F449461

General Info

Members Datasets Scaffolds Average Seq Length
465 282 930 171

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100041619|Ga0075430_1000416192
Length 170
Sequence MTPDNDAHSEPPIFSATLTPYRSLGPAGFLILMSCLGGASFATGVVFILLGAWPVFGFLGLDVFLVYLAFRANYRAANAYEQVTVTASELTVRKVTPRGRLRQEWTANPLWVRLQQDIHEEFGVERLFLISRGERLAIAGFLGPEEKKSFAMALSQALFEAKRGATRTPA

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
144 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
149 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
153 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
154 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
155 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
169 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
170 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
183 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
184 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
185 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
186 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
187 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
193 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
194 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
205 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
206 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
207 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
210 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
211 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
223 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
224 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
225 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
252 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
254 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
257 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
258 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
269 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
270 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
273 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
274 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
275 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
276 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
277 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
280 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
281 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
282 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.25
Nodule 0.22
Rhizoplane 6.67
Rhizosphere 82.8
Stem 0
Stem Tuber 0
Unclassified 4.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100041619 3300006846 Bacteria 3886
2 JGI24750J21931_1008443 3300002070 Bacteria 1310
3 JGI25406J46586_10002179 3300003203 Bacteria 9240
4 Ga0070676_10529629 3300005328 Bacteria 841
5 Ga0070683_100045948 3300005329 Bacteria 4032
6 Ga0070670_100002617 3300005331 Bacteria 14878
7 Ga0070670_100591288 3300005331 Bacteria 992
8 Ga0070670_100935673 3300005331 Bacteria 787
9 Ga0070677_10293285 3300005333 Bacteria 824
10 Ga0070680_101103629 3300005336 Bacteria 686
11 Ga0068868_100281540 3300005338 Bacteria 1407
12 Ga0070691_10328303 3300005341 Bacteria 843
13 Ga0070687_100163320 3300005343 Bacteria 1318
14 Ga0070687_100337061 3300005343 Bacteria 969
15 Ga0070687_100510269 3300005343 Unclassified 811
16 Ga0070661_100131706 3300005344 Bacteria 1879
17 Ga0070692_10259749 3300005345 Bacteria 1043
18 Ga0070668_100288183 3300005347 Bacteria 1373
19 Ga0070668_100670178 3300005347 Bacteria 913
20 Ga0070669_100216956 3300005353 Bacteria 1511
21 Ga0070669_100258806 3300005353 Bacteria 1388
22 Ga0070669_101043435 3300005353 Bacteria 703
23 Ga0070675_100510079 3300005354 Bacteria 1084
24 Ga0070671_100063112 3300005355 Bacteria 3084
25 Ga0070674_100127702 3300005356 Bacteria 1891
26 Ga0070674_100133481 3300005356 Bacteria 1854
27 Ga0070674_100189043 3300005356 Bacteria 1583
28 Ga0070674_101128648 3300005356 Unclassified 693
29 Ga0070673_100096409 3300005364 Bacteria 2427
30 Ga0070673_100201457 3300005364 Bacteria 1714
31 Ga0070673_101213722 3300005364 Bacteria 707
32 Ga0070688_100100433 3300005365 Bacteria 1907
33 Ga0070688_100157758 3300005365 Bacteria 1557
34 Ga0070659_100230856 3300005366 Bacteria 1529
35 Ga0070667_100287939 3300005367 Bacteria 1476
36 Ga0070667_100564603 3300005367 Bacteria 1047
37 Ga0070713_100235219 3300005436 Bacteria 1667
38 Ga0070701_10397174 3300005438 Unclassified 873
39 Ga0070700_100588491 3300005441 Unclassified 870
40 Ga0070694_100716098 3300005444 Bacteria 815
41 Ga0070663_100113851 3300005455 Bacteria 2036
42 Ga0070663_100675275 3300005455 Unclassified 876
43 Ga0070663_101429250 3300005455 Bacteria 613
44 Ga0070678_100225568 3300005456 Bacteria 1559
45 Ga0070678_100940456 3300005456 Unclassified 792
46 Ga0068867_100024072 3300005459 Bacteria 4363
47 Ga0068867_100996102 3300005459 Bacteria 759
48 Ga0070685_10717790 3300005466 Bacteria 730
49 Ga0070679_100210011 3300005530 Bacteria 1911
50 Ga0070684_100265995 3300005535 Bacteria 1569
51 Ga0070684_100391290 3300005535 Bacteria 1281
52 Ga0070684_101581289 3300005535 Bacteria 618
53 Ga0068853_100210613 3300005539 Bacteria 1771
54 Ga0068853_100548631 3300005539 Bacteria 1095
55 Ga0068853_100569359 3300005539 Bacteria 1074
56 Ga0070672_100161315 3300005543 Bacteria 1860
57 Ga0070686_100023995 3300005544 Bacteria 3652
58 Ga0070665_100143401 3300005548 Bacteria 2392
59 Ga0070664_100356981 3300005564 Bacteria 1331
60 Ga0068857_100105723 3300005577 Bacteria 2527
61 Ga0068857_100159584 3300005577 Bacteria 2046
62 Ga0068854_100521197 3300005578 Bacteria 1004
63 Ga0068856_100921613 3300005614 Bacteria 892
64 Ga0070702_100218920 3300005615 Bacteria 1272
65 Ga0068859_100091341 3300005617 Bacteria 3095
66 Ga0068859_101983250 3300005617 Bacteria 643
67 Ga0068864_100052378 3300005618 Bacteria 3517
68 Ga0068864_100123371 3300005618 Bacteria 2319
69 Ga0068866_10142794 3300005718 Bacteria 1376
70 Ga0068866_10550162 3300005718 Bacteria 772
71 Ga0068861_100134087 3300005719 Bacteria 2013
72 Ga0068851_10178277 3300005834 Bacteria 1176
73 Ga0068863_100073738 3300005841 Bacteria 3229
74 Ga0068863_100148509 3300005841 Bacteria 2242
75 Ga0068858_100130678 3300005842 Bacteria 2354
76 Ga0068860_100030280 3300005843 Bacteria 5205
77 Ga0068862_100579700 3300005844 Bacteria 1074
78 Ga0081455_10010586 3300005937 Bacteria 9337
79 Ga0081540_1056640 3300005983 Bacteria 1901
80 Ga0081539_10002854 3300005985 Bacteria 22994
81 Ga0070717_10275604 3300006028 Bacteria 1491
82 Ga0070717_10415453 3300006028 Bacteria 1210
83 Ga0070717_10658446 3300006028 Bacteria 951
84 Ga0075365_10007065 3300006038 Bacteria 6254
85 Ga0075365_10024758 3300006038 Bacteria 3792
86 Ga0075365_10627299 3300006038 Unclassified 760
87 Ga0075368_10048382 3300006042 Bacteria 1685
88 Ga0075363_100000153 3300006048 Bacteria 17191
89 Ga0075363_100571588 3300006048 Bacteria 676
90 Ga0075364_10136677 3300006051 Bacteria 1647
91 Ga0075364_10406851 3300006051 Bacteria 929
92 Ga0070715_10082694 3300006163 Bacteria 1461
93 Ga0070712_100085678 3300006175 Bacteria 2294
94 Ga0070712_100285877 3300006175 Bacteria 1330
95 Ga0075362_10002859 3300006177 Bacteria 5899
96 Ga0075362_10126908 3300006177 Bacteria 1211
97 Ga0075367_10019110 3300006178 Bacteria 3794
98 Ga0075367_10090474 3300006178 Bacteria 1861
99 Ga0075367_10102364 3300006178 Bacteria 1752
100 Ga0075366_10001594 3300006195 Bacteria 11350
101 Ga0075366_10016630 3300006195 Bacteria 4229
102 Ga0075370_10158298 3300006353 Bacteria 1328
103 Ga0068871_100090332 3300006358 Bacteria 2551
104 Ga0075428_100014729 3300006844 Bacteria 8685
105 Ga0075428_100266570 3300006844 Bacteria 1843
106 Ga0075428_100752754 3300006844 Bacteria 1037
107 Ga0075430_100032726 3300006846 Bacteria 4413
108 Ga0075431_100009653 3300006847 Bacteria 9694
109 Ga0075431_100254687 3300006847 Bacteria 1783
110 Ga0075431_100898291 3300006847 Unclassified 856
111 Ga0075433_10158200 3300006852 Bacteria 2016
112 Ga0075433_10957754 3300006852 Unclassified 746
113 Ga0075434_100170139 3300006871 Bacteria 2199
114 Ga0075434_100249652 3300006871 Bacteria 1794
115 Ga0075429_101409546 3300006880 Bacteria 607
116 Ga0068865_100058413 3300006881 Bacteria 2694
117 Ga0068865_101226520 3300006881 Bacteria 665
118 Ga0097620_100091339 3300006931 Bacteria 3095
119 Ga0097620_101183064 3300006931 Bacteria 842
120 Ga0097620_101982972 3300006931 Bacteria 643
121 Ga0075435_100313299 3300007076 Bacteria 1343
122 Ga0111539_11587780 3300009094 Bacteria 759
123 Ga0105245_10742066 3300009098 Bacteria 1017
124 Ga0114129_10000935 3300009147 Bacteria 38153
125 Ga0114129_10898505 3300009147 Bacteria 1122
126 Ga0114129_11083032 3300009147 Bacteria 1004
127 Ga0105243_10657029 3300009148 Bacteria 1017
128 Ga0105241_10912920 3300009174 Bacteria 816
129 Ga0105241_11049421 3300009174 Bacteria 765
130 Ga0105242_10089930 3300009176 Bacteria 2582
131 Ga0105248_10212146 3300009177 Bacteria 2182
132 Ga0105237_10303596 3300009545 Bacteria 1599
133 Ga0105238_10016481 3300009551 Bacteria 7480
134 Ga0105249_10193767 3300009553 Bacteria 1985
135 Ga0105249_10441608 3300009553 Bacteria 1338
136 Ga0105249_10725137 3300009553 Bacteria 1055
137 Ga0105249_10847907 3300009553 Bacteria 979
138 Ga0105239_10310253 3300010375 Bacteria 1778
139 Ga0105239_10777970 3300010375 Bacteria 1096
140 Ga0105246_10152800 3300011119 Bacteria 1749
141 Ga0105246_10681089 3300011119 Bacteria 899
142 Ga0157374_10023414 3300013296 Bacteria 5525
143 Ga0157378_10194687 3300013297 Bacteria 1914
144 Ga0157378_10511570 3300013297 Bacteria 1201
145 Ga0163162_10282438 3300013306 Bacteria 1792
146 Ga0163162_10638307 3300013306 Bacteria 1189
147 Ga0163162_11898368 3300013306 Bacteria 682
148 Ga0157375_11423195 3300013308 Bacteria 817
149 Ga0157375_11812133 3300013308 Bacteria 724
150 Ga0163163_10087666 3300014325 Bacteria 3123
151 Ga0157380_11861788 3300014326 Unclassified 662
152 Ga0182008_10098761 3300014497 Bacteria 1442
153 Ga0157377_10009522 3300014745 Bacteria 4770
154 Ga0157379_10306800 3300014968 Bacteria 1447
155 Ga0157379_11162824 3300014968 Bacteria 741
156 Ga0163161_10617050 3300017792 Bacteria 896
157 Ga0213876_10019172 3300021384 Bacteria 3612
158 Ga0209758_1005755 3300025297 Bacteria 9322
159 Ga0207697_10108296 3300025315 Bacteria 1189
160 Ga0207697_10189635 3300025315 Bacteria 902
161 Ga0207656_10054914 3300025321 Bacteria 1732
162 Ga0207682_10000865 3300025893 Bacteria 14063
163 Ga0207688_10011328 3300025901 Bacteria 4855
164 Ga0207688_10017372 3300025901 Bacteria 3908
165 Ga0207688_10125703 3300025901 Bacteria 1499
166 Ga0207680_10226227 3300025903 Bacteria 1284
167 Ga0207680_10721791 3300025903 Bacteria 714
168 Ga0207647_10023186 3300025904 Bacteria 4109
169 Ga0207699_10854873 3300025906 Bacteria 670
170 Ga0207645_10005075 3300025907 Bacteria 9643
171 Ga0207645_10028160 3300025907 Bacteria 3628
172 Ga0207654_10121649 3300025911 Bacteria 1640
173 Ga0207671_10392682 3300025914 Bacteria 1103
174 Ga0207663_10508730 3300025916 Bacteria 936
175 Ga0207660_10659925 3300025917 Bacteria 853
176 Ga0207662_10044508 3300025918 Bacteria 2621
177 Ga0207662_10066781 3300025918 Bacteria 2167
178 Ga0207657_10019678 3300025919 Bacteria 6401
179 Ga0207681_10131837 3300025923 Bacteria 1849
180 Ga0207681_10836015 3300025923 Bacteria 770
181 Ga0207650_10065638 3300025925 Bacteria 2720
182 Ga0207650_10177796 3300025925 Bacteria 1695
183 Ga0207650_10458813 3300025925 Bacteria 1061
184 Ga0207659_10023938 3300025926 Bacteria 4084
185 Ga0207659_10199677 3300025926 Bacteria 1596
186 Ga0207659_10351388 3300025926 Bacteria 1223
187 Ga0207687_11127729 3300025927 Bacteria 674
188 Ga0207700_10288374 3300025928 Bacteria 1414
189 Ga0207700_10409953 3300025928 Bacteria 1189
190 Ga0207664_10403574 3300025929 Bacteria 1216
191 Ga0207644_10140311 3300025931 Bacteria 1860
192 Ga0207706_10001078 3300025933 Bacteria 27712
193 Ga0207686_10386066 3300025934 Bacteria 1063
194 Ga0207686_10606932 3300025934 Bacteria 862
195 Ga0207709_10162688 3300025935 Bacteria 1558
196 Ga0207709_10260364 3300025935 Bacteria 1272
197 Ga0207709_11245836 3300025935 Bacteria 614
198 Ga0207669_10336047 3300025937 Bacteria 1161
199 Ga0207691_10003016 3300025940 Bacteria 16433
200 Ga0207691_10013813 3300025940 Bacteria 7712
201 Ga0207689_10001278 3300025942 Bacteria 24267
202 Ga0207689_10081623 3300025942 Bacteria 2658
203 Ga0207679_10083007 3300025945 Bacteria 2454
204 Ga0207679_10686252 3300025945 Bacteria 928
205 Ga0207651_10038298 3300025960 Bacteria 3150
206 Ga0207712_10505044 3300025961 Bacteria 1034
207 Ga0207712_10563697 3300025961 Bacteria 981
208 Ga0207668_10279911 3300025972 Bacteria 1367
209 Ga0207658_10905000 3300025986 Bacteria 803
210 Ga0207677_10251167 3300026023 Bacteria 1436
211 Ga0207703_10199633 3300026035 Bacteria 1777
212 Ga0207639_10287874 3300026041 Bacteria 1447
213 Ga0207639_10607222 3300026041 Bacteria 1009
214 Ga0207678_10090155 3300026067 Bacteria 2621
215 Ga0207678_10584891 3300026067 Bacteria 978
216 Ga0207708_10003818 3300026075 Bacteria 11110
217 Ga0207708_10072513 3300026075 Bacteria 2638
218 Ga0207641_10097101 3300026088 Bacteria 2589
219 Ga0207641_12106193 3300026088 Bacteria 565
220 Ga0207648_10016856 3300026089 Bacteria 6662
221 Ga0207676_10068234 3300026095 Bacteria 2843
222 Ga0207676_10877034 3300026095 Unclassified 879
223 Ga0207674_10089531 3300026116 Bacteria 3070
224 Ga0207674_10123076 3300026116 Bacteria 2560
225 Ga0207674_10540719 3300026116 Bacteria 1125
226 Ga0207675_100001067 3300026118 Bacteria 27209
227 Ga0207675_100236436 3300026118 Bacteria 1764
228 Ga0207698_10347240 3300026142 Bacteria 1400
229 Ga0207428_10612402 3300027907 Unclassified 784
230 Ga0268265_10081093 3300028380 Bacteria 2561
231 Ga0265318_10082630 3300028577 Bacteria 1185
232 Ga0265330_10200624 3300031235 Bacteria 843
233 Ga0265320_10046903 3300031240 Bacteria 2115
234 Ga0265340_10070313 3300031247 Bacteria 1660
235 Ga0265313_10160852 3300031595 Bacteria 954
236 Ga0373929_0052809 3300035085 Bacteria 933
237 Ga0373944_0040445 3300035089 Bacteria 1439
238 Ga0373923_0112910 3300035111 Bacteria 1208
239 Ga0373936_0077190 3300035113 Bacteria 1381
240 Ga0373945_0006138 3300035116 Bacteria 3865
241 Ga0373945_0056954 3300035116 Bacteria 1451
242 Ga0373953_0001606 3300035117 Bacteria 6611
243 Ga0373954_0315861 3300035118 Bacteria 771
244 Ga0373956_0007284 3300035119 Bacteria 4455
245 Ga0373956_0344007 3300035119 Bacteria 711
246 Ga0373943_0000917 3300035170 Bacteria 12977
247 Ga0373943_0003490 3300035170 Bacteria 7160
248 Ga0373943_0105128 3300035170 Bacteria 1482
249 Ga0373946_0004458 3300035171 Bacteria 5016
250 Ga0373955_0000346 3300035172 Bacteria 19457
251 Ga0373924_0001455 3300035410 Bacteria 7697
252 Ga0373931_0223199 3300035691 Bacteria 1135
253 Ga0373935_0000056 3300035692 Bacteria 46025
254 Ga0373935_0148567 3300035692 Bacteria 1588
255 Ga0373927_0027558 3300035695 Bacteria 3708
256 Ga0373927_0033737 3300035695 Bacteria 3331
257 Ga0373933_0004205 3300035724 Bacteria 7938
258 Ga0373947_0004488 3300035725 Bacteria 8191
259 Ga0373947_0008290 3300035725 Bacteria 5988
260 Ga0373947_0347932 3300035725 Bacteria 994
261 Ga0373947_0436337 3300035725 Bacteria 886
262 Ga0373947_0748600 3300035725 Bacteria 667
263 Ga0373937_0000075 3300036401 Bacteria 89727
264 Ga0373937_0674234 3300036401 Bacteria 980
265 Ga0373925_0000159 3300037068 Bacteria 72851
266 Ga0373925_0002643 3300037068 Bacteria 14219
267 Ga0373925_0302671 3300037068 Bacteria 1291
268 Ga0373925_0546855 3300037068 Unclassified 952
269 Ga0436365_0052204 3300039437 Bacteria 2456
270 Ga0436365_0414545 3300039437 Bacteria 1748
271 Ga0439453_0046444 3300041408 Bacteria 866
272 Ga0451851_1127276 3300041507 Bacteria 849
273 Ga0439444_0020118 3300042437 Bacteria 1172
274 Ga0466963_0024430 3300044694 Bacteria 3848
275 Ga0466959_0081994 3300045049 Bacteria 2324
276 Ga0466958_0006496 3300045836 Bacteria 6369
277 Ga0495627_055793 3300046453 Bacteria 1179
278 Ga0495592_0000102 3300046454 Bacteria 75767
279 Ga0495603_0392899 3300046455 Unclassified 795
280 Ga0495629_0061569 3300046459 Bacteria 2623
281 Ga0495629_0131497 3300046459 Bacteria 1743
282 Ga0495629_0486459 3300046459 Bacteria 833
283 Ga0495638_0155128 3300046460 Bacteria 1325
284 Ga0495651_0001236 3300046462 Bacteria 19760
285 Ga0495653_0000036 3300046463 Bacteria 129776
286 Ga0495580_0345850 3300046472 Bacteria 1008
287 Ga0495605_0056156 3300046474 Bacteria 1900
288 Ga0495639_0089359 3300046475 Bacteria 1443
289 Ga0495662_0006322 3300046476 Bacteria 5923
290 Ga0495662_0054295 3300046476 Bacteria 1935
291 Ga0495664_0000107 3300046477 Bacteria 41420
292 Ga0495664_0286754 3300046477 Bacteria 994
293 Ga0495594_0208257 3300046499 Bacteria 1115
294 Ga0495596_0049762 3300046500 Bacteria 1643
295 Ga0495608_0000006 3300046511 Bacteria 324334
296 Ga0495618_0000057 3300046514 Bacteria 80298
297 Ga0495618_0707883 3300046514 Bacteria 592
298 Ga0495628_0000077 3300046516 Bacteria 77338
299 Ga0495630_0001707 3300046517 Bacteria 15337
300 Ga0495630_0003757 3300046517 Bacteria 10599
301 Ga0495632_0194028 3300046519 Bacteria 927
302 Ga0495643_0073346 3300046522 Bacteria 1794
303 Ga0495643_0099355 3300046522 Bacteria 1493
304 Ga0495666_0045481 3300046526 Bacteria 2118
305 Ga0495652_0000005 3300046529 Bacteria 524368
306 Ga0495652_0533589 3300046529 Bacteria 809
307 Ga0495665_0073960 3300046531 Bacteria 1794
308 Ga0495665_0473652 3300046531 Bacteria 632
309 Ga0495640_0000007 3300046533 Bacteria 265481
310 Ga0495640_0029106 3300046533 Bacteria 3970
311 Ga0495587_0000043 3300046536 Bacteria 109717
312 Ga0495621_0318425 3300046539 Bacteria 648
313 Ga0495645_0000275 3300046543 Bacteria 37777
314 Ga0495667_0000023 3300046559 Bacteria 169343
315 Ga0495634_0000049 3300046642 Bacteria 95428
316 Ga0495634_0062108 3300046642 Bacteria 2482
317 Ga0495634_0161651 3300046642 Bacteria 1412
318 Ga0495635_0000021 3300046663 Bacteria 164643
319 Ga0495635_0035489 3300046663 Bacteria 3457
320 Ga0495657_0000063 3300046675 Bacteria 94380
321 Ga0495657_0329145 3300046675 Bacteria 907
322 Ga0495599_0000001 3300046678 Bacteria 537563
323 Ga0495623_0000056 3300046679 Bacteria 69307
324 Ga0495646_0000007 3300046680 Bacteria 236764
325 Ga0495658_0010076 3300046683 Bacteria 4721
326 Ga0495658_0216228 3300046683 Bacteria 1199
327 Ga0495613_0015829 3300046689 Bacteria 5614
328 Ga0495613_0056629 3300046689 Bacteria 2879
329 Ga0495613_0463475 3300046689 Bacteria 857
330 Ga0495613_0645913 3300046689 Unclassified 700
331 Ga0495624_0021201 3300046690 Bacteria 4312
332 Ga0495624_0061315 3300046690 Bacteria 2357
333 Ga0495671_0046751 3300046692 Bacteria 2164
334 Ga0495600_0000047 3300046809 Bacteria 71546
335 Ga0495600_0318246 3300046809 Bacteria 979
336 Ga0495581_0002513 3300047315 Bacteria 10407
337 Ga0495581_0035607 3300047315 Bacteria 2880
338 Ga0495581_0612621 3300047315 Bacteria 630
339 Ga0495604_0000014 3300047317 Bacteria 205481
340 Ga0495604_0193622 3300047317 Bacteria 1415
341 Ga0495604_0329363 3300047317 Bacteria 1019
342 Ga0495636_0088822 3300047318 Bacteria 1340
343 Ga0495674_0000014 3300047319 Bacteria 241211
344 Ga0495674_0140005 3300047319 Bacteria 2034
345 Ga0495674_0204585 3300047319 Bacteria 1637
346 Ga0495676_0539264 3300047321 Bacteria 763
347 Ga0495680_0000744 3300047322 Bacteria 36481
348 Ga0495680_0237445 3300047322 Bacteria 1296
349 Ga0495675_0000940 3300047444 Bacteria 17639
350 Ga0495684_0000272 3300047471 Bacteria 41522
351 Ga0495684_0001055 3300047471 Bacteria 22302
352 Ga0495686_0270216 3300047472 Bacteria 949
353 Ga0495593_0043801 3300047673 Unclassified 2396
354 Ga0495593_0319204 3300047673 Bacteria 777
355 Ga0495602_0000017 3300048088 Bacteria 184180
356 Ga0495602_0178298 3300048088 Bacteria 1642
357 Ga0495614_0170683 3300048089 Bacteria 976
358 Ga0495615_0002577 3300048090 Bacteria 2925
359 Ga0495615_0008549 3300048090 Bacteria 1984
360 Ga0495615_0029253 3300048090 Bacteria 1306
361 Ga0496100_0200500 3300048903 Bacteria 1454
362 Ga0496101_0060293 3300048904 Bacteria 2752
363 Ga0496101_0262477 3300048904 Bacteria 1347
364 Ga0496102_1253409 3300048905 Bacteria 661
365 Ga0496103_0106222 3300048906 Bacteria 1780
366 Ga0496104_0199383 3300048907 Bacteria 1913
367 Ga0496105_0000898 3300048908 Bacteria 20355
368 Ga0496105_0010209 3300048908 Bacteria 7380
369 Ga0496105_0100277 3300048908 Bacteria 2391
370 Ga0496105_0919247 3300048908 Bacteria 658
371 Ga0496106_0085508 3300048909 Bacteria 2428
372 Ga0496106_0115952 3300048909 Bacteria 2089
373 Ga0496106_0138730 3300048909 Bacteria 1911
374 Ga0496107_0005780 3300048910 Bacteria 8461
375 Ga0496108_0006090 3300048911 Bacteria 9756
376 Ga0496108_0261019 3300048911 Bacteria 1507
377 Ga0496108_0329168 3300048911 Bacteria 1332
378 Ga0496109_0016212 3300048912 Bacteria 6512
379 Ga0496109_0054393 3300048912 Bacteria 3651
380 Ga0496110_0058090 3300048913 Bacteria 3406
381 Ga0496110_0220601 3300048913 Bacteria 1724
382 Ga0496110_0372877 3300048913 Bacteria 1300
383 Ga0496110_0441144 3300048913 Bacteria 1186
384 Ga0496111_0004774 3300048914 Bacteria 8595
385 Ga0496111_0007298 3300048914 Bacteria 7233
386 Ga0496112_0017433 3300048915 Bacteria 6746
387 Ga0496113_0001484 3300048916 Bacteria 13113
388 Ga0496113_0082641 3300048916 Bacteria 2463
389 Ga0496113_0256415 3300048916 Bacteria 1397
390 Ga0496114_0838195 3300048917 Bacteria 799
391 Ga0496115_0137567 3300048918 Bacteria 2014
392 Ga0501039_0013220 3300049575 Bacteria 6310
393 Ga0501039_0120054 3300049575 Bacteria 2060
394 Ga0501046_0203366 3300049580 Bacteria 1473
395 Ga0501071_0022112 3300049587 Bacteria 4432
396 Ga0501071_0388397 3300049587 Bacteria 1065
397 Ga0501071_1256012 3300049587 Bacteria 572
398 Ga0501072_0112426 3300049588 Bacteria 2168
399 Ga0501074_1075938 3300049590 Unclassified 565
400 Ga0501075_0049475 3300049591 Bacteria 3159
401 Ga0501076_0426019 3300049592 Unclassified 1092
402 Ga0501076_1200266 3300049592 Bacteria 624
403 Ga0501079_0143782 3300049741 Bacteria 1858
404 Ga0501079_1068075 3300049741 Bacteria 636
405 Ga0501083_0355465 3300049744 Bacteria 952
406 nmdc:mga03683_14719_c1 3300050489 Bacteria 2901
407 nmdc:mga03n38_383323_c1 3300050490 Bacteria 771
408 nmdc:mga03n38_488106_c1 3300050490 Bacteria 690
409 nmdc:mga03n38_9771_c1 3300050490 Bacteria 3501
410 nmdc:mga00v17_309207_c1 3300050491 Bacteria 1027
411 nmdc:mga00v17_960191_c1 3300050491 Bacteria 539
412 nmdc:mga0yw44_1198_c1 3300050492 Bacteria 10140
413 nmdc:mga0yw44_191909_c1 3300050492 Bacteria 1348
414 nmdc:mga0yw44_59064_c1 3300050492 Bacteria 2345
415 nmdc:mga0k408_40381_c1 3300050493 Bacteria 2685
416 nmdc:mga0k408_553113_c1 3300050493 Unclassified 680
417 nmdc:mga0k408_69121_c1 3300050493 Bacteria 2061
418 nmdc:mga06z11_31778_c1 3300050494 Bacteria 2569
419 nmdc:mga06z11_94124_c1 3300050494 Bacteria 1632
420 nmdc:mga04h51_225725_c1 3300050495 Bacteria 744
421 nmdc:mga04h51_6005_c1 3300050495 Bacteria 3125
422 nmdc:mga07m45_124782_c1 3300050496 Bacteria 913
423 nmdc:mga05p37_36408_c1 3300050507 Bacteria 6037
424 nmdc:mga09592_1173221_c1 3300050508 Bacteria 636
425 nmdc:mga06r32_238096_c1 3300050510 Bacteria 1808
426 nmdc:mga06r32_252350_c1 3300050510 Bacteria 1752
427 nmdc:mga06r32_734242_c1 3300050510 Bacteria 951
428 nmdc:mga08y16_1030808_c1 3300050511 Bacteria 801
429 nmdc:mga08y16_71897_c1 3300050511 Bacteria 3604
430 nmdc:mga0n895_15233_c1 3300050512 Bacteria 7006
431 nmdc:mga0n895_210824_c1 3300050512 Bacteria 1973
432 nmdc:mga0n895_240139_c1 3300050512 Bacteria 1838
433 nmdc:mga0rr50_561208_c1 3300050513 Bacteria 972
434 nmdc:mga0rr50_70687_c1 3300050513 Bacteria 2013
435 nmdc:mga0a205_1196436_c1 3300050515 Unclassified 608
436 nmdc:mga0a205_148991_c1 3300050515 Bacteria 2240
437 nmdc:mga0sz30_220008_c1 3300050516 Bacteria 844
438 nmdc:mga0sz30_439605_c1 3300050516 Bacteria 585
439 Ga0495601_0000016 3300053077 Bacteria 207486
440 Ga0495601_0020265 3300053077 Bacteria 4061
441 Ga0495612_0000035 3300053078 Bacteria 69194
442 Ga0500610_0032413 3300053079 Bacteria 2660
443 Ga0495595_0000032 3300053084 Bacteria 87066
444 Ga0495595_0162079 3300053084 Bacteria 1104
445 Ga0495619_0000033 3300053085 Bacteria 138925
446 Ga0495619_0086873 3300053085 Bacteria 2114
447 Ga0495619_0201649 3300053085 Bacteria 1377
448 Ga0500652_000253 3300053131 Bacteria 20084
449 Ga0500577_0204706 3300053142 Bacteria 852
450 Ga0500604_0033541 3300053151 Bacteria 1519
451 Ga0500627_0106502 3300053158 Bacteria 1261
452 Ga0500611_151757 3300053727 Bacteria 636
453 Ga0500645_034150 3300053730 Bacteria 1519
454 Ga0501084_0058203 3300054114 Bacteria 3234
455 Ga0501084_0249048 3300054114 Bacteria 1500
456 Ga0501084_0416666 3300054114 Bacteria 1135
457 Ga0501082_0000099 3300060353 Bacteria 66846
458 Ga0501082_0140298 3300060353 Bacteria 2098
459 Ga0501082_0243441 3300060353 Bacteria 1565
460 Ga0501082_0250428 3300060353 Bacteria 1542
461 Ga0501082_0417864 3300060353 Bacteria 1171
462 Ga0530510_0067928 3300061734 Bacteria 2586
463 Ga0530510_0220359 3300061734 Bacteria 1410
464 2876817643 2876808645 Bacteria 8824342
465 2879113107 2879110137 Bacteria 8907982
466 Ga0075430_100041619
467 JGI24750J21931_1008443
468 JGI25406J46586_10002179
469 Ga0070676_10529629
470 Ga0070683_100045948
471 Ga0070670_100002617
472 Ga0070670_100591288
473 Ga0070670_100935673
474 Ga0070677_10293285
475 Ga0070680_101103629
476 Ga0068868_100281540
477 Ga0070691_10328303
478 Ga0070687_100163320
479 Ga0070687_100337061
480 Ga0070687_100510269
481 Ga0070661_100131706
482 Ga0070692_10259749
483 Ga0070668_100288183
484 Ga0070668_100670178
485 Ga0070669_100216956
486 Ga0070669_100258806
487 Ga0070669_101043435
488 Ga0070675_100510079
489 Ga0070671_100063112
490 Ga0070674_100127702
491 Ga0070674_100133481
492 Ga0070674_100189043
493 Ga0070674_101128648
494 Ga0070673_100096409
495 Ga0070673_100201457
496 Ga0070673_101213722
497 Ga0070688_100100433
498 Ga0070688_100157758
499 Ga0070659_100230856
500 Ga0070667_100287939
501 Ga0070667_100564603
502 Ga0070713_100235219
503 Ga0070701_10397174
504 Ga0070700_100588491
505 Ga0070694_100716098
506 Ga0070663_100113851
507 Ga0070663_100675275
508 Ga0070663_101429250
509 Ga0070678_100225568
510 Ga0070678_100940456
511 Ga0068867_100024072
512 Ga0068867_100996102
513 Ga0070685_10717790
514 Ga0070679_100210011
515 Ga0070684_100265995
516 Ga0070684_100391290
517 Ga0070684_101581289
518 Ga0068853_100210613
519 Ga0068853_100548631
520 Ga0068853_100569359
521 Ga0070672_100161315
522 Ga0070686_100023995
523 Ga0070665_100143401
524 Ga0070664_100356981
525 Ga0068857_100105723
526 Ga0068857_100159584
527 Ga0068854_100521197
528 Ga0068856_100921613
529 Ga0070702_100218920
530 Ga0068859_100091341
531 Ga0068859_101983250
532 Ga0068864_100052378
533 Ga0068864_100123371
534 Ga0068866_10142794
535 Ga0068866_10550162
536 Ga0068861_100134087
537 Ga0068851_10178277
538 Ga0068863_100073738
539 Ga0068863_100148509
540 Ga0068858_100130678
541 Ga0068860_100030280
542 Ga0068862_100579700
543 Ga0081455_10010586
544 Ga0081540_1056640
545 Ga0081539_10002854
546 Ga0070717_10275604
547 Ga0070717_10415453
548 Ga0070717_10658446
549 Ga0075365_10007065
550 Ga0075365_10024758
551 Ga0075365_10627299
552 Ga0075368_10048382
553 Ga0075363_100000153
554 Ga0075363_100571588
555 Ga0075364_10136677
556 Ga0075364_10406851
557 Ga0070715_10082694
558 Ga0070712_100085678
559 Ga0070712_100285877
560 Ga0075362_10002859
561 Ga0075362_10126908
562 Ga0075367_10019110
563 Ga0075367_10090474
564 Ga0075367_10102364
565 Ga0075366_10001594
566 Ga0075366_10016630
567 Ga0075370_10158298
568 Ga0068871_100090332
569 Ga0075428_100014729
570 Ga0075428_100266570
571 Ga0075428_100752754
572 Ga0075430_100032726
573 Ga0075431_100009653
574 Ga0075431_100254687
575 Ga0075431_100898291
576 Ga0075433_10158200
577 Ga0075433_10957754
578 Ga0075434_100170139
579 Ga0075434_100249652
580 Ga0075429_101409546
581 Ga0068865_100058413
582 Ga0068865_101226520
583 Ga0097620_100091339
584 Ga0097620_101183064
585 Ga0097620_101982972
586 Ga0075435_100313299
587 Ga0111539_11587780
588 Ga0105245_10742066
589 Ga0114129_10000935
590 Ga0114129_10898505
591 Ga0114129_11083032
592 Ga0105243_10657029
593 Ga0105241_10912920
594 Ga0105241_11049421
595 Ga0105242_10089930
596 Ga0105248_10212146
597 Ga0105237_10303596
598 Ga0105238_10016481
599 Ga0105249_10193767
600 Ga0105249_10441608
601 Ga0105249_10725137
602 Ga0105249_10847907
603 Ga0105239_10310253
604 Ga0105239_10777970
605 Ga0105246_10152800
606 Ga0105246_10681089
607 Ga0157374_10023414
608 Ga0157378_10194687
609 Ga0157378_10511570
610 Ga0163162_10282438
611 Ga0163162_10638307
612 Ga0163162_11898368
613 Ga0157375_11423195
614 Ga0157375_11812133
615 Ga0163163_10087666
616 Ga0157380_11861788
617 Ga0182008_10098761
618 Ga0157377_10009522
619 Ga0157379_10306800
620 Ga0157379_11162824
621 Ga0163161_10617050
622 Ga0213876_10019172
623 Ga0209758_1005755
624 Ga0207697_10108296
625 Ga0207697_10189635
626 Ga0207656_10054914
627 Ga0207682_10000865
628 Ga0207688_10011328
629 Ga0207688_10017372
630 Ga0207688_10125703
631 Ga0207680_10226227
632 Ga0207680_10721791
633 Ga0207647_10023186
634 Ga0207699_10854873
635 Ga0207645_10005075
636 Ga0207645_10028160
637 Ga0207654_10121649
638 Ga0207671_10392682
639 Ga0207663_10508730
640 Ga0207660_10659925
641 Ga0207662_10044508
642 Ga0207662_10066781
643 Ga0207657_10019678
644 Ga0207681_10131837
645 Ga0207681_10836015
646 Ga0207650_10065638
647 Ga0207650_10177796
648 Ga0207650_10458813
649 Ga0207659_10023938
650 Ga0207659_10199677
651 Ga0207659_10351388
652 Ga0207687_11127729
653 Ga0207700_10288374
654 Ga0207700_10409953
655 Ga0207664_10403574
656 Ga0207644_10140311
657 Ga0207706_10001078
658 Ga0207686_10386066
659 Ga0207686_10606932
660 Ga0207709_10162688
661 Ga0207709_10260364
662 Ga0207709_11245836
663 Ga0207669_10336047
664 Ga0207691_10003016
665 Ga0207691_10013813
666 Ga0207689_10001278
667 Ga0207689_10081623
668 Ga0207679_10083007
669 Ga0207679_10686252
670 Ga0207651_10038298
671 Ga0207712_10505044
672 Ga0207712_10563697
673 Ga0207668_10279911
674 Ga0207658_10905000
675 Ga0207677_10251167
676 Ga0207703_10199633
677 Ga0207639_10287874
678 Ga0207639_10607222
679 Ga0207678_10090155
680 Ga0207678_10584891
681 Ga0207708_10003818
682 Ga0207708_10072513
683 Ga0207641_10097101
684 Ga0207641_12106193
685 Ga0207648_10016856
686 Ga0207676_10068234
687 Ga0207676_10877034
688 Ga0207674_10089531
689 Ga0207674_10123076
690 Ga0207674_10540719
691 Ga0207675_100001067
692 Ga0207675_100236436
693 Ga0207698_10347240
694 Ga0207428_10612402
695 Ga0268265_10081093
696 Ga0265318_10082630
697 Ga0265330_10200624
698 Ga0265320_10046903
699 Ga0265340_10070313
700 Ga0265313_10160852
701 Ga0373929_0052809
702 Ga0373944_0040445
703 Ga0373923_0112910
704 Ga0373936_0077190
705 Ga0373945_0006138
706 Ga0373945_0056954
707 Ga0373953_0001606
708 Ga0373954_0315861
709 Ga0373956_0007284
710 Ga0373956_0344007
711 Ga0373943_0000917
712 Ga0373943_0003490
713 Ga0373943_0105128
714 Ga0373946_0004458
715 Ga0373955_0000346
716 Ga0373924_0001455
717 Ga0373931_0223199
718 Ga0373935_0000056
719 Ga0373935_0148567
720 Ga0373927_0027558
721 Ga0373927_0033737
722 Ga0373933_0004205
723 Ga0373947_0004488
724 Ga0373947_0008290
725 Ga0373947_0347932
726 Ga0373947_0436337
727 Ga0373947_0748600
728 Ga0373937_0000075
729 Ga0373937_0674234
730 Ga0373925_0000159
731 Ga0373925_0002643
732 Ga0373925_0302671
733 Ga0373925_0546855
734 Ga0436365_0052204
735 Ga0436365_0414545
736 Ga0439453_0046444
737 Ga0451851_1127276
738 Ga0439444_0020118
739 Ga0466963_0024430
740 Ga0466959_0081994
741 Ga0466958_0006496
742 Ga0495627_055793
743 Ga0495592_0000102
744 Ga0495603_0392899
745 Ga0495629_0061569
746 Ga0495629_0131497
747 Ga0495629_0486459
748 Ga0495638_0155128
749 Ga0495651_0001236
750 Ga0495653_0000036
751 Ga0495580_0345850
752 Ga0495605_0056156
753 Ga0495639_0089359
754 Ga0495662_0006322
755 Ga0495662_0054295
756 Ga0495664_0000107
757 Ga0495664_0286754
758 Ga0495594_0208257
759 Ga0495596_0049762
760 Ga0495608_0000006
761 Ga0495618_0000057
762 Ga0495618_0707883
763 Ga0495628_0000077
764 Ga0495630_0001707
765 Ga0495630_0003757
766 Ga0495632_0194028
767 Ga0495643_0073346
768 Ga0495643_0099355
769 Ga0495666_0045481
770 Ga0495652_0000005
771 Ga0495652_0533589
772 Ga0495665_0073960
773 Ga0495665_0473652
774 Ga0495640_0000007
775 Ga0495640_0029106
776 Ga0495587_0000043
777 Ga0495621_0318425
778 Ga0495645_0000275
779 Ga0495667_0000023
780 Ga0495634_0000049
781 Ga0495634_0062108
782 Ga0495634_0161651
783 Ga0495635_0000021
784 Ga0495635_0035489
785 Ga0495657_0000063
786 Ga0495657_0329145
787 Ga0495599_0000001
788 Ga0495623_0000056
789 Ga0495646_0000007
790 Ga0495658_0010076
791 Ga0495658_0216228
792 Ga0495613_0015829
793 Ga0495613_0056629
794 Ga0495613_0463475
795 Ga0495613_0645913
796 Ga0495624_0021201
797 Ga0495624_0061315
798 Ga0495671_0046751
799 Ga0495600_0000047
800 Ga0495600_0318246
801 Ga0495581_0002513
802 Ga0495581_0035607
803 Ga0495581_0612621
804 Ga0495604_0000014
805 Ga0495604_0193622
806 Ga0495604_0329363
807 Ga0495636_0088822
808 Ga0495674_0000014
809 Ga0495674_0140005
810 Ga0495674_0204585
811 Ga0495676_0539264
812 Ga0495680_0000744
813 Ga0495680_0237445
814 Ga0495675_0000940
815 Ga0495684_0000272
816 Ga0495684_0001055
817 Ga0495686_0270216
818 Ga0495593_0043801
819 Ga0495593_0319204
820 Ga0495602_0000017
821 Ga0495602_0178298
822 Ga0495614_0170683
823 Ga0495615_0002577
824 Ga0495615_0008549
825 Ga0495615_0029253
826 Ga0496100_0200500
827 Ga0496101_0060293
828 Ga0496101_0262477
829 Ga0496102_1253409
830 Ga0496103_0106222
831 Ga0496104_0199383
832 Ga0496105_0000898
833 Ga0496105_0010209
834 Ga0496105_0100277
835 Ga0496105_0919247
836 Ga0496106_0085508
837 Ga0496106_0115952
838 Ga0496106_0138730
839 Ga0496107_0005780
840 Ga0496108_0006090
841 Ga0496108_0261019
842 Ga0496108_0329168
843 Ga0496109_0016212
844 Ga0496109_0054393
845 Ga0496110_0058090
846 Ga0496110_0220601
847 Ga0496110_0372877
848 Ga0496110_0441144
849 Ga0496111_0004774
850 Ga0496111_0007298
851 Ga0496112_0017433
852 Ga0496113_0001484
853 Ga0496113_0082641
854 Ga0496113_0256415
855 Ga0496114_0838195
856 Ga0496115_0137567
857 Ga0501039_0013220
858 Ga0501039_0120054
859 Ga0501046_0203366
860 Ga0501071_0022112
861 Ga0501071_0388397
862 Ga0501071_1256012
863 Ga0501072_0112426
864 Ga0501074_1075938
865 Ga0501075_0049475
866 Ga0501076_0426019
867 Ga0501076_1200266
868 Ga0501079_0143782
869 Ga0501079_1068075
870 Ga0501083_0355465
871 nmdc:mga03683_14719_c1
872 nmdc:mga03n38_383323_c1
873 nmdc:mga03n38_488106_c1
874 nmdc:mga03n38_9771_c1
875 nmdc:mga00v17_309207_c1
876 nmdc:mga00v17_960191_c1
877 nmdc:mga0yw44_1198_c1
878 nmdc:mga0yw44_191909_c1
879 nmdc:mga0yw44_59064_c1
880 nmdc:mga0k408_40381_c1
881 nmdc:mga0k408_553113_c1
882 nmdc:mga0k408_69121_c1
883 nmdc:mga06z11_31778_c1
884 nmdc:mga06z11_94124_c1
885 nmdc:mga04h51_225725_c1
886 nmdc:mga04h51_6005_c1
887 nmdc:mga07m45_124782_c1
888 nmdc:mga05p37_36408_c1
889 nmdc:mga09592_1173221_c1
890 nmdc:mga06r32_238096_c1
891 nmdc:mga06r32_252350_c1
892 nmdc:mga06r32_734242_c1
893 nmdc:mga08y16_1030808_c1
894 nmdc:mga08y16_71897_c1
895 nmdc:mga0n895_15233_c1
896 nmdc:mga0n895_210824_c1
897 nmdc:mga0n895_240139_c1
898 nmdc:mga0rr50_561208_c1
899 nmdc:mga0rr50_70687_c1
900 nmdc:mga0a205_1196436_c1
901 nmdc:mga0a205_148991_c1
902 nmdc:mga0sz30_220008_c1
903 nmdc:mga0sz30_439605_c1
904 Ga0495601_0000016
905 Ga0495601_0020265
906 Ga0495612_0000035
907 Ga0500610_0032413
908 Ga0495595_0000032
909 Ga0495595_0162079
910 Ga0495619_0000033
911 Ga0495619_0086873
912 Ga0495619_0201649
913 Ga0500652_000253
914 Ga0500577_0204706
915 Ga0500604_0033541
916 Ga0500627_0106502
917 Ga0500611_151757
918 Ga0500645_034150
919 Ga0501084_0058203
920 Ga0501084_0249048
921 Ga0501084_0416666
922 Ga0501082_0000099
923 Ga0501082_0140298
924 Ga0501082_0243441
925 Ga0501082_0250428
926 Ga0501082_0417864
927 Ga0530510_0067928
928 Ga0530510_0220359
929 2876817643
930 2879113107

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10003

DUF2244

Integral membrane protein (DUF2244)

18

158

0.98

Map