F449486

General Info

Members Datasets Scaffolds Average Seq Length
465 274 928 269

Family's Representative Sequence

Representative Sequence 3300015265|Ga0182005_1012312|Ga0182005_10123123
Length 310
Sequence MPRRVSKPDRLIIDPGRGAWCASAWIDCALQRRSPTWQGCLIVNAEALKDSEFKQFQSWLYRAAGINLSPAKKALVAGRLSKRLKHHQLNSYGDYFQMIMGHGATAELQIALDLLTTNETYFFREPKHFDFLRQQVLPKAAPGKIFRLWSAASSSGEEPYSLAMTLADGLGSTPWEIIGSDISSQVLAKARTGHYPIERASHIAQPLLARHCLKGTGSQEGTFLIERNLRSRVHFMPINLNESLPNIGEFEVIFLRNVMIYFDQETKRKVVARMLPLLKPGGYFIVSHSESLNGITDGLKLISPSIYRKP

Samples

Sample ID Description Type Environment
1 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
34 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
35 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
36 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
37 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
74 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
80 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
81 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
82 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
83 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
101 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
102 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
103 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
104 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
105 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
106 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
107 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
108 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
109 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
110 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
111 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
112 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
113 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
114 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
115 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
116 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
117 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
118 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
119 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
127 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
128 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
129 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
130 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
131 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
132 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
133 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
136 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
137 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
138 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
139 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
140 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
141 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
142 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
143 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
144 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
145 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
148 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
151 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
152 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
153 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
154 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
157 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
158 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
159 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
162 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
172 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
177 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
178 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
179 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
180 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
181 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
182 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
183 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
184 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
185 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
186 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
187 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
188 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
189 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
190 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
191 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
192 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
193 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
194 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
195 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
196 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
197 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
198 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
199 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
200 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
201 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
202 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
203 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
204 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
205 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
206 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
207 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
208 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
209 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
210 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
211 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
212 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
213 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
214 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
215 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
216 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
217 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
218 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
219 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
220 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
221 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
222 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
223 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
224 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
225 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
226 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
227 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
228 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
229 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
230 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
231 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
232 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
233 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
234 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
235 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
236 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
237 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
238 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
239 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
240 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
241 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
242 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
243 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
244 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
245 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
246 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
247 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
248 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
249 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
250 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
251 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
252 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
253 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
254 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
255 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
256 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
257 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
258 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
259 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
260 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
261 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
262 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
263 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
264 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
265 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
266 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
267 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
268 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
269 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
270 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
271 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
272 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
273 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
274 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 69.03
Metatranscriptomes 0
Isolates 30.97

Biome Distribution

Category Percentage (%)
Aerial Root 0.43
Bulb 0
Endosphere 1.94
Nodule 1.29
Rhizoplane 13.98
Rhizosphere 70.11
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182005_1012312 3300015265 Bacteria 2418
2 SwRhRL2b_contig_3834392 2162886007 Bacteria 7000
3 rootH1_10396375 3300003323 Bacteria 1337
4 Ga0055540_1000358 3300003792 Bacteria 38808
5 Ga0065714_10003146 3300005288 Bacteria 15707
6 Ga0065714_10106188 3300005288 Bacteria 1553
7 Ga0065704_10000531 3300005289 Bacteria 21770
8 Ga0065704_10017805 3300005289 Bacteria 3350
9 Ga0065712_10078233 3300005290 Bacteria 3376
10 Ga0065712_10109001 3300005290 Bacteria 1863
11 Ga0070670_100000017 3300005331 Bacteria 224429
12 Ga0070670_100000250 3300005331 Bacteria 48480
13 Ga0070666_10037023 3300005335 Bacteria 3242
14 Ga0070661_100000091 3300005344 Bacteria 73554
15 Ga0070661_100000233 3300005344 Bacteria 46159
16 Ga0070669_100000322 3300005353 Bacteria 37474
17 Ga0070669_100000420 3300005353 Bacteria 32410
18 Ga0070671_100000173 3300005355 Bacteria 42660
19 Ga0070688_100004605 3300005365 Bacteria 7195
20 Ga0070667_100000203 3300005367 Bacteria 70031
21 Ga0070708_100344174 3300005445 Bacteria 1405
22 Ga0070662_100000227 3300005457 Bacteria 33126
23 Ga0070685_10000026 3300005466 Bacteria 98490
24 Ga0070706_100081992 3300005467 Bacteria 2988
25 Ga0068853_100000499 3300005539 Bacteria 26876
26 Ga0070665_100023167 3300005548 Bacteria 6254
27 Ga0070665_100114483 3300005548 Bacteria 2700
28 Ga0070664_100000053 3300005564 Bacteria 69415
29 Ga0070664_100000125 3300005564 Bacteria 51348
30 Ga0068854_100003662 3300005578 Bacteria 9614
31 Ga0068859_100140740 3300005617 Bacteria 2486
32 Ga0068864_100000029 3300005618 Bacteria 224429
33 Ga0068851_10000520 3300005834 Bacteria 16854
34 Ga0068863_100195325 3300005841 Bacteria 1945
35 Ga0068858_100010971 3300005842 Bacteria 8562
36 Ga0068860_100010514 3300005843 Bacteria 9150
37 Ga0068862_100005773 3300005844 Bacteria 10321
38 Ga0075364_10085575 3300006051 Bacteria 2088
39 Ga0075370_10139669 3300006353 Bacteria 1416
40 Ga0097620_100140744 3300006931 Bacteria 2486
41 Ga0079104_1000041 3300006946 Bacteria 186297
42 Ga0079104_1018239 3300006946 Unclassified 1994
43 Ga0099826_10046540 3300006948 Bacteria 2955
44 Ga0105251_10006241 3300009011 Bacteria 7641
45 Ga0105251_10008253 3300009011 Bacteria 6294
46 Ga0105251_10031786 3300009011 Bacteria 2637
47 Ga0105244_10000756 3300009036 Bacteria 27613
48 Ga0105244_10006204 3300009036 Bacteria 7795
49 Ga0105244_10012788 3300009036 Bacteria 4948
50 Ga0105244_10017346 3300009036 Bacteria 4070
51 Ga0105250_10000015 3300009092 Bacteria 262683
52 Ga0105250_10000199 3300009092 Bacteria 51075
53 Ga0105242_10001830 3300009176 Bacteria 16700
54 Ga0105242_10008757 3300009176 Bacteria 7764
55 Ga0105248_10109156 3300009177 Bacteria 3119
56 Ga0105248_10126883 3300009177 Bacteria 2878
57 Ga0105237_10000455 3300009545 Bacteria 58035
58 Ga0105237_10001233 3300009545 Bacteria 34098
59 Ga0105237_10202372 3300009545 Bacteria 1986
60 Ga0157373_10003737 3300013100 Bacteria 11514
61 Ga0157373_10077612 3300013100 Bacteria 2343
62 Ga0157370_10009977 3300013104 Bacteria 10048
63 Ga0157370_10044630 3300013104 Bacteria 4258
64 Ga0157370_10152668 3300013104 Bacteria 2149
65 Ga0157369_10001081 3300013105 Bacteria 34115
66 Ga0157369_10014068 3300013105 Bacteria 9040
67 Ga0157369_10020695 3300013105 Bacteria 7355
68 Ga0157374_10002026 3300013296 Bacteria 17007
69 Ga0163162_10171998 3300013306 Bacteria 2291
70 Ga0163162_10295191 3300013306 Bacteria 1752
71 Ga0157372_10817918 3300013307 Bacteria 1082
72 Ga0157375_10000996 3300013308 Bacteria 24450
73 Ga0157375_10117609 3300013308 Bacteria 2764
74 Ga0163163_10000658 3300014325 Bacteria 29560
75 Ga0182008_10102569 3300014497 Bacteria 1415
76 Ga0182008_10105011 3300014497 Bacteria 1397
77 Ga0182006_1000143 3300015261 Bacteria 76634
78 Ga0182006_1000842 3300015261 Bacteria 20632
79 Ga0182006_1057790 3300015261 Bacteria 1473
80 Ga0163161_10000581 3300017792 Bacteria 29441
81 Ga0163161_10045934 3300017792 Bacteria 3150
82 Ga0163161_10130399 3300017792 Bacteria 1896
83 Ga0209050_1000009 3300025298 Bacteria 1047265
84 Ga0209051_1000438 3300025303 Bacteria 56435
85 Ga0209257_1004767 3300025304 Bacteria 10124
86 Ga0207656_10000410 3300025321 Bacteria 14409
87 Ga0207696_1000090 3300025711 Bacteria 188474
88 Ga0207696_1000176 3300025711 Bacteria 100134
89 Ga0207696_1000177 3300025711 Bacteria 100134
90 Ga0207696_1000371 3300025711 Bacteria 44425
91 Ga0207655_1000006 3300025728 Bacteria 861092
92 Ga0207655_1000390 3300025728 Bacteria 61299
93 Ga0207655_1000457 3300025728 Bacteria 53535
94 Ga0207713_1001136 3300025735 Bacteria 22587
95 Ga0207680_10318459 3300025903 Bacteria 1087
96 Ga0207684_10107458 3300025910 Bacteria 2387
97 Ga0207671_10001022 3300025914 Bacteria 34106
98 Ga0207671_10001360 3300025914 Bacteria 28567
99 Ga0207649_10000095 3300025920 Bacteria 73954
100 Ga0207649_10000375 3300025920 Bacteria 33434
101 Ga0207681_10000401 3300025923 Bacteria 30136
102 Ga0207681_10000936 3300025923 Bacteria 19006
103 Ga0207650_10000003 3300025925 Bacteria 1123235
104 Ga0207650_10000727 3300025925 Bacteria 25549
105 Ga0207644_10000057 3300025931 Bacteria 83320
106 Ga0207706_10000501 3300025933 Bacteria 41713
107 Ga0207711_10000472 3300025941 Bacteria 41502
108 Ga0207679_10000008 3300025945 Bacteria 412057
109 Ga0207679_10000180 3300025945 Bacteria 52169
110 Ga0207679_10065275 3300025945 Bacteria 2723
111 Ga0207640_10050878 3300025981 Bacteria 2690
112 Ga0207658_10000012 3300025986 Bacteria 224402
113 Ga0207639_10208583 3300026041 Bacteria 1680
114 Ga0207676_10000003 3300026095 Bacteria 1123235
115 Ga0209281_1000073 3300027111 Bacteria 269036
116 Ga0209371_1007889 3300027312 Bacteria 3622
117 Ga0209282_1062416 3300027666 Bacteria 2069
118 Ga0268266_10044960 3300028379 Bacteria 3775
119 Ga0268266_10196838 3300028379 Bacteria 1843
120 Ga0268265_10001254 3300028380 Bacteria 21916
121 Ga0268264_10000009 3300028381 Bacteria 724972
122 Ga0307515_10000188 3300028794 Bacteria 151439
123 Ga0268256_1008175 3300030500 Bacteria 3622
124 Ga0314311_1257646 3300030733 Bacteria 2755
125 Ga0265328_10002140 3300031239 Bacteria 8914
126 Ga0265328_10015079 3300031239 Bacteria 3033
127 Ga0265325_10187418 3300031241 Bacteria 960
128 Ga0265340_10001854 3300031247 Bacteria 12060
129 Ga0265331_10000390 3300031250 Bacteria 45388
130 Ga0265331_10081617 3300031250 Bacteria 1501
131 Ga0265327_10000085 3300031251 Bacteria 203068
132 Ga0265327_10000721 3300031251 Bacteria 51910
133 Ga0265327_10000859 3300031251 Bacteria 45360
134 Ga0265327_10001585 3300031251 Bacteria 27716
135 Ga0265327_10004037 3300031251 Bacteria 13331
136 Ga0265327_10020519 3300031251 Bacteria 4022
137 Ga0265327_10056602 3300031251 Unclassified 2020
138 Ga0265327_10088683 3300031251 Bacteria 1512
139 Ga0265316_10025563 3300031344 Bacteria 4926
140 Ga0265316_10130663 3300031344 Bacteria 1892
141 Ga0307408_100000465 3300031548 Bacteria 35428
142 Ga0307408_100025889 3300031548 Bacteria 4021
143 Ga0307408_100051972 3300031548 Bacteria 2954
144 Ga0307514_10147400 3300031649 Bacteria 1587
145 Ga0307405_10000149 3300031731 Bacteria 26581
146 Ga0307405_10011196 3300031731 Bacteria 4685
147 Ga0307405_10060372 3300031731 Bacteria 2392
148 Ga0307405_10103358 3300031731 Bacteria 1915
149 Ga0307413_10020257 3300031824 Bacteria 3533
150 Ga0307406_10020661 3300031901 Bacteria 3881
151 Ga0307406_10459393 3300031901 Bacteria 1023
152 Ga0307407_10037215 3300031903 Bacteria 2687
153 Ga0307407_10336175 3300031903 Bacteria 1065
154 Ga0307412_10006494 3300031911 Bacteria 6615
155 Ga0307412_10009858 3300031911 Bacteria 5489
156 Ga0307412_10029013 3300031911 Bacteria 3468
157 Ga0307409_100049451 3300031995 Bacteria 3206
158 Ga0307414_10081528 3300032004 Bacteria 2369
159 Ga0307414_10085831 3300032004 Bacteria 2320
160 Ga0307411_10023258 3300032005 Bacteria 3667
161 Ga0307411_10090203 3300032005 Bacteria 2137
162 Ga0307411_10315837 3300032005 Bacteria 1259
163 Ga0373927_0009450 3300035695 Bacteria 6539
164 Ga0395905_0002481 3300037471 Bacteria 20416
165 Ga0439438_000073 3300041405 Bacteria 46619
166 Ga0439438_004269 3300041405 Bacteria 5545
167 Ga0439438_012785 3300041405 Bacteria 2558
168 Ga0439438_014856 3300041405 Bacteria 2307
169 Ga0439447_000031 3300041407 Bacteria 49687
170 Ga0439447_007014 3300041407 Bacteria 3610
171 Ga0439453_0016751 3300041408 Bacteria 1281
172 Ga0439466_0000288 3300041411 Bacteria 19602
173 Ga0439466_0000477 3300041411 Bacteria 15276
174 Ga0439466_0000740 3300041411 Bacteria 12372
175 Ga0439466_0014041 3300041411 Bacteria 2923
176 Ga0439466_0031131 3300041411 Bacteria 1826
177 Ga0439431_0003418 3300041997 Bacteria 3495
178 Ga0439437_000096 3300042000 Bacteria 6473
179 Ga0439432_000025 3300042006 Bacteria 50525
180 Ga0439432_011151 3300042006 Bacteria 3097
181 Ga0439432_020094 3300042006 Bacteria 2222
182 Ga0439432_020717 3300042006 Bacteria 2183
183 Ga0439432_024088 3300042006 Bacteria 2001
184 Ga0439452_000155 3300042010 Bacteria 50710
185 Ga0439452_005043 3300042010 Bacteria 4311
186 Ga0439452_041699 3300042010 Bacteria 1078
187 Ga0439456_001031 3300042013 Bacteria 5532
188 Ga0450911_000007 3300042115 Bacteria 212322
189 Ga0450913_001782 3300042117 Bacteria 1240
190 Ga0450894_002072 3300042131 Bacteria 2752
191 Ga0450898_000017 3300042134 Bacteria 13617
192 Ga0450899_003376 3300042135 Bacteria 1718
193 Ga0439446_0000014 3300042156 Bacteria 39067
194 Ga0439446_0001805 3300042156 Bacteria 4996
195 Ga0439446_0022668 3300042156 Bacteria 1781
196 Ga0439434_0006003 3300042435 Bacteria 3545
197 Ga0439459_0004302 3300042438 Bacteria 2287
198 Ga0439464_0040481 3300042439 Bacteria 1327
199 Ga0450916_000020 3300042530 Bacteria 7935
200 Ga0450916_002541 3300042530 Bacteria 1947
201 Ga0450893_0000299 3300042532 Bacteria 6826
202 Ga0451577_0000395 3300042876 Bacteria 80169
203 Ga0451577_0319831 3300042876 Bacteria 1407
204 Ga0466969_0016994 3300044656 Bacteria 3801
205 Ga0466961_0005920 3300044693 Bacteria 7749
206 Ga0453684_0000354 3300044712 Bacteria 190599
207 Ga0453684_0001464 3300044712 Bacteria 66894
208 Ga0453684_0001598 3300044712 Bacteria 62237
209 Ga0453684_0291227 3300044712 Bacteria 1859
210 Ga0453684_0791515 3300044712 Bacteria 1023
211 Ga0453684_0923786 3300044712 Bacteria 933
212 Ga0453684_1160364 3300044712 Bacteria 813
213 Ga0466959_0176299 3300045049 Bacteria 1497
214 Ga0451576_0000013 3300045051 Bacteria 665120
215 Ga0451576_0195917 3300045051 Bacteria 2110
216 Ga0495617_012890 3300046452 Bacteria 2849
217 Ga0495617_038755 3300046452 Bacteria 1594
218 Ga0495627_000009 3300046453 Bacteria 463964
219 Ga0495627_024961 3300046453 Bacteria 1942
220 Ga0495591_000002 3300046458 Bacteria 455013
221 Ga0495591_006456 3300046458 Bacteria 5184
222 Ga0495591_013161 3300046458 Bacteria 3042
223 Ga0495650_0010305 3300046471 Bacteria 5225
224 Ga0495605_0000007 3300046474 Bacteria 358289
225 Ga0495605_0001110 3300046474 Bacteria 17928
226 Ga0495605_0001750 3300046474 Bacteria 13910
227 Ga0495605_0005366 3300046474 Bacteria 7468
228 Ga0495605_0075218 3300046474 Bacteria 1588
229 Ga0495584_0000134 3300046491 Bacteria 50765
230 Ga0495584_0001249 3300046491 Bacteria 15526
231 Ga0495584_0074378 3300046491 Bacteria 1707
232 Ga0495607_0000045 3300046501 Bacteria 125217
233 Ga0495607_0002449 3300046501 Bacteria 15097
234 Ga0495607_0004589 3300046501 Bacteria 10120
235 Ga0495607_0006369 3300046501 Bacteria 8312
236 Ga0495583_0000007 3300046506 Bacteria 434661
237 Ga0495606_0003629 3300046507 Bacteria 16209
238 Ga0495606_0015798 3300046507 Bacteria 5794
239 Ga0495606_0091505 3300046507 Bacteria 1870
240 Ga0495610_0026211 3300046512 Bacteria 3115
241 Ga0495610_0105880 3300046512 Bacteria 1253
242 Ga0495616_0004719 3300046513 Bacteria 8542
243 Ga0495620_0000014 3300046515 Bacteria 157890
244 Ga0495620_0012299 3300046515 Bacteria 4431
245 Ga0495631_0000733 3300046518 Bacteria 21060
246 Ga0495631_0066536 3300046518 Bacteria 1559
247 Ga0495632_0013988 3300046519 Bacteria 4557
248 Ga0495637_0013802 3300046520 Bacteria 3827
249 Ga0495637_0014617 3300046520 Bacteria 3700
250 Ga0495637_0034998 3300046520 Bacteria 2196
251 Ga0495643_0002331 3300046522 Bacteria 15255
252 Ga0495648_0033129 3300046524 Bacteria 3379
253 Ga0495654_0004087 3300046530 Bacteria 8757
254 Ga0495654_0009834 3300046530 Bacteria 5226
255 Ga0495609_0000004 3300046538 Bacteria 697346
256 Ga0495609_0062141 3300046538 Bacteria 1649
257 Ga0495597_0000023 3300046542 Bacteria 149302
258 Ga0495633_0000135 3300046558 Bacteria 97871
259 Ga0495633_0001755 3300046558 Bacteria 16096
260 Ga0495668_0083309 3300046616 Bacteria 1754
261 Ga0495611_0001820 3300046648 Bacteria 10221
262 Ga0495625_0004716 3300046660 Bacteria 12765
263 Ga0495625_0123207 3300046660 Bacteria 1762
264 Ga0495661_0000106 3300046665 Bacteria 100351
265 Ga0495661_0057454 3300046665 Bacteria 2323
266 Ga0495661_0107847 3300046665 Bacteria 1556
267 Ga0495671_0000212 3300046692 Bacteria 50878
268 Ga0495671_0010183 3300046692 Bacteria 5223
269 Ga0495671_0052163 3300046692 Bacteria 2033
270 Ga0495649_0000030 3300046694 Bacteria 152164
271 Ga0495649_0054362 3300046694 Bacteria 2165
272 Ga0495589_0000966 3300046794 Bacteria 17567
273 Ga0495589_0117649 3300046794 Bacteria 1280
274 Ga0495660_0000560 3300046810 Bacteria 30334
275 Ga0495660_0001006 3300046810 Bacteria 20524
276 Ga0495660_0191247 3300046810 Bacteria 983
277 Ga0495672_0001668 3300047320 Bacteria 21529
278 Ga0495672_0101301 3300047320 Bacteria 1561
279 Ga0495683_0000004 3300047323 Bacteria 321136
280 Ga0495683_0000924 3300047323 Bacteria 20706
281 Ga0495679_006593 3300047446 Bacteria 4971
282 Ga0495673_0000198 3300047469 Bacteria 93985
283 Ga0495673_0000400 3300047469 Bacteria 50787
284 Ga0495673_0005159 3300047469 Bacteria 7958
285 Ga0495681_0002504 3300047470 Bacteria 13088
286 Ga0495686_0090922 3300047472 Bacteria 1853
287 Ga0495626_0000355 3300048091 Bacteria 47898
288 Ga0496117_0013153 3300048920 Bacteria 7238
289 Ga0496118_0014910 3300048921 Bacteria 7238
290 Ga0496120_0034130 3300048923 Bacteria 3051
291 Ga0496121_0192983 3300048924 Bacteria 1458
292 Ga0496122_0012130 3300048925 Bacteria 8629
293 Ga0496122_0054517 3300048925 Bacteria 3002
294 Ga0496122_0107874 3300048925 Bacteria 1838
295 Ga0496123_0043768 3300048926 Bacteria 3070
296 Ga0496123_0046916 3300048926 Bacteria 2924
297 Ga0496124_0000035 3300048927 Bacteria 318099
298 Ga0496124_0004476 3300048927 Bacteria 16305
299 Ga0496124_0025869 3300048927 Bacteria 5304
300 Ga0496124_0040811 3300048927 Bacteria 4010
301 Ga0496125_0002115 3300048928 Bacteria 26689
302 Ga0496125_0011521 3300048928 Bacteria 8835
303 Ga0496125_0017443 3300048928 Bacteria 6843
304 Ga0496125_0018446 3300048928 Bacteria 6626
305 Ga0496126_0002105 3300048929 Bacteria 27873
306 Ga0496126_0002519 3300048929 Bacteria 24534
307 Ga0496126_0058687 3300048929 Bacteria 3468
308 Ga0496126_0221759 3300048929 Bacteria 1588
309 Ga0495678_000014 3300049459 Bacteria 313755
310 Ga0495678_001501 3300049459 Bacteria 18158
311 Ga0495678_001568 3300049459 Bacteria 17564
312 Ga0495682_0009853 3300049460 Bacteria 3719
313 Ga0501033_0201011 3300049570 Bacteria 1423
314 Ga0501034_0059282 3300049571 Bacteria 3845
315 Ga0501038_0104416 3300049574 Bacteria 2355
316 Ga0501209_000080 3300049656 Bacteria 9592
317 Ga0501226_000022 3300049853 Bacteria 111874
318 nmdc:mga07m45_128063_c1 3300050496 Bacteria 1468
319 Ga0500650_0000319 3300053098 Bacteria 11594
320 Ga0500595_025070 3300053119 Bacteria 2074
321 2510285165 2510065053 Bacteria 5005518
322 2510293998 2510065055 Bacteria 5037935
323 2510313032 2510065058 Bacteria 5005894
324 2511824277 2511231156 Bacteria 6845832
325 2511825545 2511231156 Bacteria 6845832
326 2599399792 2599185167 Bacteria 6353609
327 2599454492 2599185179 Bacteria 6611171
328 2599515665 2599185190 Bacteria 6285678
329 2599522228 2599185191 Bacteria 6297582
330 2599611142 2599185212 Bacteria 6765997
331 2599614262 2599185212 Bacteria 6765997
332 2599768696 2599185248 Bacteria 6696816
333 2599770036 2599185248 Bacteria 6696816
334 2599880711 2599185288 Bacteria 6666191
335 2599881515 2599185288 Bacteria 6666191
336 2599884450 2599185289 Bacteria 6778765
337 2599887360 2599185289 Bacteria 6778765
338 2599895043 2599185290 Bacteria 6289611
339 2599896371 2599185291 Bacteria 6775623
340 2599898475 2599185291 Bacteria 6775623
341 2599932835 2599185300 Bacteria 6062622
342 2599941370 2599185302 Bacteria 5954930
343 2599942591 2599185302 Bacteria 5954930
344 2599946486 2599185303 Bacteria 6512725
345 2599949762 2599185303 Bacteria 6512725
346 2599953110 2599185304 Bacteria 5951361
347 2599953340 2599185304 Bacteria 5951361
348 2599958278 2599185305 Bacteria 6748700
349 2599958934 2599185305 Bacteria 6748700
350 2599964110 2599185306 Bacteria 6637356
351 2599968988 2599185306 Bacteria 6637356
352 2599976408 2599185308 Bacteria 6621546
353 2599980245 2599185308 Bacteria 6621546
354 2599982486 2599185309 Bacteria 5969593
355 2599982637 2599185309 Bacteria 5969593
356 2599989762 2599185310 Bacteria 6014457
357 2599992218 2599185310 Bacteria 6014457
358 2599994476 2599185311 Bacteria 6354990
359 2599998658 2599185312 Bacteria 5912071
360 2599999321 2599185312 Bacteria 5912071
361 2600003657 2599185313 Bacteria 6658188
362 2600006072 2599185313 Bacteria 6658188
363 2600009445 2599185314 Bacteria 6621749
364 2600009820 2599185314 Bacteria 6621749
365 2600015980 2599185315 Bacteria 6771107
366 2600017222 2599185315 Bacteria 6771107
367 2600023411 2599185316 Bacteria 6320029
368 2600028319 2599185317 Bacteria 6435722
369 2600029359 2599185317 Bacteria 6435722
370 2600035680 2599185318 Bacteria 6961590
371 2600036147 2599185318 Bacteria 6961590
372 2600040852 2599185319 Bacteria 6637840
373 2600044954 2599185319 Bacteria 6637840
374 2600047156 2599185320 Bacteria 5963263
375 2600047338 2599185320 Bacteria 5963263
376 2600051186 2599185321 Bacteria 6764560
377 2600052045 2599185321 Bacteria 6764560
378 2600057084 2599185322 Bacteria 6763055
379 2600059650 2599185322 Bacteria 6763055
380 2600064995 2599185323 Bacteria 6688755
381 2600065804 2599185323 Bacteria 6688755
382 2600069292 2599185324 Bacteria 6590677
383 2600069737 2599185324 Bacteria 6590677
384 2600077432 2599185325 Bacteria 6324919
385 2600357232 2600254930 Bacteria 6431253
386 2600358734 2600254930 Bacteria 6431253
387 2621300618 2619619299 Bacteria 6649820
388 2621300632 2619619299 Bacteria 6649820
389 2643870209 2643221571 Bacteria 6228673
390 2644222526 2643221639 Bacteria 6649903
391 2644280958 2643221650 Bacteria 7029547
392 2644284751 2643221650 Bacteria 7029547
393 2652546378 2651869719 Bacteria 6047974
394 2671089066 2667528170 Bacteria 6786960
395 2671090967 2667528170 Bacteria 6786960
396 2671124715 2667528176 Bacteria 6724917
397 2671126729 2667528176 Bacteria 6724917
398 2677899705 2675903420 Bacteria 6247433
399 2678263992 2675903515 Bacteria 6580491
400 2738673282 2738541265 Bacteria 6594665
401 2738673296 2738541265 Bacteria 6594665
402 2738687836 2738541271 Bacteria 5657310
403 2738751675 2738541282 Bacteria 6593925
404 2738751689 2738541282 Bacteria 6593925
405 2738806168 2738541294 Bacteria 6925949
406 2738810702 2738541294 Bacteria 6925949
407 2738860716 2738541303 Bacteria 6591772
408 2738860730 2738541303 Bacteria 6591772
409 2738893528 2738541309 Bacteria 6926455
410 2738898062 2738541309 Bacteria 6926455
411 2739263729 2738543016 Bacteria 5657564
412 2745004448 2744054620 Bacteria 6551379
413 2774128256 2773857672 Bacteria 4993178
414 2794597879 2791355520 Bacteria 5948615
415 2808854800 2808606361 Bacteria 6136259
416 2808855269 2808606361 Bacteria 6136259
417 2808922991 2808606376 Bacteria 6248667
418 2808925155 2808606376 Bacteria 6248667
419 2808935005 2808606378 Bacteria 6177535
420 2808935155 2808606378 Bacteria 6177535
421 2808943507 2808606379 Bacteria 5022697
422 2808945135 2808606380 Bacteria 6248705
423 2808947239 2808606380 Bacteria 6248705
424 2808960974 2808606382 Bacteria 6841132
425 2808963402 2808606383 Bacteria 6138645
426 2808963774 2808606383 Bacteria 6138645
427 2808980311 2808606385 Bacteria 6711065
428 2808980664 2808606385 Bacteria 6711065
429 2808996032 2808606388 Bacteria 6706662
430 2808996385 2808606388 Bacteria 6706662
431 2808998193 2808606389 Bacteria 6138126
432 2808998662 2808606389 Bacteria 6138126
433 2817490108 2816332298 Bacteria 6852809
434 2817490122 2816332298 Bacteria 6852809
435 2825652419 2825651385 Bacteria 6715909
436 2825657229 2825651385 Bacteria 6715909
437 2842859924 2842854478 Bacteria 6143501
438 2852613907 2852612431 Bacteria 6885235
439 2852614675 2852612431 Bacteria 6885235
440 2852660167 2852657418 Bacteria 6472974
441 2852667587 2852667396 Bacteria 6885555
442 2852668357 2852667396 Bacteria 6885555
443 2894514560 2894510363 Bacteria 5121143
444 2913039079 2913036834 Bacteria 6704877
445 2913039167 2913036834 Bacteria 6704877
446 2917835387 2917832318 Bacteria 5346010
447 2919129276 2919125081 Bacteria 5385106
448 2919456751 2919456309 Bacteria 6586567
449 2919485182 2919481497 Bacteria 6907839
450 2923586681 2923586266 Bacteria 6565975
451 2929146443 2929144301 Bacteria 6622272
452 2931369885 2931369376 Bacteria 6847892
453 2931395662 2931390751 Bacteria 6273349
454 2947237176 2947233263 Bacteria 6439278
455 2974299587 2974298342 Bacteria 4840922
456 2984501943 2984499530 Bacteria 5020881
457 2984504561 2984504281 Bacteria 5262371
458 2988729558 2988728565 Bacteria 6124362
459 3007422433 3007419365 Bacteria 7026924
460 3007422447 3007419365 Bacteria 7026924
461 3007869823 3007866637 Bacteria 5899198
462 8016733628 8016728285 Bacteria 5263933
463 8054290904 8054285046 Bacteria 6919322
464 8056145462 8056143049 Bacteria 6307666
465 Ga0182005_1012312
466 SwRhRL2b_contig_3834392
467 rootH1_10396375
468 Ga0055540_1000358
469 Ga0065714_10003146
470 Ga0065714_10106188
471 Ga0065704_10000531
472 Ga0065704_10017805
473 Ga0065712_10078233
474 Ga0065712_10109001
475 Ga0070670_100000017
476 Ga0070670_100000250
477 Ga0070666_10037023
478 Ga0070661_100000091
479 Ga0070661_100000233
480 Ga0070669_100000322
481 Ga0070669_100000420
482 Ga0070671_100000173
483 Ga0070688_100004605
484 Ga0070667_100000203
485 Ga0070708_100344174
486 Ga0070662_100000227
487 Ga0070685_10000026
488 Ga0070706_100081992
489 Ga0068853_100000499
490 Ga0070665_100023167
491 Ga0070665_100114483
492 Ga0070664_100000053
493 Ga0070664_100000125
494 Ga0068854_100003662
495 Ga0068859_100140740
496 Ga0068864_100000029
497 Ga0068851_10000520
498 Ga0068863_100195325
499 Ga0068858_100010971
500 Ga0068860_100010514
501 Ga0068862_100005773
502 Ga0075364_10085575
503 Ga0075370_10139669
504 Ga0097620_100140744
505 Ga0079104_1000041
506 Ga0079104_1018239
507 Ga0099826_10046540
508 Ga0105251_10006241
509 Ga0105251_10008253
510 Ga0105251_10031786
511 Ga0105244_10000756
512 Ga0105244_10006204
513 Ga0105244_10012788
514 Ga0105244_10017346
515 Ga0105250_10000015
516 Ga0105250_10000199
517 Ga0105242_10001830
518 Ga0105242_10008757
519 Ga0105248_10109156
520 Ga0105248_10126883
521 Ga0105237_10000455
522 Ga0105237_10001233
523 Ga0105237_10202372
524 Ga0157373_10003737
525 Ga0157373_10077612
526 Ga0157370_10009977
527 Ga0157370_10044630
528 Ga0157370_10152668
529 Ga0157369_10001081
530 Ga0157369_10014068
531 Ga0157369_10020695
532 Ga0157374_10002026
533 Ga0163162_10171998
534 Ga0163162_10295191
535 Ga0157372_10817918
536 Ga0157375_10000996
537 Ga0157375_10117609
538 Ga0163163_10000658
539 Ga0182008_10102569
540 Ga0182008_10105011
541 Ga0182006_1000143
542 Ga0182006_1000842
543 Ga0182006_1057790
544 Ga0163161_10000581
545 Ga0163161_10045934
546 Ga0163161_10130399
547 Ga0209050_1000009
548 Ga0209051_1000438
549 Ga0209257_1004767
550 Ga0207656_10000410
551 Ga0207696_1000090
552 Ga0207696_1000176
553 Ga0207696_1000177
554 Ga0207696_1000371
555 Ga0207655_1000006
556 Ga0207655_1000390
557 Ga0207655_1000457
558 Ga0207713_1001136
559 Ga0207680_10318459
560 Ga0207684_10107458
561 Ga0207671_10001022
562 Ga0207671_10001360
563 Ga0207649_10000095
564 Ga0207649_10000375
565 Ga0207681_10000401
566 Ga0207681_10000936
567 Ga0207650_10000003
568 Ga0207650_10000727
569 Ga0207644_10000057
570 Ga0207706_10000501
571 Ga0207711_10000472
572 Ga0207679_10000008
573 Ga0207679_10000180
574 Ga0207679_10065275
575 Ga0207640_10050878
576 Ga0207658_10000012
577 Ga0207639_10208583
578 Ga0207676_10000003
579 Ga0209281_1000073
580 Ga0209371_1007889
581 Ga0209282_1062416
582 Ga0268266_10044960
583 Ga0268266_10196838
584 Ga0268265_10001254
585 Ga0268264_10000009
586 Ga0307515_10000188
587 Ga0268256_1008175
588 Ga0314311_1257646
589 Ga0265328_10002140
590 Ga0265328_10015079
591 Ga0265325_10187418
592 Ga0265340_10001854
593 Ga0265331_10000390
594 Ga0265331_10081617
595 Ga0265327_10000085
596 Ga0265327_10000721
597 Ga0265327_10000859
598 Ga0265327_10001585
599 Ga0265327_10004037
600 Ga0265327_10020519
601 Ga0265327_10056602
602 Ga0265327_10088683
603 Ga0265316_10025563
604 Ga0265316_10130663
605 Ga0307408_100000465
606 Ga0307408_100025889
607 Ga0307408_100051972
608 Ga0307514_10147400
609 Ga0307405_10000149
610 Ga0307405_10011196
611 Ga0307405_10060372
612 Ga0307405_10103358
613 Ga0307413_10020257
614 Ga0307406_10020661
615 Ga0307406_10459393
616 Ga0307407_10037215
617 Ga0307407_10336175
618 Ga0307412_10006494
619 Ga0307412_10009858
620 Ga0307412_10029013
621 Ga0307409_100049451
622 Ga0307414_10081528
623 Ga0307414_10085831
624 Ga0307411_10023258
625 Ga0307411_10090203
626 Ga0307411_10315837
627 Ga0373927_0009450
628 Ga0395905_0002481
629 Ga0439438_000073
630 Ga0439438_004269
631 Ga0439438_012785
632 Ga0439438_014856
633 Ga0439447_000031
634 Ga0439447_007014
635 Ga0439453_0016751
636 Ga0439466_0000288
637 Ga0439466_0000477
638 Ga0439466_0000740
639 Ga0439466_0014041
640 Ga0439466_0031131
641 Ga0439431_0003418
642 Ga0439437_000096
643 Ga0439432_000025
644 Ga0439432_011151
645 Ga0439432_020094
646 Ga0439432_020717
647 Ga0439432_024088
648 Ga0439452_000155
649 Ga0439452_005043
650 Ga0439452_041699
651 Ga0439456_001031
652 Ga0450911_000007
653 Ga0450913_001782
654 Ga0450894_002072
655 Ga0450898_000017
656 Ga0450899_003376
657 Ga0439446_0000014
658 Ga0439446_0001805
659 Ga0439446_0022668
660 Ga0439434_0006003
661 Ga0439459_0004302
662 Ga0439464_0040481
663 Ga0450916_000020
664 Ga0450916_002541
665 Ga0450893_0000299
666 Ga0451577_0000395
667 Ga0451577_0319831
668 Ga0466969_0016994
669 Ga0466961_0005920
670 Ga0453684_0000354
671 Ga0453684_0001464
672 Ga0453684_0001598
673 Ga0453684_0291227
674 Ga0453684_0791515
675 Ga0453684_0923786
676 Ga0453684_1160364
677 Ga0466959_0176299
678 Ga0451576_0000013
679 Ga0451576_0195917
680 Ga0495617_012890
681 Ga0495617_038755
682 Ga0495627_000009
683 Ga0495627_024961
684 Ga0495591_000002
685 Ga0495591_006456
686 Ga0495591_013161
687 Ga0495650_0010305
688 Ga0495605_0000007
689 Ga0495605_0001110
690 Ga0495605_0001750
691 Ga0495605_0005366
692 Ga0495605_0075218
693 Ga0495584_0000134
694 Ga0495584_0001249
695 Ga0495584_0074378
696 Ga0495607_0000045
697 Ga0495607_0002449
698 Ga0495607_0004589
699 Ga0495607_0006369
700 Ga0495583_0000007
701 Ga0495606_0003629
702 Ga0495606_0015798
703 Ga0495606_0091505
704 Ga0495610_0026211
705 Ga0495610_0105880
706 Ga0495616_0004719
707 Ga0495620_0000014
708 Ga0495620_0012299
709 Ga0495631_0000733
710 Ga0495631_0066536
711 Ga0495632_0013988
712 Ga0495637_0013802
713 Ga0495637_0014617
714 Ga0495637_0034998
715 Ga0495643_0002331
716 Ga0495648_0033129
717 Ga0495654_0004087
718 Ga0495654_0009834
719 Ga0495609_0000004
720 Ga0495609_0062141
721 Ga0495597_0000023
722 Ga0495633_0000135
723 Ga0495633_0001755
724 Ga0495668_0083309
725 Ga0495611_0001820
726 Ga0495625_0004716
727 Ga0495625_0123207
728 Ga0495661_0000106
729 Ga0495661_0057454
730 Ga0495661_0107847
731 Ga0495671_0000212
732 Ga0495671_0010183
733 Ga0495671_0052163
734 Ga0495649_0000030
735 Ga0495649_0054362
736 Ga0495589_0000966
737 Ga0495589_0117649
738 Ga0495660_0000560
739 Ga0495660_0001006
740 Ga0495660_0191247
741 Ga0495672_0001668
742 Ga0495672_0101301
743 Ga0495683_0000004
744 Ga0495683_0000924
745 Ga0495679_006593
746 Ga0495673_0000198
747 Ga0495673_0000400
748 Ga0495673_0005159
749 Ga0495681_0002504
750 Ga0495686_0090922
751 Ga0495626_0000355
752 Ga0496117_0013153
753 Ga0496118_0014910
754 Ga0496120_0034130
755 Ga0496121_0192983
756 Ga0496122_0012130
757 Ga0496122_0054517
758 Ga0496122_0107874
759 Ga0496123_0043768
760 Ga0496123_0046916
761 Ga0496124_0000035
762 Ga0496124_0004476
763 Ga0496124_0025869
764 Ga0496124_0040811
765 Ga0496125_0002115
766 Ga0496125_0011521
767 Ga0496125_0017443
768 Ga0496125_0018446
769 Ga0496126_0002105
770 Ga0496126_0002519
771 Ga0496126_0058687
772 Ga0496126_0221759
773 Ga0495678_000014
774 Ga0495678_001501
775 Ga0495678_001568
776 Ga0495682_0009853
777 Ga0501033_0201011
778 Ga0501034_0059282
779 Ga0501038_0104416
780 Ga0501209_000080
781 Ga0501226_000022
782 nmdc:mga07m45_128063_c1
783 Ga0500650_0000319
784 Ga0500595_025070
785 2510285165
786 2510293998
787 2510313032
788 2511824277
789 2511825545
790 2599399792
791 2599454492
792 2599515665
793 2599522228
794 2599611142
795 2599614262
796 2599768696
797 2599770036
798 2599880711
799 2599881515
800 2599884450
801 2599887360
802 2599895043
803 2599896371
804 2599898475
805 2599932835
806 2599941370
807 2599942591
808 2599946486
809 2599949762
810 2599953110
811 2599953340
812 2599958278
813 2599958934
814 2599964110
815 2599968988
816 2599976408
817 2599980245
818 2599982486
819 2599982637
820 2599989762
821 2599992218
822 2599994476
823 2599998658
824 2599999321
825 2600003657
826 2600006072
827 2600009445
828 2600009820
829 2600015980
830 2600017222
831 2600023411
832 2600028319
833 2600029359
834 2600035680
835 2600036147
836 2600040852
837 2600044954
838 2600047156
839 2600047338
840 2600051186
841 2600052045
842 2600057084
843 2600059650
844 2600064995
845 2600065804
846 2600069292
847 2600069737
848 2600077432
849 2600357232
850 2600358734
851 2621300618
852 2621300632
853 2643870209
854 2644222526
855 2644280958
856 2644284751
857 2652546378
858 2671089066
859 2671090967
860 2671124715
861 2671126729
862 2677899705
863 2678263992
864 2738673282
865 2738673296
866 2738687836
867 2738751675
868 2738751689
869 2738806168
870 2738810702
871 2738860716
872 2738860730
873 2738893528
874 2738898062
875 2739263729
876 2745004448
877 2774128256
878 2794597879
879 2808854800
880 2808855269
881 2808922991
882 2808925155
883 2808935005
884 2808935155
885 2808943507
886 2808945135
887 2808947239
888 2808960974
889 2808963402
890 2808963774
891 2808980311
892 2808980664
893 2808996032
894 2808996385
895 2808998193
896 2808998662
897 2817490108
898 2817490122
899 2825652419
900 2825657229
901 2842859924
902 2852613907
903 2852614675
904 2852660167
905 2852667587
906 2852668357
907 2894514560
908 2913039079
909 2913039167
910 2917835387
911 2919129276
912 2919456751
913 2919485182
914 2923586681
915 2929146443
916 2931369885
917 2931395662
918 2947237176
919 2974299587
920 2984501943
921 2984504561
922 2988729558
923 3007422433
924 3007422447
925 3007869823
926 8016733628
927 8054290904
928 8056145462

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03705

CheR_N

CheR methyltransferase, all-alpha domain

51

103

0.96

PF01739

CheR

CheR methyltransferase, SAM binding domain

118

307

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1bc5-assembly1.cif.gz_A chemotaxis receptor recognition by protein methyltransferase cher 0.9237 14 278
5xlx-assembly1.cif.gz_D crystal structure of the c-terminal domain of cher1 containing sah 0.9139 88 278
1bc5-assembly1.cif.gz_A chemotaxis receptor recognition by protein methyltransferase cher 0.9073 14 278
5xlx-assembly1.cif.gz_D crystal structure of the c-terminal domain of cher1 containing sah 0.8661 88 278
5ftw-assembly1.cif.gz_A crystal structure of glutamate o-methyltransferase in complex with s- adenosyl-l-homocysteine (sah) from bacillus subtilis 0.8239 20 278
ID Description Score Start End Superfamily
1af7A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9396 85 278 3.40.50.150
1af7A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.935 85 278 3.40.50.150
5ftwA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9115 86 278 3.40.50.150
5ftwA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9024 86 278 3.40.50.150
1bc5A01 Mainly Alpha;Orthogonal Bundle;Chemotaxis Receptor Methyltransferase Cher; domain 1;Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.8978 14 84 1.10.155.10
ID Description Score Start End GO Terms
AF-A0A3M5LP99-F1-model_v4 Chemotaxis protein methyltransferase CheR 0.9934 104 278 GO:0008757
GO:0009288
GO:0032259
AF-A0A1J5PH97-F1-model_v4 Chemotaxis protein methyltransferase (EC 2.1.1.80) 0.9867 134 278 GO:0008983
GO:0032259
AF-A0A349L650-F1-model_v4 SAM-dependent methyltransferase 0.9831 109 278 GO:0008757
GO:0032259
AF-A0A080M6H3-F1-model_v4 Chemotaxis protein methyltransferase (EC 2.1.1.80) 0.9823 131 278 GO:0008983
GO:0032259
AF-A0A8B3G486-F1-model_v4 protein-glutamate O-methyltransferase (EC 2.1.1.80) 0.9804 15 243 GO:0008757
GO:0032259

Map