_0027727
851 Ga0496110_0078166
852 Ga0496110_0122131
853 Ga0496111_0038981
854 Ga0496111_0404122
855 Ga0496113_0211738
856 Ga0496113_0585852
857 Ga0496114_0039443
858 Ga0496114_0386477
859 Ga0496114_0490318
860 Ga0496115_0005403
861 Ga0496118_0028167
862 Ga0496120_0036302
863 Ga0496120_0184880
864 Ga0496121_0001013
865 Ga0496121_0020256
866 Ga0496122_0017354
867 Ga0496123_0014794
868 Ga0496123_0051814
869 Ga0496123_0087117
870 Ga0496124_0005643
871 Ga0496124_0007335
872 Ga0496124_0013021
873 Ga0496124_0293885
874 Ga0496124_0329624
875 Ga0496124_0388662
876 Ga0496125_0095640
877 Ga0496126_0067180
878 Ga0501042_0077194
879 Ga0501249_001551
880 Ga0501252_005764
881 Ga0501225_0008697
882 Ga0501262_000112
883 nmdc:mga03683_1941_c2
884 nmdc:mga03683_41557_c1
885 nmdc:mga03683_752_c1
886 nmdc:mga03n38_12515_c1
887 nmdc:mga03n38_1379_c1
888 nmdc:mga03n38_39852_c1
889 nmdc:mga00v17_167555_c1
890 nmdc:mga00v17_2845_c1
891 nmdc:mga0yw44_23816_c1
892 nmdc:mga0k408_2591_c2
893 nmdc:mga0k408_51480_c1
894 nmdc:mga0k408_6140_c1
895 nmdc:mga07m45_2915_c1
896 nmdc:mga07m45_498_c1
897 nmdc:mga07m45_8196_c1
898 nmdc:mga07m45_9987_c1
899 nmdc:mga0rr50_696592_c1
900 nmdc:mga0sz30_230062_c1
901 nmdc:mga0sz30_78544_c1
902 Ga0500610_0102254
903 Ga0500660_106355
904 Ga0500562_009365
905 Ga0500595_001321
906 Ga0500618_029059
907 Ga0500652_188430
908 Ga0500573_0000010
909 Ga0500588_0013375
910 Ga0500596_011994
911 2600228381
912 2644162663
913 2738719866
914 2739279065
915 2819551603
916 2819715178
917 2842677857
918 2842749901
919 2879163938
920 2904450132
921 2904457045
922 2919464855
923 2928528083
924 2928971412
925 2929525417
926 2945913172
927 2945948793
928 2945972912
929 2945984554
930 2954772930

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01161

PBP

Phosphatidylethanolamine-binding protein

71

211

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3n08-assembly1.cif.gz_B crystal structure of a putative phosphatidylethanolamine-binding protein (pebp) homolog ct736 from chlamydia trachomatis d/uw-3/cx 0.8394 34 191
1fux-assembly1.cif.gz_B crystal structure of e.coli ybcl, a new member of the mammalian pebp family 0.8364 36 190
3n08-assembly1.cif.gz_B crystal structure of a putative phosphatidylethanolamine-binding protein (pebp) homolog ct736 from chlamydia trachomatis d/uw-3/cx 0.8289 34 191
1fux-assembly1.cif.gz_B crystal structure of e.coli ybcl, a new member of the mammalian pebp family 0.789 36 190
1fjj-assembly1.cif.gz_A-2 crystal structure of e.coli ybhb protein, a new member of the mammalian pebp family 0.7879 36 190
ID Description Score Start End Superfamily
af_P77368_20_183_3.90.280.10 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8625 36 190 3.90.280.10
3n08A00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8503 35 191 3.90.280.10
3n08A00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8449 35 191 3.90.280.10
af_P77368_20_183_3.90.280.10 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8138 36 190 3.90.280.10
af_Q9M042_1_161_3.90.280.10 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8024 34 187 3.90.280.10
ID Description Score Start End GO Terms
AF-A0A0M0BW92-F1-model_v4 Phosphatidylethanolamine-binding protein 0.9116 34 191
AF-A0A6G0AB97-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9096 39 191
AF-A0A7W1QH96-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9091 37 191
AF-A0A2M7PMH3-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9079 39 194
AF-A0A501PEM7-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9061 35 191

Map