metagRoot

F449495

General Info

Members	Datasets	Scaffolds	Average Seq Length
465	339	394	328

Family's Representative Sequence

Representative Sequence	3300025923\|Ga0207681_10133616\|Ga0207681_101336162
Length	360
Sequence	MGAPTTAIALCTWNGERFLPAQLDSLLAQTQPPDEIVVTDDASTDGSWTLLSGGFPAYAGARVTVLDKLTYSGNRDNLAPVADDPNLTFVTGDICDAGLVGDLMRGHDAVVHFAAESHVDRSIAGAGPFVTTNVVGTQVLLDAARAAGIGRFLHVSTDEVYGSIAEGSWTEDWPLAPNSPYAASKAGSDLLALAYHRTHGLDLVVTRCSNNYGPYQFPEKVIPLFVTNLLDGRRVPLYGDGGNIRDWLHVSDHCAGIQLALEKGRAGEVYHIGGGEELTNKELTQQLLDACGRSWDDSVEYVTDRLGHDRRYSLSIEKIQNELGYVPAVPFARGIADTVAWYRDNRAWWEPLKARAGLDK

Samples

	Sample ID	Description	Type	Environment
1	2501939600	Micromonospora sp. L5	Isolate	Unclassified
2	2547132111	Streptomyces sp. TOR3209	Isolate	Rhizosphere
3	2582581313	Streptomyces mirabilis OV308	Isolate	Rhizosphere
4	2616644814	Streptomyces mirabilis OK461	Isolate	Rhizosphere
5	2622736626	Micromonospora rhizosphaerae DSM 45431	Isolate	Rhizosphere
6	2643221601	Kitasatospora sp. Root187	Isolate	Unclassified
7	2643221631	Kitasatospora sp. Root107	Isolate	Unclassified
8	2643221647	Streptomyces sp. Root369	Isolate	Unclassified
9	2643221714	Streptomyces sp. Root264	Isolate	Unclassified
10	2751185782	Actinoplanes subtropicus NRRL B-24665	Isolate	Rhizosphere
11	2772190715	Micromonospora chokoriensis NRRL B-24750	Isolate	Unclassified
12	2784746768	Streptomyces griseorubiginosus SAI-142	Isolate	Unclassified
13	2786546132	Streptomyces sp. W SAI-097	Isolate	Unclassified
14	2811994917	Streptomyces sp. SLBN-134	Isolate	Unclassified
15	2818991472	Kitasatospora viridis DSM 44826	Isolate	Rhizosphere
16	2831935698	Jishengella sp. AZ1-13	Isolate	Unclassified
17	2855670206	Micromonospora noduli Lupac 07	Isolate	Nodule
18	2855676851	Micromonospora saelicesensis GAR05	Isolate	Unclassified
19	2855683550	Micromonospora sp. RP3T	Isolate	Unclassified
20	2856858025	Micromonospora aurantiaca 110B(2018)	Isolate	Unclassified
21	2857288857	Micromonospora noduli ONO23	Isolate	Unclassified
22	2858848962	Micromonospora saelicesensis GAR06	Isolate	Unclassified
23	2858882152	Micromonospora noduli MED15	Isolate	Nodule
24	2858888857	Micromonospora saelicesensis Lupac 06	Isolate	Unclassified
25	2858895516	Micromonospora saelicesensis PSN13	Isolate	Unclassified
26	2862281513	Streptomyces sp. Act143	Isolate	Rhizosphere
27	2862290372	Streptomyces triticagri NEAU-YY421	Isolate	Rhizosphere
28	2862574272	Streptomyces sp. AcE210	Isolate	Nodule
29	2867312974	Micromonospora musae NGC1-4	Isolate	Unclassified
30	2867319477	Micromonospora musae MS1-9	Isolate	Unclassified
31	2867346516	Streptomyces radicis AZ1-7	Isolate	Unclassified
32	2867428634	Streptomyces sp. RP5T	Isolate	Unclassified
33	2867507094	Micromonospora zingiberis PLAI 1-1	Isolate	Unclassified
34	2868088558	Phytoactinopolyspora endophytica EGI 60009	Isolate	Unclassified
35	2869048445	Micromonospora saelicesensis PSN01	Isolate	Unclassified
36	2869061728	Micromonospora noduli ONO86	Isolate	Unclassified
37	2869068681	Micromonospora noduli GUI43	Isolate	Unclassified
38	2877676314	Streptomyces griseorubiginosus 3E-1	Isolate	Unclassified
39	2880489317	Micromonospora ureilytica DSM 101692	Isolate	Unclassified
40	2880495981	Micromonospora vinacea DSM 101695	Isolate	Unclassified
41	2912723979	Streptomyces sp. NEAU-sy36	Isolate	Rhizosphere
42	2929219909	Micromonospora sp. R-75348 Hybrid assembly	Isolate	Unclassified
43	2929226422	Micromonospora sp. R-74116 Hybrid assembly	Isolate	Unclassified
44	2946072368	Streptomyces achromogenes W4I19-2	Isolate	Rhizosphere
45	2954380949	Streptomyces ciscaucasicus W1I15	Isolate	Rhizosphere
46	2954673503	Streptomyces sp. SAI-119	Isolate	Rhizosphere
47	2954682443	Streptomyces sp. SAI-149	Isolate	Rhizosphere
48	2954691527	Streptomyces sp. SAI-127	Isolate	Rhizosphere
49	2954701450	Streptomyces sp. SAI-144	Isolate	Rhizosphere
50	2954711539	Streptomyces sp. SAI-090	Isolate	Rhizosphere
51	2954721474	Streptomyces sp. SAI-117	Isolate	Rhizosphere
52	2954731030	Streptomyces sp. SAI-133	Isolate	Rhizosphere
53	2954740390	Streptomyces sp. SAI-041	Isolate	Rhizosphere
54	2954749733	Streptomyces sp. SAI-135	Isolate	Rhizosphere
55	2954759201	Streptomyces sp. SAI-208	Isolate	Rhizosphere
56	2995463766	Streptacidiphilus fuscans NEAU-YB345	Isolate	Unclassified
57	3006321560	Actinacidiphila epipremni PRB2-1	Isolate	Unclassified
58	3006486233	Streptomyces sp. BR123	Isolate	Rhizosphere
59	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
60	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
61	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
62	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
63	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
64	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
65	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
66	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
67	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
68	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
69	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
70	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
71	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
72	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
73	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
74	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
75	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
76	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
77	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
78	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
79	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
80	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
81	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
82	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
83	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
84	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
85	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
86	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
87	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
88	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
89	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
90	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
91	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
92	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
93	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
94	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
95	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
96	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
97	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
98	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
99	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
100	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
101	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
102	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
103	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
104	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
105	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
106	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
107	3300009993	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG	Metagenome	Rhizosphere
108	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
109	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
110	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
111	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
112	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
113	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
114	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
115	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
116	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
117	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
118	3300015688	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01	Metagenome	Rhizosphere
119	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
120	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
121	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
122	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
151	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
154	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
155	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
156	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
157	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
158	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
159	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
160	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
161	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
162	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
163	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
164	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
165	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
166	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
167	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
168	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
169	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
170	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
171	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
172	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
173	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
174	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
175	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
176	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
177	3300031889	Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO	Metagenome	Rhizosphere
178	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
179	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
180	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
181	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
182	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
183	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
184	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
185	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
186	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
187	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
188	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
189	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
190	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
191	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
192	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
193	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
194	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
195	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
196	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
197	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
198	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
199	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
200	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
201	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
202	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
203	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
204	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
205	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
206	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
207	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
208	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
209	3300042138	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379	Metagenome	Rhizosphere
210	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
211	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
212	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
213	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
214	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
215	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
216	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
217	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
218	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
219	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
220	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
221	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
222	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
223	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
224	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
225	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
226	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
227	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
228	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
229	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
230	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
231	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
232	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
233	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
234	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
235	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
236	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
237	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
238	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
239	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
240	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
241	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
242	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
243	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
244	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
245	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
246	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
247	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
248	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
249	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
250	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
251	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
252	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
253	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
254	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
255	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
256	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
257	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
258	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
259	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
260	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
261	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
262	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
263	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
264	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
265	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
266	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
267	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
268	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
269	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
270	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
271	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
272	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
273	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
274	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
275	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
276	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
277	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
278	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
279	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
280	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
281	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
282	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
283	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
284	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
285	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
286	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
287	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
288	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
289	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
290	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
291	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
292	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
293	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
294	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
295	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
296	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
297	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
298	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
299	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
300	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
301	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
302	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
303	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
304	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
305	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
306	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
307	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
308	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
309	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
310	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
311	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
312	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
313	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
314	3300053099	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere	Metagenome	Endosphere
315	3300053100	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere	Metagenome	Endosphere
316	3300053107	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere	Metagenome	Endosphere
317	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
318	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
319	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
320	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
321	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
322	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
323	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
324	3300053739	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere	Metagenome	Endosphere
325	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
326	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
327	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
328	649633069	Micromonospora sp. L5	Isolate	Unclassified
329	8001781756	Catellatospora tritici NEAU-YM18	Isolate	Rhizosphere
330	8003830390	Micromonospora parastrephiae STR1_7	Isolate	Rhizosphere
331	8003870546	Micromonospora tarensis STR1s_6	Isolate	Rhizosphere
332	8008558824	Streptomyces scabiei NRRL B-2795	Isolate	Nodule
333	8025530807	Streptomyces sp. 4R-3d	Isolate	Unclassified
334	8048369669	Streptomyces indonesiensis DSM 41759	Isolate	Rhizoplane
335	8048379754	Streptomyces asiaticus DSM 41761	Isolate	Rhizosphere
336	8054704163	Micromonospora trifolii NIE79	Isolate	Nodule
337	8054727385	Micromonospora alfalfae MED01	Isolate	Nodule
338	8054734606	Micromonospora hortensis NIE111	Isolate	Nodule
339	8057568493	Actinorhabdospora filicis NBRC 111898	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	84.3
Metatranscriptomes	0.43
Isolates	15.27

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	5.38
Nodule	1.72
Rhizoplane	1.29
Rhizosphere	78.28
Stem	0
Stem Tuber	0
Unclassified	13.33

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25406J46586_10001222	3300003203	Bacteria	12084
2	Ga0070658_10016299	3300005327	Bacteria	5946
3	Ga0070658_10048536	3300005327	Bacteria	3437
4	Ga0070683_100014550	3300005329	Bacteria	6888
5	Ga0070683_100126805	3300005329	Bacteria	2413
6	Ga0070670_100085953	3300005331	Bacteria	2703
7	Ga0068869_100046811	3300005334	Bacteria	3120
8	Ga0070680_100002285	3300005336	Bacteria	14175
9	Ga0068868_100032552	3300005338	Bacteria	4012
10	Ga0070661_100007725	3300005344	Bacteria	7428
11	Ga0070692_10012742	3300005345	Bacteria	3903
12	Ga0070675_100079513	3300005354	Bacteria	2732
13	Ga0070713_100095643	3300005436	Bacteria	2563
14	Ga0070713_100454196	3300005436	Bacteria	1204
15	Ga0070700_100065233	3300005441	Bacteria	2308
16	Ga0070663_100058738	3300005455	Bacteria	2763
17	Ga0070678_100492150	3300005456	Bacteria	1081
18	Ga0070662_100029464	3300005457	Bacteria	3831
19	Ga0070681_10002527	3300005458	Bacteria	16771
20	Ga0070706_100001534	3300005467	Bacteria	24136
21	Ga0070679_100002750	3300005530	Bacteria	16011
22	Ga0070684_100019479	3300005535	Bacteria	5613
23	Ga0070684_100054483	3300005535	Bacteria	3485
24	Ga0070684_100063570	3300005535	Bacteria	3236
25	Ga0070695_100305729	3300005545	Bacteria	1177
26	Ga0070665_100134276	3300005548	Bacteria	2476
27	Ga0070664_100000503	3300005564	Bacteria	29613
28	Ga0070664_100041671	3300005564	Bacteria	3875
29	Ga0068857_100084876	3300005577	Bacteria	2830
30	Ga0068856_100137985	3300005614	Bacteria	2445
31	Ga0068852_100268890	3300005616	Bacteria	1640
32	Ga0068859_100031223	3300005617	Bacteria	5347
33	Ga0068864_100003600	3300005618	Bacteria	12807
34	Ga0068870_10027874	3300005840	Bacteria	2830
35	Ga0068858_100035451	3300005842	Bacteria	4627
36	Ga0068858_100069684	3300005842	Bacteria	3260
37	Ga0068858_100168917	3300005842	Bacteria	2062
38	Ga0068860_100026122	3300005843	Bacteria	5632
39	Ga0068860_100063901	3300005843	Bacteria	3496
40	Ga0068860_100309824	3300005843	Bacteria	1548
41	Ga0081538_10000803	3300005981	Bacteria	34049
42	Ga0081539_10000197	3300005985	Bacteria	140516
43	Ga0081539_10001345	3300005985	Bacteria	42808
44	Ga0081539_10003855	3300005985	Bacteria	17585
45	Ga0081539_10006323	3300005985	Bacteria	11433
46	Ga0081539_10016837	3300005985	Bacteria	5184
47	Ga0081539_10079674	3300005985	Bacteria	1725
48	Ga0070717_10092364	3300006028	Bacteria	2557
49	Ga0075365_10051029	3300006038	Bacteria	2731
50	Ga0075363_100048157	3300006048	Bacteria	2265
51	Ga0075364_10104696	3300006051	Bacteria	1885
52	Ga0075367_10199874	3300006178	Bacteria	1249
53	Ga0075428_100068601	3300006844	Bacteria	3879
54	Ga0075430_100026597	3300006846	Bacteria	4920
55	Ga0075434_100390747	3300006871	Bacteria	1412
56	Ga0075429_100075430	3300006880	Bacteria	2937
57	Ga0068865_100226624	3300006881	Bacteria	1464
58	Ga0097620_100031223	3300006931	Bacteria	5347
59	Ga0099826_10009602	3300006948	Bacteria	7223
60	Ga0111539_10001711	3300009094	Bacteria	29199
61	Ga0111539_10074757	3300009094	Bacteria	3993
62	Ga0114129_10000056	3300009147	Bacteria	99329
63	Ga0114129_10005255	3300009147	Bacteria	18253
64	Ga0114129_10134095	3300009147	Bacteria	3399
65	Ga0105243_10077531	3300009148	Bacteria	2703
66	Ga0105243_10506543	3300009148	Bacteria	1145
67	Ga0105238_10337177	3300009551	Bacteria	1495
68	Ga0105028_101432	3300009993	Bacteria	2519
69	Ga0105239_10030719	3300010375	Bacteria	5909
70	Ga0105246_10196346	3300011119	Bacteria	1566
71	Ga0105246_10238408	3300011119	Bacteria	1436
72	Ga0157374_10225526	3300013296	Bacteria	1840
73	Ga0157374_10292179	3300013296	Bacteria	1611
74	Ga0157372_10099229	3300013307	Bacteria	3322
75	Ga0157375_10345891	3300013308	Bacteria	1652
76	Ga0163163_10004916	3300014325	Bacteria	11492
77	Ga0182008_10000456	3300014497	Bacteria	31212
78	Ga0157377_10007005	3300014745	Bacteria	5415
79	Ga0157376_10424191	3300014969	Bacteria	1292
80	Ga0182007_10000656	3300015262	Bacteria	19842
81	Ga0183367_1006	3300015688	Bacteria	648044
82	Ga0206354_10780326	3300020081	Bacteria	7709
83	Ga0206353_11002918	3300020082	Bacteria	6103
84	Ga0207426_1000602	3300025302	Bacteria	47055
85	Ga0207688_10067563	3300025901	Bacteria	2023
86	Ga0207647_10013244	3300025904	Bacteria	5724
87	Ga0207647_10014327	3300025904	Bacteria	5467
88	Ga0207645_10150789	3300025907	Bacteria	1517
89	Ga0207705_10004702	3300025909	Bacteria	10295
90	Ga0207684_10011499	3300025910	Bacteria	7737
91	Ga0207707_10000831	3300025912	Bacteria	30306
92	Ga0207660_10001113	3300025917	Bacteria	17951
93	Ga0207649_10010256	3300025920	Bacteria	5143
94	Ga0207652_10003418	3300025921	Bacteria	13100
95	Ga0207681_10133616	3300025923	Bacteria	1838
96	Ga0207650_10099310	3300025925	Bacteria	2238
97	Ga0207659_10001895	3300025926	Bacteria	12400
98	Ga0207700_10094672	3300025928	Bacteria	2367
99	Ga0207664_10000712	3300025929	Bacteria	22620
100	Ga0207706_10017035	3300025933	Bacteria	6556
101	Ga0207709_10009879	3300025935	Bacteria	5254
102	Ga0207704_10047480	3300025938	Bacteria	2567
103	Ga0207689_10004248	3300025942	Bacteria	13027
104	Ga0207661_10008094	3300025944	Bacteria	7499
105	Ga0207661_10090767	3300025944	Bacteria	2544
106	Ga0207679_10023934	3300025945	Bacteria	4182
107	Ga0207679_10053326	3300025945	Bacteria	2971
108	Ga0207677_10005815	3300026023	Bacteria	6712
109	Ga0207703_10064880	3300026035	Bacteria	2999
110	Ga0207678_10008656	3300026067	Bacteria	8967
111	Ga0207702_10072494	3300026078	Bacteria	2969
112	Ga0207676_10029756	3300026095	Bacteria	4092
113	Ga0207675_100074327	3300026118	Bacteria	3180
114	Ga0207683_10171405	3300026121	Bacteria	1965
115	Ga0207698_10013097	3300026142	Bacteria	5460
116	Ga0207428_10015567	3300027907	Bacteria	6573
117	Ga0207428_10021205	3300027907	Bacteria	5503
118	Ga0268265_10247992	3300028380	Bacteria	1575
119	Ga0268264_10035368	3300028381	Bacteria	4112
120	Ga0268264_10079663	3300028381	Bacteria	2795
121	Ga0268264_10404283	3300028381	Bacteria	1313
122	Ga0265322_10026552	3300028654	Bacteria	1655
123	Ga0307517_10002997	3300028786	Bacteria	26707
124	Ga0307517_10136335	3300028786	Bacteria	1744
125	Ga0307515_10000229	3300028794	Bacteria	139040
126	Ga0307515_10102488	3300028794	Bacteria	3442
127	Ga0307515_10286534	3300028794	Bacteria	1348
128	Ga0265338_10013894	3300028800	Bacteria	9038
129	Ga0307511_10021126	3300030521	Bacteria	6146
130	Ga0307512_10002657	3300030522	Bacteria	22066
131	Ga0265330_10045945	3300031235	Bacteria	1925
132	Ga0265320_10025982	3300031240	Bacteria	3072
133	Ga0265325_10000922	3300031241	Bacteria	21220
134	Ga0265340_10003444	3300031247	Bacteria	8928
135	Ga0265339_10007897	3300031249	Bacteria	6828
136	Ga0307513_10001973	3300031456	Bacteria	29050
137	Ga0307513_10008036	3300031456	Bacteria	13553
138	Ga0307513_10018707	3300031456	Bacteria	8272
139	Ga0307513_10127210	3300031456	Bacteria	2501
140	Ga0307509_10021671	3300031507	Bacteria	7260
141	Ga0307408_100085901	3300031548	Bacteria	2364
142	Ga0307408_100105349	3300031548	Bacteria	2156
143	Ga0307408_100255169	3300031548	Bacteria	1448
144	Ga0265313_10016844	3300031595	Bacteria	4186
145	Ga0307508_10003716	3300031616	Bacteria	15280
146	Ga0307508_10008803	3300031616	Bacteria	9315
147	Ga0307514_10003844	3300031649	Bacteria	14127
148	Ga0307514_10088421	3300031649	Bacteria	2267
149	Ga0265314_10082348	3300031711	Bacteria	2117
150	Ga0265342_10014657	3300031712	Bacteria	5196
151	Ga0316576_10010444	3300031727	Bacteria	6032
152	Ga0316576_10079420	3300031727	Bacteria	2432
153	Ga0316576_10101829	3300031727	Bacteria	2147
154	Ga0316578_10009501	3300031728	Bacteria	5005
155	Ga0307516_10000185	3300031730	Bacteria	80941
156	Ga0307516_10001550	3300031730	Bacteria	31620
157	Ga0307516_10015822	3300031730	Bacteria	7918
158	Ga0307405_10015273	3300031731	Bacteria	4155
159	Ga0307410_10109951	3300031852	Bacteria	1993
160	Ga0326468_10003174	3300031889	Bacteria	1384
161	Ga0307406_10004776	3300031901	Bacteria	7382
162	Ga0307406_10017200	3300031901	Bacteria	4209
163	Ga0307406_10114012	3300031901	Bacteria	1866
164	Ga0307406_10128855	3300031901	Bacteria	1773
165	Ga0307406_10196459	3300031901	Bacteria	1481
166	Ga0307407_10022662	3300031903	Bacteria	3264
167	Ga0307407_10099145	3300031903	Bacteria	1804
168	Ga0307409_100000394	3300031995	Bacteria	18541
169	Ga0307409_100172066	3300031995	Bacteria	1907
170	Ga0307409_100172278	3300031995	Bacteria	1906
171	Ga0307416_100003533	3300032002	Bacteria	9211
172	Ga0307414_10474068	3300032004	Bacteria	1103
173	Ga0307411_10052308	3300032005	Bacteria	2670
174	Ga0307411_10130535	3300032005	Bacteria	1836
175	Ga0307415_100000418	3300032126	Bacteria	18196
176	Ga0307415_100047388	3300032126	Bacteria	2893
177	Ga0307415_100122358	3300032126	Bacteria	1954
178	Ga0307507_10111667	3300033179	Bacteria	2230
179	Ga0307507_10129538	3300033179	Bacteria	1981
180	Ga0307510_10032010	3300033180	Bacteria	5932
181	Ga0307510_10079901	3300033180	Bacteria	3184
182	Ga0373938_0003603	3300034957	Bacteria	2552
183	Ga0373940_0026947	3300035088	Bacteria	1507
184	Ga0373951_0000135	3300035091	Bacteria	27809
185	Ga0373932_0026284	3300035112	Bacteria	1582
186	Ga0373941_0032946	3300035115	Bacteria	1554
187	Ga0373942_0000677	3300035207	Bacteria	9506
188	Ga0373962_0022383	3300035242	Bacteria	1675
189	Ga0316574_0058594	3300035398	Bacteria	2413
190	Ga0316582_0269263	3300036647	Bacteria	1169
191	Ga0316584_0005567	3300036712	Bacteria	8476
192	Ga0316584_0324103	3300036712	Bacteria	1111
193	Ga0395899_0119588	3300037312	Bacteria	1888
194	Ga0395900_0076155	3300037418	Bacteria	3449
195	Ga0395900_0195027	3300037418	Bacteria	2052
196	Ga0395900_0229001	3300037418	Bacteria	1870
197	Ga0395898_0035966	3300037466	Bacteria	4922
198	Ga0395898_0059599	3300037466	Bacteria	3712
199	Ga0395905_0182353	3300037471	Bacteria	1971
200	Ga0436364_1025652	3300037853	Bacteria	1729
201	Ga0395901_0009208	3300038443	Bacteria	10003
202	Ga0451837_0025921	3300041494	Bacteria	3066
203	Ga0451853_2406245	3300041512	Bacteria	1288
204	Ga0439433_0003932	3300041999	Bacteria	3197
205	Ga0439448_0006620	3300042005	Bacteria	3335
206	Ga0439449_0021260	3300042007	Bacteria	2429
207	Ga0439457_002029	3300042014	Bacteria	5942
208	Ga0450903_001347	3300042138	Bacteria	4591
209	Ga0439458_0010963	3300042157	Bacteria	2023
210	Ga0466969_0006439	3300044656	Bacteria	6249
211	Ga0466969_0011890	3300044656	Bacteria	4602
212	Ga0466972_0000862	3300044658	Bacteria	14558
213	Ga0466966_0001833	3300044684	Bacteria	13783
214	Ga0466966_0002574	3300044684	Bacteria	11882
215	Ga0466966_0018684	3300044684	Bacteria	4567
216	Ga0466961_0005669	3300044693	Bacteria	7894
217	Ga0466961_0127991	3300044693	Bacteria	1592
218	Ga0466963_0001528	3300044694	Bacteria	12528
219	Ga0466963_0089043	3300044694	Bacteria	2099
220	Ga0466963_0175758	3300044694	Bacteria	1494
221	Ga0466963_0270109	3300044694	Bacteria	1195
222	Ga0453684_0000100	3300044712	Bacteria	368331
223	Ga0466971_0007810	3300044719	Bacteria	4661
224	Ga0466970_0014045	3300044765	Bacteria	4106
225	Ga0466957_0014082	3300044842	Bacteria	4653
226	Ga0466960_0001987	3300044901	Bacteria	7580
227	Ga0466959_0073858	3300045049	Bacteria	2466
228	Ga0466959_0137581	3300045049	Bacteria	1728
229	Ga0466959_0169737	3300045049	Bacteria	1530
230	Ga0466958_0000423	3300045836	Bacteria	17436
231	Ga0466958_0027658	3300045836	Bacteria	3357
232	Ga0466967_0001622	3300045976	Bacteria	13281
233	Ga0466967_0019784	3300045976	Bacteria	5423
234	Ga0466967_0036351	3300045976	Bacteria	4204
235	Ga0495603_0000651	3300046455	Bacteria	19603
236	Ga0495590_0017039	3300046457	Bacteria	2620
237	Ga0495629_0013527	3300046459	Bacteria	5887
238	Ga0495629_0027691	3300046459	Bacteria	4024
239	Ga0495629_0126527	3300046459	Bacteria	1780
240	Ga0495629_0178028	3300046459	Bacteria	1474
241	Ga0495638_0084123	3300046460	Bacteria	1926
242	Ga0495641_0029932	3300046461	Bacteria	2618
243	Ga0495651_0278433	3300046462	Bacteria	1131
244	Ga0495650_0012670	3300046471	Bacteria	4519
245	Ga0495605_0012509	3300046474	Bacteria	4705
246	Ga0495662_0089643	3300046476	Bacteria	1499
247	Ga0495585_0033813	3300046492	Bacteria	2892
248	Ga0495594_0008905	3300046499	Bacteria	5175
249	Ga0495594_0018216	3300046499	Bacteria	3717
250	Ga0495594_0049782	3300046499	Bacteria	2303
251	Ga0495594_0050894	3300046499	Bacteria	2279
252	Ga0495596_0037339	3300046500	Bacteria	1921
253	Ga0495607_0003207	3300046501	Bacteria	12634
254	Ga0495583_0013336	3300046506	Bacteria	4588
255	Ga0495606_0012756	3300046507	Bacteria	6700
256	Ga0495606_0121599	3300046507	Bacteria	1562
257	Ga0495608_0144621	3300046511	Bacteria	1517
258	Ga0495610_0012493	3300046512	Bacteria	5106
259	Ga0495616_0016355	3300046513	Bacteria	4108
260	Ga0495616_0031917	3300046513	Bacteria	2755
261	Ga0495620_0075382	3300046515	Bacteria	1372
262	Ga0495628_0078459	3300046516	Bacteria	2568
263	Ga0495628_0079861	3300046516	Bacteria	2543
264	Ga0495632_0063194	3300046519	Bacteria	1793
265	Ga0495637_0052527	3300046520	Bacteria	1701
266	Ga0495637_0085207	3300046520	Bacteria	1254
267	Ga0495643_0002222	3300046522	Bacteria	15767
268	Ga0495643_0006737	3300046522	Bacteria	7518
269	Ga0495666_0012223	3300046526	Bacteria	4281
270	Ga0495666_0056992	3300046526	Bacteria	1870
271	Ga0495640_0005138	3300046533	Bacteria	10402
272	Ga0495609_0079685	3300046538	Bacteria	1432
273	Ga0495597_0088487	3300046542	Bacteria	1317
274	Ga0495622_0000660	3300046557	Bacteria	19531
275	Ga0495622_0058485	3300046557	Bacteria	1785
276	Ga0495633_0012221	3300046558	Bacteria	4578
277	Ga0495633_0019713	3300046558	Bacteria	3406
278	Ga0495633_0120309	3300046558	Bacteria	1216
279	Ga0495668_0000696	3300046616	Bacteria	40415
280	Ga0495668_0037963	3300046616	Bacteria	2693
281	Ga0495634_0064210	3300046642	Bacteria	2434
282	Ga0495611_0008786	3300046648	Bacteria	4272
283	Ga0495625_0001767	3300046660	Bacteria	24979
284	Ga0495625_0044727	3300046660	Bacteria	3203
285	Ga0495625_0062660	3300046660	Bacteria	2628
286	Ga0495588_0021326	3300046674	Bacteria	3192
287	Ga0495657_0017481	3300046675	Bacteria	5204
288	Ga0495657_0022312	3300046675	Bacteria	4537
289	Ga0495657_0117244	3300046675	Bacteria	1680
290	Ga0495599_0127613	3300046678	Bacteria	1580
291	Ga0495599_0174969	3300046678	Bacteria	1324
292	Ga0495613_0005398	3300046689	Bacteria	9602
293	Ga0495613_0017181	3300046689	Bacteria	5387
294	Ga0495613_0086290	3300046689	Bacteria	2276
295	Ga0495613_0162495	3300046689	Bacteria	1588
296	Ga0495624_0212748	3300046690	Bacteria	1172
297	Ga0495670_0004575	3300046691	Bacteria	6786
298	Ga0495649_0116508	3300046694	Bacteria	1414
299	Ga0495589_0021533	3300046794	Bacteria	3294
300	Ga0495589_0158277	3300046794	Bacteria	1079
301	Ga0495660_0010047	3300046810	Bacteria	5505
302	Ga0495660_0056906	3300046810	Bacteria	2111
303	Ga0495581_0015145	3300047315	Bacteria	4477
304	Ga0495581_0057326	3300047315	Bacteria	2248
305	Ga0495604_0006029	3300047317	Bacteria	9618
306	Ga0495604_0008623	3300047317	Bacteria	8059
307	Ga0495636_0078238	3300047318	Bacteria	1420
308	Ga0495676_0030745	3300047321	Bacteria	4551
309	Ga0495680_0070024	3300047322	Bacteria	2675
310	Ga0495683_0017463	3300047323	Bacteria	3718
311	Ga0495683_0026934	3300047323	Bacteria	2941
312	Ga0495683_0114570	3300047323	Bacteria	1284
313	Ga0495687_002907	3300047443	Bacteria	13048
314	Ga0495687_008076	3300047443	Bacteria	6081
315	Ga0495687_024947	3300047443	Bacteria	2834
316	Ga0495687_028478	3300047443	Bacteria	2598
317	Ga0495687_041734	3300047443	Bacteria	2010
318	Ga0495687_062003	3300047443	Bacteria	1536
319	Ga0495675_0016702	3300047444	Bacteria	4641
320	Ga0495685_000265	3300047447	Bacteria	18000
321	Ga0495685_002454	3300047447	Bacteria	5810
322	Ga0495685_009751	3300047447	Bacteria	3214
323	Ga0495681_0077838	3300047470	Bacteria	1487
324	Ga0495684_0173538	3300047471	Bacteria	1602
325	Ga0495686_0031468	3300047472	Bacteria	3440
326	Ga0495686_0099839	3300047472	Bacteria	1752
327	Ga0495614_0118808	3300048089	Bacteria	1164
328	Ga0495626_0000237	3300048091	Bacteria	63826
329	Ga0496104_0018904	3300048907	Bacteria	6294
330	Ga0496109_0034820	3300048912	Bacteria	4538
331	Ga0496111_0159700	3300048914	Bacteria	1673
332	Ga0496113_0062479	3300048916	Bacteria	2812
333	Ga0496115_0376787	3300048918	Bacteria	1155
334	Ga0501032_0018893	3300049569	Bacteria	4823
335	Ga0501033_0003739	3300049570	Bacteria	12378
336	Ga0501033_0145272	3300049570	Bacteria	1713
337	Ga0501034_0023777	3300049571	Bacteria	6240
338	Ga0501034_0061278	3300049571	Bacteria	3778
339	Ga0501034_0132202	3300049571	Bacteria	2478
340	Ga0501034_0242212	3300049571	Bacteria	1749
341	Ga0501036_0002813	3300049572	Bacteria	13789
342	Ga0501036_0304357	3300049572	Bacteria	1333
343	Ga0501037_0179996	3300049573	Bacteria	1500
344	Ga0501038_0047324	3300049574	Bacteria	3726
345	Ga0501039_0007698	3300049575	Bacteria	8226
346	Ga0501043_0069880	3300049579	Bacteria	2758
347	Ga0501043_0162687	3300049579	Bacteria	1743
348	Ga0501047_0009698	3300049581	Bacteria	9104
349	Ga0501047_0056004	3300049581	Bacteria	3812
350	Ga0501070_0001036	3300049586	Bacteria	25021
351	Ga0501070_0006046	3300049586	Bacteria	10309
352	Ga0501073_0001605	3300049589	Bacteria	16747
353	Ga0501074_0022655	3300049590	Bacteria	4566
354	Ga0501074_0264239	3300049590	Bacteria	1223
355	Ga0501079_0005167	3300049741	Bacteria	9703
356	Ga0501080_0005030	3300049742	Bacteria	11780
357	Ga0501081_0081755	3300049743	Bacteria	2263
358	Ga0501035_0004118	3300049822	Bacteria	13822
359	Ga0501035_0013340	3300049822	Bacteria	7582
360	Ga0501044_0002738	3300049823	Bacteria	20044
361	Ga0501044_0002852	3300049823	Bacteria	19672
362	Ga0501044_0019323	3300049823	Bacteria	7290
363	nmdc:mga03n38_5539_c1	3300050490	Bacteria	4306
364	nmdc:mga05p37_235736_c1	3300050507	Bacteria	2203
365	nmdc:mga05p37_6335_c1	3300050507	Bacteria	13941
366	nmdc:mga09592_182431_c1	3300050508	Bacteria	1816
367	nmdc:mga0qj67_21994_c1	3300050509	Bacteria	4894
368	nmdc:mga08y16_1269_c1	3300050511	Bacteria	25037
369	nmdc:mga08y16_15945_c1	3300050511	Bacteria	7899
370	nmdc:mga0n895_422794_c1	3300050512	Bacteria	1347
371	nmdc:mga0rr50_196316_c1	3300050513	Bacteria	1656
372	Ga0500610_0109501	3300053079	Bacteria	1422
373	Ga0500644_0003497	3300053088	Bacteria	3891
374	Ga0500583_0045577	3300053092	Bacteria	2014
375	Ga0500583_0076427	3300053092	Bacteria	1611
376	Ga0500566_0069668	3300053094	Bacteria	1976
377	Ga0500641_0031155	3300053096	Bacteria	2102
378	Ga0500654_041853	3300053099	Bacteria	2590
379	Ga0500660_047901	3300053100	Bacteria	2132
380	Ga0500560_028698	3300053107	Bacteria	1664
381	Ga0500594_0012314	3300053118	Bacteria	2013
382	Ga0500614_028550	3300053123	Bacteria	1348
383	Ga0500652_009133	3300053131	Bacteria	3339
384	Ga0500658_0043604	3300053134	Bacteria	1806
385	Ga0500561_0006508	3300053137	Bacteria	2232
386	Ga0500616_0000109	3300053153	Bacteria	152604
387	Ga0500616_0000562	3300053153	Bacteria	45732
388	Ga0500616_0030040	3300053153	Bacteria	2986
389	Ga0500634_0026299	3300053161	Bacteria	3169
390	Ga0500587_005169	3300053739	Bacteria	1765
391	Ga0501084_0239422	3300054114	Bacteria	1532
392	Ga0466962_0003262	3300061719	Bacteria	7706
393	Ga0466962_0013094	3300061719	Bacteria	3990
394	Ga0530510_0104192	3300061734	Bacteria	2075

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300036647	Ga0316582_0269263	Ga0316582_0269263_29_868	268
2	3300005456	Ga0070678_100492150	Ga0070678_1004921501	287
3	3300031456	Ga0307513_10127210	Ga0307513_101272102	291
4	3300049572	Ga0501036_0304357	Ga0501036_0304357_422_1303	292
5	3300005436	Ga0070713_100454196	Ga0070713_1004541961	293
6	3300046471	Ga0495650_0012670	Ga0495650_0012670_550_1518	293
7	3300009147	Ga0114129_10134095	Ga0114129_101340951	306
8	3300005617	Ga0068859_100031223	Ga0068859_1000312233	310
9	3300006931	Ga0097620_100031223	Ga0097620_1000312233	310
10	3300009993	Ga0105028_101432	Ga0105028_1014322	312
11	3300031456	Ga0307513_10001973	Ga0307513_1000197316	315
12	3300050513	nmdc:mga0rr50_196316_c1	nmdc:mga0rr50_196316_c1_180_1136	315
13	iso_pu_bacteria	2862290372	2862296496	315
14	iso_pu_bacteria	2862574272	2862576482	315
15	iso_pu_bacteria	2818991472	2819746354	316
16	3300031727	Ga0316576_10079420	Ga0316576_100794202	317
17	3300046459	Ga0495629_0126527	Ga0495629_0126527_12_971	317
18	iso_pu_bacteria	2547132111	2547409360	317
19	iso_pu_bacteria	2616644814	2616701336	317
20	iso_pu_bacteria	2643221601	2644014461	317
21	iso_pu_bacteria	2643221631	2644175898	317
22	iso_pu_bacteria	2643221714	2644633022	317
23	iso_pu_bacteria	2946072368	2946077371	317
24	iso_pu_bacteria	3006486233	3006490537	317
25	iso_pu_bacteria	8001781756	8001782561	317
26	3300005327	Ga0070658_10048536	Ga0070658_100485363	318
27	3300005840	Ga0068870_10027874	Ga0068870_100278742	318
28	3300006038	Ga0075365_10051029	Ga0075365_100510293	318
29	3300006048	Ga0075363_100048157	Ga0075363_1000481572	318
30	3300006051	Ga0075364_10104696	Ga0075364_101046963	318
31	3300006178	Ga0075367_10199874	Ga0075367_101998742	318
32	3300031548	Ga0307408_100085901	Ga0307408_1000859013	318
33	3300031548	Ga0307408_100105349	Ga0307408_1001053492	318
34	3300031727	Ga0316576_10010444	Ga0316576_100104442	318
35	3300031852	Ga0307410_10109951	Ga0307410_101099513	318
36	3300031901	Ga0307406_10196459	Ga0307406_101964592	318
37	3300035398	Ga0316574_0058594	Ga0316574_0058594_607_1605	318
38	3300036712	Ga0316584_0005567	Ga0316584_0005567_4019_5017	318
39	3300037312	Ga0395899_0119588	Ga0395899_0119588_112_1086	318
40	3300037418	Ga0395900_0195027	Ga0395900_0195027_770_1744	318
41	3300037466	Ga0395898_0059599	Ga0395898_0059599_136_1110	318
42	3300049570	Ga0501033_0003739	Ga0501033_0003739_9234_10190	318
43	3300049571	Ga0501034_0061278	Ga0501034_0061278_1428_2396	318
44	3300049823	Ga0501044_0002738	Ga0501044_0002738_10019_10975	318
45	3300053096	Ga0500641_0031155	Ga0500641_0031155_1103_2068	318
46	3300005329	Ga0070683_100014550	Ga0070683_1000145503	319
47	3300005535	Ga0070684_100019479	Ga0070684_1000194792	319
48	3300005564	Ga0070664_100041671	Ga0070664_1000416711	319
49	3300005981	Ga0081538_10000803	Ga0081538_1000080320	319
50	3300025944	Ga0207661_10008094	Ga0207661_100080946	319
51	3300025945	Ga0207679_10053326	Ga0207679_100533261	319
52	3300031727	Ga0316576_10101829	Ga0316576_101018293	319
53	3300031728	Ga0316578_10009501	Ga0316578_100095015	319
54	3300036712	Ga0316584_0324103	Ga0316584_0324103_13_978	319
55	3300037853	Ga0436364_1025652	Ga0436364_1025652_288_1265	319
56	3300041494	Ga0451837_0025921	Ga0451837_0025921_628_1593	319
57	3300047321	Ga0495676_0030745	Ga0495676_0030745_592_1560	319
58	iso_pu_bacteria	2751185782	2753265715	319
59	iso_pu_bacteria	2867346516	2867347806	319
60	iso_pu_bacteria	8057568493	8057572527	319
61	3300005535	Ga0070684_100063570	Ga0070684_1000635701	320
62	3300005618	Ga0068864_100003600	Ga0068864_1000036005	320
63	3300005842	Ga0068858_100168917	Ga0068858_1001689173	320
64	3300005843	Ga0068860_100309824	Ga0068860_1003098242	320
65	3300009094	Ga0111539_10001711	Ga0111539_1000171122	320
66	3300014325	Ga0163163_10004916	Ga0163163_1000491611	320
67	3300026095	Ga0207676_10029756	Ga0207676_100297564	320
68	3300027907	Ga0207428_10015567	Ga0207428_100155675	320
69	3300031548	Ga0307408_100255169	Ga0307408_1002551692	320
70	3300031731	Ga0307405_10015273	Ga0307405_100152732	320
71	3300048907	Ga0496104_0018904	Ga0496104_0018904_3682_4665	320
72	3300048912	Ga0496109_0034820	Ga0496109_0034820_2098_3081	320
73	3300048914	Ga0496111_0159700	Ga0496111_0159700_38_1021	320
74	3300048916	Ga0496113_0062479	Ga0496113_0062479_177_1160	320
75	3300050511	nmdc:mga08y16_1269_c1	nmdc:mga08y16_1269_c1_21817_22854	320
76	iso_pu_bacteria	2772190715	2772646464	320
77	iso_pu_bacteria	2855670206	2855673532	320
78	iso_pu_bacteria	2855676851	2855680462	320
79	iso_pu_bacteria	2857288857	2857289859	320
80	iso_pu_bacteria	2858848962	2858852658	320
81	iso_pu_bacteria	2858882152	2858886665	320
82	iso_pu_bacteria	2858888857	2858890088	320
83	iso_pu_bacteria	2858895516	2858896221	320
84	iso_pu_bacteria	2869048445	2869052529	320
85	iso_pu_bacteria	2869061728	2869066942	320
86	iso_pu_bacteria	2869068681	2869072183	320
87	iso_pu_bacteria	2880489317	2880491499	320
88	iso_pu_bacteria	2880495981	2880500957	320
89	iso_pu_bacteria	2929226422	2929229478	320
90	iso_pu_bacteria	2995463766	2995468524	320
91	iso_pu_bacteria	8003830390	8003830795	320
92	iso_pu_bacteria	8003870546	8003871255	320
93	iso_pu_bacteria	8054704163	8054708060	320
94	iso_pu_bacteria	8054727385	8054733029	320
95	iso_pu_bacteria	8054734606	8054737768	320
96	3300005535	Ga0070684_100054483	Ga0070684_1000544832	321
97	3300005577	Ga0068857_100084876	Ga0068857_1000848761	321
98	3300005614	Ga0068856_100137985	Ga0068856_1001379852	321
99	3300009148	Ga0105243_10077531	Ga0105243_100775312	321
100	3300013307	Ga0157372_10099229	Ga0157372_100992292	321
101	3300025904	Ga0207647_10013244	Ga0207647_100132445	321
102	3300025935	Ga0207709_10009879	Ga0207709_100098794	321
103	3300026078	Ga0207702_10072494	Ga0207702_100724943	321
104	3300031730	Ga0307516_10015822	Ga0307516_100158228	321
105	3300034957	Ga0373938_0003603	Ga0373938_0003603_1187_2152	321
106	3300041512	Ga0451853_2406245	Ga0451853_2406245_100_1074	321
107	3300044684	Ga0466966_0018684	Ga0466966_0018684_1692_2765	321
108	3300044693	Ga0466961_0005669	Ga0466961_0005669_4894_5967	321
109	3300044693	Ga0466961_0127991	Ga0466961_0127991_390_1496	321
110	3300044719	Ga0466971_0007810	Ga0466971_0007810_921_1994	321
111	3300044765	Ga0466970_0014045	Ga0466970_0014045_1038_2144	321
112	3300045049	Ga0466959_0073858	Ga0466959_0073858_489_1562	321
113	3300045976	Ga0466967_0001622	Ga0466967_0001622_8584_9549	321
114	3300046457	Ga0495590_0017039	Ga0495590_0017039_655_1629	321
115	3300046462	Ga0495651_0278433	Ga0495651_0278433_29_1000	321
116	3300046499	Ga0495594_0049782	Ga0495594_0049782_1256_2227	321
117	3300046500	Ga0495596_0037339	Ga0495596_0037339_124_1098	321
118	3300046507	Ga0495606_0121599	Ga0495606_0121599_506_1480	321
119	3300046511	Ga0495608_0144621	Ga0495608_0144621_392_1363	321
120	3300046512	Ga0495610_0012493	Ga0495610_0012493_3540_4514	321
121	3300046513	Ga0495616_0016355	Ga0495616_0016355_2742_3716	321
122	3300046515	Ga0495620_0075382	Ga0495620_0075382_191_1165	321
123	3300046516	Ga0495628_0078459	Ga0495628_0078459_799_1770	321
124	3300046516	Ga0495628_0079861	Ga0495628_0079861_899_1873	321
125	3300046519	Ga0495632_0063194	Ga0495632_0063194_499_1473	321
126	3300046520	Ga0495637_0085207	Ga0495637_0085207_125_1099	321
127	3300046522	Ga0495643_0006737	Ga0495643_0006737_6448_7419	321
128	3300046526	Ga0495666_0056992	Ga0495666_0056992_129_1100	321
129	3300046533	Ga0495640_0005138	Ga0495640_0005138_4341_5312	321
130	3300046538	Ga0495609_0079685	Ga0495609_0079685_186_1160	321
131	3300046557	Ga0495622_0058485	Ga0495622_0058485_53_1027	321
132	3300046558	Ga0495633_0120309	Ga0495633_0120309_144_1118	321
133	3300046642	Ga0495634_0064210	Ga0495634_0064210_975_1946	321
134	3300046660	Ga0495625_0044727	Ga0495625_0044727_674_1648	321
135	3300046674	Ga0495588_0021326	Ga0495588_0021326_1068_2045	321
136	3300046675	Ga0495657_0017481	Ga0495657_0017481_599_1570	321
137	3300046675	Ga0495657_0022312	Ga0495657_0022312_891_1865	321
138	3300046678	Ga0495599_0174969	Ga0495599_0174969_43_1014	321
139	3300046689	Ga0495613_0005398	Ga0495613_0005398_1030_2004	321
140	3300046689	Ga0495613_0017181	Ga0495613_0017181_1074_2045	321
141	3300046690	Ga0495624_0212748	Ga0495624_0212748_84_1055	321
142	3300046694	Ga0495649_0116508	Ga0495649_0116508_304_1278	321
143	3300046810	Ga0495660_0056906	Ga0495660_0056906_162_1136	321
144	3300047315	Ga0495581_0057326	Ga0495581_0057326_871_1842	321
145	3300047317	Ga0495604_0006029	Ga0495604_0006029_5552_6529	321
146	3300047317	Ga0495604_0008623	Ga0495604_0008623_2554_3525	321
147	3300047318	Ga0495636_0078238	Ga0495636_0078238_78_1049	321
148	3300047322	Ga0495680_0070024	Ga0495680_0070024_1073_2047	321
149	3300047323	Ga0495683_0114570	Ga0495683_0114570_299_1273	321
150	3300047443	Ga0495687_008076	Ga0495687_008076_859_1833	321
151	3300047443	Ga0495687_024947	Ga0495687_024947_1759_2730	321
152	3300047443	Ga0495687_028478	Ga0495687_028478_568_1542	321
153	3300047443	Ga0495687_041734	Ga0495687_041734_73_1044	321
154	3300047444	Ga0495675_0016702	Ga0495675_0016702_29_1006	321
155	3300047447	Ga0495685_009751	Ga0495685_009751_1363_2340	321
156	3300047471	Ga0495684_0173538	Ga0495684_0173538_262_1233	321
157	3300047472	Ga0495686_0099839	Ga0495686_0099839_17_988	321
158	3300048089	Ga0495614_0118808	Ga0495614_0118808_16_987	321
159	3300061719	Ga0466962_0013094	Ga0466962_0013094_1949_3022	321
160	iso_pu_bacteria	2501939600	2501942564	321
161	iso_pu_bacteria	2582581313	2585304846	321
162	iso_pu_bacteria	2622736626	2623589855	321
163	iso_pu_bacteria	2643221647	2644269248	321
164	iso_pu_bacteria	2784746768	2785368573	321
165	iso_pu_bacteria	2786546132	2786669663	321
166	iso_pu_bacteria	2831935698	2831936030	321
167	iso_pu_bacteria	2855683550	2855689188	321
168	iso_pu_bacteria	2856858025	2856860854	321
169	iso_pu_bacteria	2867312974	2867315832	321
170	iso_pu_bacteria	2867319477	2867323701	321
171	iso_pu_bacteria	2867428634	2867431112	321
172	iso_pu_bacteria	2867507094	2867507656	321
173	iso_pu_bacteria	2868088558	2868090927	321
174	iso_pu_bacteria	2877676314	2877681963	321
175	iso_pu_bacteria	2929219909	2929223123	321
176	iso_pu_bacteria	2954380949	2954387070	321
177	iso_pu_bacteria	2954673503	2954676088	321
178	iso_pu_bacteria	2954682443	2954688078	321
179	iso_pu_bacteria	2954691527	2954697907	321
180	iso_pu_bacteria	2954701450	2954704309	321
181	iso_pu_bacteria	2954711539	2954717028	321
182	iso_pu_bacteria	2954721474	2954726976	321
183	iso_pu_bacteria	2954731030	2954734805	321
184	iso_pu_bacteria	2954740390	2954745899	321
185	iso_pu_bacteria	2954749733	2954753691	321
186	iso_pu_bacteria	2954759201	2954764870	321
187	iso_pu_bacteria	3006321560	3006321849	321
188	iso_pu_bacteria	649633069	649811604	321
189	iso_pu_bacteria	8025530807	8025531911	321
190	3300025923	Ga0207681_10133616	Ga0207681_101336162	322
191	3300033180	Ga0307510_10032010	Ga0307510_100320102	322
192	3300046476	Ga0495662_0089643	Ga0495662_0089643_495_1472	322
193	3300046675	Ga0495657_0117244	Ga0495657_0117244_559_1542	322
194	iso_pu_bacteria	2862281513	2862288154	322
195	iso_pu_bacteria	2912723979	2912730450	322
196	iso_pu_bacteria	8025530807	8025533701	322
197	iso_pu_bacteria	8048369669	8048379549	322
198	iso_pu_bacteria	8048379754	8048389711	322
199	3300005545	Ga0070695_100305729	Ga0070695_1003057291	323
200	3300005548	Ga0070665_100134276	Ga0070665_1001342763	323
201	3300005842	Ga0068858_100035451	Ga0068858_1000354514	323
202	3300005843	Ga0068860_100026122	Ga0068860_1000261224	323
203	3300005985	Ga0081539_10001345	Ga0081539_1000134536	323
204	3300005985	Ga0081539_10003855	Ga0081539_100038557	323
205	3300005985	Ga0081539_10006323	Ga0081539_100063239	323
206	3300005985	Ga0081539_10016837	Ga0081539_100168372	323
207	3300005985	Ga0081539_10079674	Ga0081539_100796742	323
208	3300006844	Ga0075428_100068601	Ga0075428_1000686012	323
209	3300006871	Ga0075434_100390747	Ga0075434_1003907472	323
210	3300006948	Ga0099826_10009602	Ga0099826_100096023	323
211	3300011119	Ga0105246_10196346	Ga0105246_101963461	323
212	3300011119	Ga0105246_10238408	Ga0105246_102384082	323
213	3300013296	Ga0157374_10225526	Ga0157374_102255262	323
214	3300014497	Ga0182008_10000456	Ga0182008_1000045620	323
215	3300015262	Ga0182007_10000656	Ga0182007_100006568	323
216	3300015688	Ga0183367_1006	Ga0183367_1006493	323
217	3300025302	Ga0207426_1000602	Ga0207426_100060221	323
218	3300025904	Ga0207647_10014327	Ga0207647_100143272	323
219	3300028380	Ga0268265_10247992	Ga0268265_102479922	323
220	3300028381	Ga0268264_10079663	Ga0268264_100796633	323
221	3300028654	Ga0265322_10026552	Ga0265322_100265522	323
222	3300028786	Ga0307517_10002997	Ga0307517_1000299720	323
223	3300028794	Ga0307515_10000229	Ga0307515_1000022952	323
224	3300030521	Ga0307511_10021126	Ga0307511_100211265	323
225	3300030522	Ga0307512_10002657	Ga0307512_100026576	323
226	3300031456	Ga0307513_10008036	Ga0307513_1000803612	323
227	3300031507	Ga0307509_10021671	Ga0307509_100216714	323
228	3300031616	Ga0307508_10003716	Ga0307508_1000371612	323
229	3300031616	Ga0307508_10008803	Ga0307508_100088033	323
230	3300031649	Ga0307514_10003844	Ga0307514_100038444	323
231	3300031730	Ga0307516_10000185	Ga0307516_1000018510	323
232	3300031730	Ga0307516_10001550	Ga0307516_1000155011	323
233	3300031889	Ga0326468_10003174	Ga0326468_100031741	323
234	3300031901	Ga0307406_10114012	Ga0307406_101140122	323
235	3300032005	Ga0307411_10052308	Ga0307411_100523083	323
236	3300032005	Ga0307411_10130535	Ga0307411_101305352	323
237	3300032126	Ga0307415_100122358	Ga0307415_1001223582	323
238	3300033179	Ga0307507_10111667	Ga0307507_101116672	323
239	3300033179	Ga0307507_10129538	Ga0307507_101295382	323
240	3300033180	Ga0307510_10079901	Ga0307510_100799013	323
241	3300035088	Ga0373940_0026947	Ga0373940_0026947_47_1024	323
242	3300035091	Ga0373951_0000135	Ga0373951_0000135_7405_8382	323
243	3300035112	Ga0373932_0026284	Ga0373932_0026284_98_1075	323
244	3300035115	Ga0373941_0032946	Ga0373941_0032946_86_1201	323
245	3300035207	Ga0373942_0000677	Ga0373942_0000677_8218_9333	323
246	3300035242	Ga0373962_0022383	Ga0373962_0022383_634_1605	323
247	3300037418	Ga0395900_0076155	Ga0395900_0076155_368_1345	323
248	3300037466	Ga0395898_0035966	Ga0395898_0035966_975_1952	323
249	3300037471	Ga0395905_0182353	Ga0395905_0182353_202_1179	323
250	3300038443	Ga0395901_0009208	Ga0395901_0009208_2966_3943	323
251	3300041999	Ga0439433_0003932	Ga0439433_0003932_595_1581	323
252	3300042005	Ga0439448_0006620	Ga0439448_0006620_1914_2900	323
253	3300042007	Ga0439449_0021260	Ga0439449_0021260_971_1957	323
254	3300042014	Ga0439457_002029	Ga0439457_002029_2657_3643	323
255	3300042138	Ga0450903_001347	Ga0450903_001347_1762_2748	323
256	3300042157	Ga0439458_0010963	Ga0439458_0010963_663_1649	323
257	3300044656	Ga0466969_0011890	Ga0466969_0011890_3468_4448	323
258	3300044658	Ga0466972_0000862	Ga0466972_0000862_9073_10053	323
259	3300044684	Ga0466966_0002574	Ga0466966_0002574_4796_5776	323
260	3300044694	Ga0466963_0089043	Ga0466963_0089043_29_1024	323
261	3300045049	Ga0466959_0169737	Ga0466959_0169737_199_1179	323
262	3300045976	Ga0466967_0036351	Ga0466967_0036351_80_1075	323
263	3300046459	Ga0495629_0013527	Ga0495629_0013527_1347_2333	323
264	3300046459	Ga0495629_0178028	Ga0495629_0178028_410_1399	323
265	3300046461	Ga0495641_0029932	Ga0495641_0029932_1465_2454	323
266	3300046492	Ga0495585_0033813	Ga0495585_0033813_1270_2259	323
267	3300046499	Ga0495594_0008905	Ga0495594_0008905_3015_4004	323
268	3300046499	Ga0495594_0050894	Ga0495594_0050894_428_1438	323
269	3300046507	Ga0495606_0012756	Ga0495606_0012756_1555_2544	323
270	3300046520	Ga0495637_0052527	Ga0495637_0052527_419_1408	323
271	3300046522	Ga0495643_0002222	Ga0495643_0002222_9381_10370	323
272	3300046542	Ga0495597_0088487	Ga0495597_0088487_128_1144	323
273	3300046558	Ga0495633_0019713	Ga0495633_0019713_722_1711	323
274	3300046616	Ga0495668_0000696	Ga0495668_0000696_18586_19575	323
275	3300046660	Ga0495625_0001767	Ga0495625_0001767_5397_6386	323
276	3300046660	Ga0495625_0062660	Ga0495625_0062660_743_1774	323
277	3300046689	Ga0495613_0086290	Ga0495613_0086290_112_1101	323
278	3300046691	Ga0495670_0004575	Ga0495670_0004575_962_1951	323
279	3300046794	Ga0495589_0021533	Ga0495589_0021533_335_1324	323
280	3300047315	Ga0495581_0015145	Ga0495581_0015145_2946_3932	323
281	3300047323	Ga0495683_0017463	Ga0495683_0017463_140_1171	323
282	3300047323	Ga0495683_0026934	Ga0495683_0026934_216_1205	323
283	3300047443	Ga0495687_002907	Ga0495687_002907_11876_12907	323
284	3300047443	Ga0495687_062003	Ga0495687_062003_35_1024	323
285	3300047447	Ga0495685_000265	Ga0495685_000265_1494_2483	323
286	3300047470	Ga0495681_0077838	Ga0495681_0077838_461_1450	323
287	3300047472	Ga0495686_0031468	Ga0495686_0031468_1978_2973	323
288	3300048091	Ga0495626_0000237	Ga0495626_0000237_34229_35218	323
289	3300049823	Ga0501044_0002852	Ga0501044_0002852_7265_8251	323
290	3300050490	nmdc:mga03n38_5539_c1	nmdc:mga03n38_5539_c1_3016_4005	323
291	3300053079	Ga0500610_0109501	Ga0500610_0109501_46_1035	323
292	3300053088	Ga0500644_0003497	Ga0500644_0003497_2308_3414	323
293	3300053092	Ga0500583_0076427	Ga0500583_0076427_96_1073	323
294	3300053094	Ga0500566_0069668	Ga0500566_0069668_406_1395	323
295	3300053099	Ga0500654_041853	Ga0500654_041853_366_1355	323
296	3300053100	Ga0500660_047901	Ga0500660_047901_799_1788	323
297	3300053107	Ga0500560_028698	Ga0500560_028698_620_1609	323
298	3300053123	Ga0500614_028550	Ga0500614_028550_42_1031	323
299	3300053131	Ga0500652_009133	Ga0500652_009133_376_1365	323
300	3300053134	Ga0500658_0043604	Ga0500658_0043604_384_1373	323
301	3300053137	Ga0500561_0006508	Ga0500561_0006508_461_1450	323
302	3300053153	Ga0500616_0030040	Ga0500616_0030040_24_1013	323
303	3300053161	Ga0500634_0026299	Ga0500634_0026299_1369_2358	323
304	3300053739	Ga0500587_005169	Ga0500587_005169_729_1718	323
305	iso_pu_bacteria	2811994917	2812481240	323
306	3300014969	Ga0157376_10424191	Ga0157376_104241911	324
307	3300044656	Ga0466969_0006439	Ga0466969_0006439_1358_2338	324
308	3300044684	Ga0466966_0001833	Ga0466966_0001833_3897_4871	324
309	3300044694	Ga0466963_0001528	Ga0466963_0001528_9578_10552	324
310	3300044694	Ga0466963_0175758	Ga0466963_0175758_492_1466	324
311	3300044842	Ga0466957_0014082	Ga0466957_0014082_530_1504	324
312	3300045049	Ga0466959_0137581	Ga0466959_0137581_13_993	324
313	3300045836	Ga0466958_0000423	Ga0466958_0000423_9128_10102	324
314	3300045836	Ga0466958_0027658	Ga0466958_0027658_1050_2024	324
315	3300045976	Ga0466967_0019784	Ga0466967_0019784_1421_2395	324
316	3300046459	Ga0495629_0027691	Ga0495629_0027691_599_1582	324
317	3300046689	Ga0495613_0162495	Ga0495613_0162495_251_1234	324
318	3300049570	Ga0501033_0145272	Ga0501033_0145272_414_1397	324
319	3300049571	Ga0501034_0242212	Ga0501034_0242212_366_1349	324
320	3300053153	Ga0500616_0000109	Ga0500616_0000109_5201_6187	324
321	3300061719	Ga0466962_0003262	Ga0466962_0003262_931_1905	324
322	3300005329	Ga0070683_100126805	Ga0070683_1001268053	325
323	3300005331	Ga0070670_100085953	Ga0070670_1000859532	325
324	3300005334	Ga0068869_100046811	Ga0068869_1000468114	325
325	3300005338	Ga0068868_100032552	Ga0068868_1000325522	325
326	3300005344	Ga0070661_100007725	Ga0070661_1000077255	325
327	3300005345	Ga0070692_10012742	Ga0070692_100127423	325
328	3300005354	Ga0070675_100079513	Ga0070675_1000795132	325
329	3300005436	Ga0070713_100095643	Ga0070713_1000956432	325
330	3300005441	Ga0070700_100065233	Ga0070700_1000652332	325
331	3300005455	Ga0070663_100058738	Ga0070663_1000587382	325
332	3300005457	Ga0070662_100029464	Ga0070662_1000294642	325
333	3300005467	Ga0070706_100001534	Ga0070706_1000015344	325
334	3300005564	Ga0070664_100000503	Ga0070664_1000005032	325
335	3300005616	Ga0068852_100268890	Ga0068852_1002688902	325
336	3300005842	Ga0068858_100069684	Ga0068858_1000696843	325
337	3300005843	Ga0068860_100063901	Ga0068860_1000639012	325
338	3300006028	Ga0070717_10092364	Ga0070717_100923642	325
339	3300006846	Ga0075430_100026597	Ga0075430_1000265971	325
340	3300006881	Ga0068865_100226624	Ga0068865_1002266242	325
341	3300009094	Ga0111539_10074757	Ga0111539_100747575	325
342	3300009147	Ga0114129_10000056	Ga0114129_1000005613	325
343	3300009148	Ga0105243_10506543	Ga0105243_105065431	325
344	3300010375	Ga0105239_10030719	Ga0105239_100307192	325
345	3300013296	Ga0157374_10292179	Ga0157374_102921792	325
346	3300013308	Ga0157375_10345891	Ga0157375_103458912	325
347	3300014745	Ga0157377_10007005	Ga0157377_100070055	325
348	3300025901	Ga0207688_10067563	Ga0207688_100675632	325
349	3300025907	Ga0207645_10150789	Ga0207645_101507892	325
350	3300025910	Ga0207684_10011499	Ga0207684_100114996	325
351	3300025920	Ga0207649_10010256	Ga0207649_100102565	325
352	3300025925	Ga0207650_10099310	Ga0207650_100993102	325
353	3300025926	Ga0207659_10001895	Ga0207659_100018953	325
354	3300025928	Ga0207700_10094672	Ga0207700_100946722	325
355	3300025929	Ga0207664_10000712	Ga0207664_100007128	325
356	3300025933	Ga0207706_10017035	Ga0207706_100170352	325
357	3300025938	Ga0207704_10047480	Ga0207704_100474802	325
358	3300025942	Ga0207689_10004248	Ga0207689_100042489	325
359	3300025944	Ga0207661_10090767	Ga0207661_100907671	325
360	3300025945	Ga0207679_10023934	Ga0207679_100239342	325
361	3300026023	Ga0207677_10005815	Ga0207677_100058156	325
362	3300026035	Ga0207703_10064880	Ga0207703_100648802	325
363	3300026067	Ga0207678_10008656	Ga0207678_100086566	325
364	3300026118	Ga0207675_100074327	Ga0207675_1000743272	325
365	3300026121	Ga0207683_10171405	Ga0207683_101714052	325
366	3300026142	Ga0207698_10013097	Ga0207698_100130975	325
367	3300027907	Ga0207428_10021205	Ga0207428_100212052	325
368	3300028381	Ga0268264_10035368	Ga0268264_100353683	325
369	3300028381	Ga0268264_10404283	Ga0268264_104042832	325
370	3300028794	Ga0307515_10102488	Ga0307515_101024882	325
371	3300028794	Ga0307515_10286534	Ga0307515_102865341	325
372	3300031456	Ga0307513_10018707	Ga0307513_100187073	325
373	3300031649	Ga0307514_10088421	Ga0307514_100884213	325
374	3300031901	Ga0307406_10004776	Ga0307406_100047764	325
375	3300031901	Ga0307406_10128855	Ga0307406_101288552	325
376	3300031903	Ga0307407_10099145	Ga0307407_100991451	325
377	3300031995	Ga0307409_100000394	Ga0307409_10000039416	325
378	3300031995	Ga0307409_100172066	Ga0307409_1001720662	325
379	3300031995	Ga0307409_100172278	Ga0307409_1001722782	325
380	3300032002	Ga0307416_100003533	Ga0307416_1000035334	325
381	3300032004	Ga0307414_10474068	Ga0307414_104740681	325
382	3300032126	Ga0307415_100000418	Ga0307415_10000041815	325
383	3300032126	Ga0307415_100047388	Ga0307415_1000473882	325
384	3300037418	Ga0395900_0229001	Ga0395900_0229001_71_1060	325
385	3300044712	Ga0453684_0000100	Ga0453684_0000100_82790_83794	325
386	3300044901	Ga0466960_0001987	Ga0466960_0001987_2824_3813	325
387	3300046455	Ga0495603_0000651	Ga0495603_0000651_4688_5677	325
388	3300046460	Ga0495638_0084123	Ga0495638_0084123_521_1510	325
389	3300046474	Ga0495605_0012509	Ga0495605_0012509_1579_2568	325
390	3300046499	Ga0495594_0018216	Ga0495594_0018216_2425_3414	325
391	3300046501	Ga0495607_0003207	Ga0495607_0003207_11591_12580	325
392	3300046506	Ga0495583_0013336	Ga0495583_0013336_2293_3282	325
393	3300046513	Ga0495616_0031917	Ga0495616_0031917_1176_2165	325
394	3300046526	Ga0495666_0012223	Ga0495666_0012223_199_1188	325
395	3300046557	Ga0495622_0000660	Ga0495622_0000660_4681_5670	325
396	3300046558	Ga0495633_0012221	Ga0495633_0012221_1386_2375	325
397	3300046616	Ga0495668_0037963	Ga0495668_0037963_1445_2434	325
398	3300046648	Ga0495611_0008786	Ga0495611_0008786_230_1219	325
399	3300046678	Ga0495599_0127613	Ga0495599_0127613_281_1546	325
400	3300046794	Ga0495589_0158277	Ga0495589_0158277_40_1029	325
401	3300046810	Ga0495660_0010047	Ga0495660_0010047_1662_2651	325
402	3300047447	Ga0495685_002454	Ga0495685_002454_4623_5612	325
403	3300049569	Ga0501032_0018893	Ga0501032_0018893_2538_3527	325
404	3300049571	Ga0501034_0023777	Ga0501034_0023777_25_1011	325
405	3300049571	Ga0501034_0132202	Ga0501034_0132202_698_1687	325
406	3300049572	Ga0501036_0002813	Ga0501036_0002813_4946_5932	325
407	3300049573	Ga0501037_0179996	Ga0501037_0179996_295_1284	325
408	3300049574	Ga0501038_0047324	Ga0501038_0047324_867_1856	325
409	3300049575	Ga0501039_0007698	Ga0501039_0007698_3175_4161	325
410	3300049579	Ga0501043_0069880	Ga0501043_0069880_794_1783	325
411	3300049579	Ga0501043_0162687	Ga0501043_0162687_110_1096	325
412	3300049581	Ga0501047_0009698	Ga0501047_0009698_7235_8296	325
413	3300049581	Ga0501047_0056004	Ga0501047_0056004_1894_2883	325
414	3300049586	Ga0501070_0006046	Ga0501070_0006046_7788_8774	325
415	3300049590	Ga0501074_0264239	Ga0501074_0264239_195_1181	325
416	3300049743	Ga0501081_0081755	Ga0501081_0081755_794_1780	325
417	3300049822	Ga0501035_0004118	Ga0501035_0004118_10715_11704	325
418	3300049822	Ga0501035_0013340	Ga0501035_0013340_802_1788	325
419	3300049823	Ga0501044_0019323	Ga0501044_0019323_1886_2875	325
420	3300050507	nmdc:mga05p37_6335_c1	nmdc:mga05p37_6335_c1_7363_8346	325
421	3300050509	nmdc:mga0qj67_21994_c1	nmdc:mga0qj67_21994_c1_3672_4688	325
422	3300050511	nmdc:mga08y16_15945_c1	nmdc:mga08y16_15945_c1_5728_6720	325
423	3300053092	Ga0500583_0045577	Ga0500583_0045577_45_1034	325
424	3300053118	Ga0500594_0012314	Ga0500594_0012314_761_1750	325
425	3300053153	Ga0500616_0000562	Ga0500616_0000562_31227_32240	325
426	3300061734	Ga0530510_0104192	Ga0530510_0104192_717_1706	325
427	iso_pu_bacteria	8008558824	8008567165	325
428	3300028800	Ga0265338_10013894	Ga0265338_100138947	326
429	3300031235	Ga0265330_10045945	Ga0265330_100459452	326
430	3300031240	Ga0265320_10025982	Ga0265320_100259822	326
431	3300031241	Ga0265325_10000922	Ga0265325_1000092220	326
432	3300031247	Ga0265340_10003444	Ga0265340_100034445	326
433	3300031249	Ga0265339_10007897	Ga0265339_100078973	326
434	3300031595	Ga0265313_10016844	Ga0265313_100168443	326
435	3300031711	Ga0265314_10082348	Ga0265314_100823483	326
436	3300031712	Ga0265342_10014657	Ga0265342_100146572	326
437	3300005327	Ga0070658_10016299	Ga0070658_100162994	327
438	3300005336	Ga0070680_100002285	Ga0070680_1000022854	327
439	3300005458	Ga0070681_10002527	Ga0070681_100025273	327
440	3300005530	Ga0070679_100002750	Ga0070679_1000027502	327
441	3300009551	Ga0105238_10337177	Ga0105238_103371772	327
442	3300020081	Ga0206354_10780326	Ga0206354_107803265	327
443	3300020082	Ga0206353_11002918	Ga0206353_110029183	327
444	3300025909	Ga0207705_10004702	Ga0207705_100047026	327
445	3300025912	Ga0207707_10000831	Ga0207707_100008314	327
446	3300025917	Ga0207660_10001113	Ga0207660_1000111311	327
447	3300025921	Ga0207652_10003418	Ga0207652_100034188	327
448	3300044694	Ga0466963_0270109	Ga0466963_0270109_122_1138	327
449	3300048918	Ga0496115_0376787	Ga0496115_0376787_28_1017	327
450	3300049586	Ga0501070_0001036	Ga0501070_0001036_7585_8568	327
451	3300049589	Ga0501073_0001605	Ga0501073_0001605_3532_4515	327
452	3300049590	Ga0501074_0022655	Ga0501074_0022655_401_1384	327
453	3300049741	Ga0501079_0005167	Ga0501079_0005167_3179_4162	327
454	3300049742	Ga0501080_0005030	Ga0501080_0005030_8239_9222	327
455	3300050512	nmdc:mga0n895_422794_c1	nmdc:mga0n895_422794_c1_175_1158	327
456	3300054114	Ga0501084_0239422	Ga0501084_0239422_120_1103	327
457	3300031901	Ga0307406_10017200	Ga0307406_100172003	329
458	3300031903	Ga0307407_10022662	Ga0307407_100226623	329
459	3300028786	Ga0307517_10136335	Ga0307517_101363352	330
460	3300003203	JGI25406J46586_10001222	JGI25406J46586_100012222	331
461	3300005985	Ga0081539_10000197	Ga0081539_1000019763	331
462	3300006880	Ga0075429_100075430	Ga0075429_1000754302	331
463	3300009147	Ga0114129_10005255	Ga0114129_100052556	331
464	3300050507	nmdc:mga05p37_235736_c1	nmdc:mga05p37_235736_c1_268_1287	331
465	3300050508	nmdc:mga09592_182431_c1	nmdc:mga09592_182431_c1_232_1290	331

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

57

273

0.97 PF00535

Glycos_transf_2

Glycosyl transferase family 2

7

105

0.92 PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

45

338

0.91 PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

71

318

0.87 PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

59

264

0.82 PF07993

NAD_binding_4

Male sterility protein

61

220

0.8 PF04321

RmlD_sub_bind

RmlD substrate binding domain

58

304

0.77 PF13460

NAD_binding_10

NAD(P)H-binding

70

210

0.75 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1r66-assembly1.cif.gz_A-2	crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with nad and tyd bound	0.9752	1	321
1r6d-assembly1.cif.gz_A-2	crystal structure of desiv double mutant (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with nad and dau bound	0.9749	1	321
8shh-assembly1.cif.gz_A	crystal structure of evds6 decarboxylase in ligand free state	0.9742	2	324
8shh-assembly1.cif.gz_B	crystal structure of evds6 decarboxylase in ligand free state	0.971	2	323
1r66-assembly1.cif.gz_A-2	crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with nad and tyd bound	0.9693	1	321

ID	Description	Score	Start	End	Superfamily
1r6dA02	Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1	0.9575	180	321	3.90.25.10
1r6dA01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9426	1	297	3.40.50.720
1r6dA01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9384	1	297	3.40.50.720
1r6dA02	Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1	0.938	180	321	3.90.25.10
6dntA01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9322	2	242	3.40.50.720

ID	Description	Score	Start	End	GO Terms
AF-A0A7W7PVF3-F1-model_v4	dTDP-D-glucose 4,6-dehydratase	0.995	176	323
AF-A0A7C3TH40-F1-model_v4	NAD-dependent epimerase/dehydratase family protein	0.993	121	321
AF-A0A1V5IPG3-F1-model_v4	dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)	0.9873	174	325	GO:0008460
AF-A0A351DKE6-F1-model_v4	deleted	0.9864	121	324
AF-A0A662PL15-F1-model_v4	dTDP-glucose 4,6-dehydratase	0.9863	176	321

Feature Viewer

pLDDT	pTM	Quality
92.98	0.92	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F449495

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

57

273

0.97

PF00535

Glycos_transf_2

Glycosyl transferase family 2

7

105

0.92

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

45

338

0.91

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

71

318

0.87

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

59

264

0.82

PF07993

NAD_binding_4

Male sterility protein

61

220

0.8

PF04321

RmlD_sub_bind

RmlD substrate binding domain

58

304

0.77

PF13460

NAD_binding_10

NAD(P)H-binding

70

210

0.75

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map