F449516

General Info

Members Datasets Scaffolds Average Seq Length
465 333 430 247

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0254095|Ga0436364_0254095_1407_2162
Length 241
Sequence MRLFDLKGRVAIVTGGNGGIGLGMARGLAEAGAAVVISGRDQAKADAAMTALGPGHLFLAADVTRQADCRSLVARTLDRYGRLDILVNNAGTSIRKAPETYEEEEWRFVLDTNLTSAFLCAQAAHPAMREAGGGKLINIGSMMSLFGAPAIVQLTKSLAAAWAADNIQVNAVLPGWIDTDLTRRARAEVPGLHESVLARTPAGRWGEAADMAGIAVFLASPASDFVTGAAIAVDGGFSAKA

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2643221683 Variovorax sp. Root473 Isolate Unclassified
9 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
10 2818991446 Variovorax sp. 1180 Isolate Unclassified
11 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
12 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
13 2885198086 Variovorax sp. 679 Isolate Unclassified
14 2885211737 Variovorax sp. 553 Isolate Unclassified
15 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
16 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
17 2899924645 Variovorax sp. 369 Isolate Unclassified
18 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
19 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
20 2904456579 Variovorax sp. 2002 Isolate Unclassified
21 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
22 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
23 2928037797 Variovorax sp. 1126 Isolate Unclassified
24 2928044640 Variovorax sp. 1128 Isolate Unclassified
25 2928051484 Variovorax sp. 1133 Isolate Unclassified
26 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
27 2928070936 Variovorax gossypii 1167 Isolate Unclassified
28 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
29 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
30 2929520902 Variovorax beijingensis 502 Isolate Unclassified
31 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
32 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
33 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
34 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
35 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
36 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
37 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
38 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
39 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
40 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
41 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
42 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
43 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
44 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
45 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
46 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
47 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
48 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
49 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
50 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
51 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
52 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
53 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
54 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
55 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
56 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
57 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
58 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
59 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
60 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
61 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
62 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
63 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
64 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
65 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
66 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
67 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
68 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
69 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
70 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
71 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
72 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
73 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
74 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
75 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
76 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
77 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
92 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
93 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
94 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
95 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
96 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
97 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
118 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
119 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
123 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
126 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
135 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
138 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
182 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
183 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
184 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
185 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
186 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
187 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
188 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
192 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
195 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
198 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
199 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
211 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
212 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
213 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
214 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
226 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
227 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
228 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
229 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
230 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
231 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
232 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
233 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
234 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
235 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
236 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
237 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
238 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
239 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
240 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
241 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
242 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
243 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
244 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
248 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
249 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
250 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
251 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
252 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
253 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
254 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
255 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
256 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
257 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
258 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
259 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
260 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
261 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
262 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
263 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
264 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
265 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
268 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
269 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
270 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
271 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
272 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
273 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
274 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
275 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
278 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
279 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
280 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
281 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
282 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
283 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
284 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
285 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
286 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
287 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
288 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
289 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
290 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
291 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
292 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
293 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
294 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
295 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
296 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
301 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
302 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
305 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
306 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
307 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
308 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
309 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
310 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
311 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
312 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
313 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
314 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
315 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
316 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
317 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
318 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
319 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
320 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
321 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
322 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
323 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
324 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
325 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
326 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
327 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
328 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
329 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
330 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
331 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
332 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
333 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.61
Metatranscriptomes 0.86
Isolates 7.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.39
Nodule 1.29
Rhizoplane 1.94
Rhizosphere 60.65
Stem 0
Stem Tuber 0
Unclassified 7.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000643 3300002773 Bacteria 18494
2 JGI25152J39213_1001773 3300002773 Bacteria 8789
3 JGI25152J39213_1013927 3300002773 Bacteria 1652
4 JGI25150J39212_1002523 3300002774 Bacteria 4525
5 JGI25159J45721_1000618 3300002987 Bacteria 15833
6 JGI25159J45721_1009047 3300002987 Bacteria 2668
7 JGI25151J46595_10000720 3300003187 Bacteria 27528
8 JGI25151J46595_10001285 3300003187 Bacteria 17696
9 JGI25151J46595_10004304 3300003187 Bacteria 7562
10 JGI25151J46595_10037192 3300003187 Bacteria 1828
11 JGI25151J46595_10038008 3300003187 Bacteria 1797
12 JGI25153J46596_10000941 3300003215 Bacteria 17696
13 JGI25153J46596_10030604 3300003215 Bacteria 1828
14 JGI25153J46596_10031231 3300003215 Bacteria 1797
15 JGI25160J50197_1000746 3300003354 Bacteria 17696
16 JGI25160J50197_1003671 3300003354 Bacteria 6797
17 JGI25161J50226_1001326 3300003374 Bacteria 7687
18 JGI25161J50226_1006164 3300003374 Bacteria 2210
19 JGI25161J50226_1008386 3300003374 Bacteria 1598
20 Ga0006562J51391_1039874 3300003578 Bacteria 2613
21 Ga0006562J51391_1039876 3300003578 Bacteria 1440
22 Ga0006562J51391_1104774 3300003578 Bacteria 3200
23 Ga0006562J51391_1104775 3300003578 Bacteria 1650
24 Ga0055527_1007787 3300003760 Bacteria 1299
25 Ga0055535_1000477 3300003761 Bacteria 36428
26 Ga0055542_1000022 3300003762 Bacteria 302315
27 Ga0055526_1001330 3300003771 Bacteria 17696
28 Ga0055526_1004201 3300003771 Bacteria 8745
29 Ga0055537_1000381 3300003773 Bacteria 29870
30 Ga0055537_1000687 3300003773 Bacteria 17696
31 Ga0055524_1000997 3300003775 Bacteria 17696
32 Ga0055524_1001643 3300003775 Bacteria 12471
33 Ga0055536_1000337 3300003781 Bacteria 34704
34 Ga0055536_1000465 3300003781 Bacteria 28427
35 Ga0055536_1024073 3300003781 Bacteria 1773
36 Ga0055534_1000016 3300003784 Bacteria 144444
37 Ga0055534_1000564 3300003784 Bacteria 19575
38 Ga0055528_1000144 3300003790 Bacteria 58098
39 Ga0055528_1000877 3300003790 Bacteria 20397
40 Ga0055530_10000456 3300003791 Bacteria 36242
41 Ga0055540_1000458 3300003792 Bacteria 31738
42 Ga0055540_1000746 3300003792 Bacteria 22070
43 Ga0055540_1000844 3300003792 Bacteria 20544
44 Ga0055531_10000488 3300003794 Bacteria 36350
45 Ga0055531_10026157 3300003794 Bacteria 2091
46 Ga0055543_1001142 3300004625 Bacteria 11340
47 Ga0055543_1001312 3300004625 Bacteria 10188
48 Ga0065165_1007683 3300005262 Bacteria 5231
49 Ga0065714_10004476 3300005288 Bacteria 5239
50 Ga0065707_10083747 3300005295 Bacteria 8333
51 Ga0070676_10036061 3300005328 Bacteria 2847
52 Ga0070666_10084208 3300005335 Bacteria 2176
53 Ga0070682_100052544 3300005337 Bacteria 2550
54 Ga0070682_100242766 3300005337 Bacteria 1294
55 Ga0068868_100286023 3300005338 Bacteria 1397
56 Ga0070691_10086528 3300005341 Bacteria 1540
57 Ga0070687_100097993 3300005343 Bacteria 1636
58 Ga0070668_100277407 3300005347 Bacteria 1399
59 Ga0070675_100289277 3300005354 Bacteria 1442
60 Ga0070674_100070459 3300005356 Bacteria 2470
61 Ga0070714_100210404 3300005435 Bacteria 1782
62 Ga0070710_10042195 3300005437 Bacteria 2521
63 Ga0070700_100013129 3300005441 Bacteria 4646
64 Ga0070708_100019314 3300005445 Bacteria 5724
65 Ga0070663_100709177 3300005455 Bacteria 856
66 Ga0070678_100568516 3300005456 Bacteria 1008
67 Ga0070662_100072262 3300005457 Bacteria 2546
68 Ga0070681_10634515 3300005458 Bacteria 983
69 Ga0068867_100005317 3300005459 Bacteria 9097
70 Ga0068867_100229619 3300005459 Bacteria 1499
71 Ga0070679_100301766 3300005530 Bacteria 1552
72 Ga0068853_100002638 3300005539 Bacteria 13508
73 Ga0068853_100009610 3300005539 Bacteria 7791
74 Ga0068853_100113287 3300005539 Bacteria 2411
75 Ga0070665_100250342 3300005548 Bacteria 1772
76 Ga0068855_100258755 3300005563 Bacteria 1940
77 Ga0068855_100288879 3300005563 Bacteria 1818
78 Ga0068857_100046193 3300005577 Bacteria 3864
79 Ga0068856_100296667 3300005614 Bacteria 1634
80 Ga0070702_100024390 3300005615 Bacteria 3227
81 Ga0068852_100169886 3300005616 Bacteria 2043
82 Ga0068866_10003878 3300005718 Bacteria 6134
83 Ga0068861_100001145 3300005719 Bacteria 16514
84 Ga0068861_100257473 3300005719 Bacteria 1492
85 Ga0068851_10009304 3300005834 Bacteria 4562
86 Ga0068863_100371203 3300005841 Bacteria 1396
87 Ga0068858_100072171 3300005842 Bacteria 3203
88 Ga0068860_100003560 3300005843 Bacteria 16016
89 Ga0068862_100186011 3300005844 Bacteria 1866
90 Ga0068862_100488368 3300005844 Bacteria 1167
91 Ga0081540_1001538 3300005983 Bacteria 19791
92 Ga0075364_10096395 3300006051 Bacteria 1967
93 Ga0075364_10172637 3300006051 Bacteria 1461
94 Ga0070712_100008525 3300006175 Bacteria 6450
95 Ga0075362_10011862 3300006177 Bacteria 3443
96 Ga0075367_10048115 3300006178 Bacteria 2511
97 Ga0075366_10100193 3300006195 Bacteria 1738
98 Ga0075370_10000420 3300006353 Bacteria 15687
99 Ga0075370_10040199 3300006353 Bacteria 2637
100 Ga0075370_10049583 3300006353 Bacteria 2380
101 Ga0075370_10147516 3300006353 Bacteria 1378
102 Ga0075431_100048183 3300006847 Bacteria 4394
103 Ga0068865_100007676 3300006881 Bacteria 6644
104 Ga0068865_100017638 3300006881 Bacteria 4595
105 Ga0105240_10028434 3300009093 Bacteria 7303
106 Ga0105240_10073311 3300009093 Bacteria 4227
107 Ga0105245_10599234 3300009098 Bacteria 1128
108 Ga0114129_10001539 3300009147 Bacteria 31268
109 Ga0114129_10768320 3300009147 Bacteria 1232
110 Ga0105243_10001847 3300009148 Bacteria 18103
111 Ga0105243_10042264 3300009148 Bacteria 3568
112 Ga0105241_10020303 3300009174 Bacteria 4908
113 Ga0105237_10049123 3300009545 Bacteria 4242
114 Ga0105237_10061298 3300009545 Bacteria 3761
115 Ga0105239_10104451 3300010375 Bacteria 3137
116 Ga0105239_10245201 3300010375 Bacteria 2011
117 Ga0157373_10119024 3300013100 Bacteria 1856
118 Ga0157373_10218710 3300013100 Bacteria 1344
119 Ga0157370_10006457 3300013104 Bacteria 12937
120 Ga0157369_10016894 3300013105 Bacteria 8201
121 Ga0157378_10083933 3300013297 Bacteria 2883
122 Ga0163162_10009102 3300013306 Bacteria 9654
123 Ga0163162_10384683 3300013306 Bacteria 1536
124 Ga0157372_10034145 3300013307 Bacteria 5591
125 Ga0157372_10119616 3300013307 Bacteria 3024
126 Ga0157380_10820902 3300014326 Bacteria 949
127 Ga0182008_10012241 3300014497 Bacteria 4530
128 Ga0157379_10187931 3300014968 Bacteria 1867
129 Ga0163161_10000088 3300017792 Bacteria 91403
130 Ga0163161_10031678 3300017792 Bacteria 3769
131 Ga0163161_10043125 3300017792 Bacteria 3248
132 Ga0163161_10068192 3300017792 Bacteria 2599
133 Ga0213875_10094188 3300021388 Bacteria 1397
134 Ga0209436_105690 3300025208 Bacteria 2824
135 Ga0209672_104029 3300025228 Bacteria 2837
136 Ga0209147_100987 3300025229 Bacteria 12361
137 Ga0209258_100009 3300025242 Bacteria 996276
138 Ga0207425_1000169 3300025245 Bacteria 54781
139 Ga0207425_1018326 3300025245 Bacteria 1520
140 Ga0209677_100491 3300025253 Bacteria 22276
141 Ga0209148_1000007 3300025254 Bacteria 1592273
142 Ga0209129_1000024 3300025258 Bacteria 417268
143 Ga0209129_1002535 3300025258 Bacteria 8869
144 Ga0209129_1004377 3300025258 Bacteria 5553
145 Ga0209129_1013109 3300025258 Bacteria 1847
146 Ga0209565_1000046 3300025263 Bacteria 226073
147 Ga0209565_1000286 3300025263 Bacteria 49417
148 Ga0209455_1001620 3300025272 Bacteria 9843
149 Ga0209455_1005471 3300025272 Bacteria 3918
150 Ga0209673_1000058 3300025273 Bacteria 269028
151 Ga0209673_1000300 3300025273 Bacteria 91660
152 Ga0209673_1000410 3300025273 Bacteria 75829
153 Ga0209673_1005378 3300025273 Bacteria 6463
154 Ga0209130_1000157 3300025284 Bacteria 101890
155 Ga0209130_1000383 3300025284 Bacteria 49412
156 Ga0209675_1000010 3300025291 Bacteria 541927
157 Ga0209675_1000151 3300025291 Bacteria 91172
158 Ga0209676_1000028 3300025292 Bacteria 559745
159 Ga0209676_1000275 3300025292 Bacteria 107485
160 Ga0209676_1000581 3300025292 Bacteria 54811
161 Ga0209676_1024666 3300025292 Bacteria 1942
162 Ga0209025_1000272 3300025294 Bacteria 120328
163 Ga0209025_1000289 3300025294 Bacteria 113555
164 Ga0209025_1001337 3300025294 Bacteria 33246
165 Ga0209025_1009321 3300025294 Bacteria 6869
166 Ga0209025_1023151 3300025294 Bacteria 3260
167 Ga0209025_1044655 3300025294 Bacteria 1848
168 Ga0209564_1000209 3300025295 Bacteria 133651
169 Ga0209564_1000326 3300025295 Bacteria 92977
170 Ga0209758_1000049 3300025297 Bacteria 345104
171 Ga0209758_1014963 3300025297 Bacteria 4063
172 Ga0209758_1037808 3300025297 Bacteria 1860
173 Ga0209050_1000002 3300025298 Bacteria 1792849
174 Ga0209050_1000122 3300025298 Bacteria 195305
175 Ga0209256_1000088 3300025299 Bacteria 217236
176 Ga0209256_1000253 3300025299 Bacteria 94918
177 Ga0207426_1000038 3300025302 Bacteria 441522
178 Ga0207426_1000053 3300025302 Bacteria 384818
179 Ga0209051_1000015 3300025303 Bacteria 546798
180 Ga0209051_1000168 3300025303 Bacteria 119312
181 Ga0209051_1000179 3300025303 Bacteria 114055
182 Ga0209051_1000496 3300025303 Bacteria 50669
183 Ga0209051_1000509 3300025303 Bacteria 49288
184 Ga0209051_1028614 3300025303 Bacteria 2197
185 Ga0209257_1000814 3300025304 Bacteria 45274
186 Ga0209257_1001051 3300025304 Bacteria 36633
187 Ga0207656_10112669 3300025321 Bacteria 1259
188 Ga0207688_10066945 3300025901 Bacteria 2032
189 Ga0207680_10056727 3300025903 Bacteria 2367
190 Ga0207647_10074704 3300025904 Bacteria 2041
191 Ga0207685_10048310 3300025905 Bacteria 1629
192 Ga0207645_10043587 3300025907 Bacteria 2872
193 Ga0207705_10098124 3300025909 Bacteria 2152
194 Ga0207654_10049090 3300025911 Bacteria 2418
195 Ga0207695_10066784 3300025913 Bacteria 3692
196 Ga0207671_10104794 3300025914 Bacteria 2145
197 Ga0207693_10004956 3300025915 Bacteria 11186
198 Ga0207657_10006953 3300025919 Bacteria 11660
199 Ga0207694_10060495 3300025924 Bacteria 2948
200 Ga0207659_10429164 3300025926 Bacteria 1110
201 Ga0207687_10504518 3300025927 Bacteria 1010
202 Ga0207700_10809185 3300025928 Bacteria 838
203 Ga0207664_10296341 3300025929 Bacteria 1422
204 Ga0207706_10046141 3300025933 Bacteria 3858
205 Ga0207709_10000284 3300025935 Bacteria 57743
206 Ga0207709_10009407 3300025935 Bacteria 5376
207 Ga0207709_10056076 3300025935 Bacteria 2437
208 Ga0207709_10073961 3300025935 Bacteria 2173
209 Ga0207669_10001982 3300025937 Bacteria 8681
210 Ga0207704_10302329 3300025938 Bacteria 1226
211 Ga0207691_10086708 3300025940 Bacteria 2809
212 Ga0207691_10250381 3300025940 Bacteria 1529
213 Ga0207711_10165933 3300025941 Bacteria 2002
214 Ga0207668_10030055 3300025972 Bacteria 3567
215 Ga0207658_10630026 3300025986 Bacteria 965
216 Ga0207703_10160222 3300026035 Bacteria 1970
217 Ga0207703_10303201 3300026035 Bacteria 1458
218 Ga0207639_10004496 3300026041 Bacteria 9406
219 Ga0207639_10017328 3300026041 Bacteria 5106
220 Ga0207678_10606381 3300026067 Bacteria 960
221 Ga0207708_10038512 3300026075 Bacteria 3643
222 Ga0207708_10043809 3300026075 Bacteria 3411
223 Ga0207702_10121567 3300026078 Bacteria 2338
224 Ga0207641_10475874 3300026088 Bacteria 1210
225 Ga0207648_10000556 3300026089 Bacteria 41762
226 Ga0207648_10059198 3300026089 Bacteria 3340
227 Ga0207648_10080794 3300026089 Bacteria 2836
228 Ga0207648_10305519 3300026089 Bacteria 1427
229 Ga0207674_10051401 3300026116 Bacteria 4206
230 Ga0207675_100012870 3300026118 Bacteria 7815
231 Ga0207675_100169498 3300026118 Bacteria 2086
232 Ga0207683_10267137 3300026121 Bacteria 1562
233 Ga0207683_10307692 3300026121 Bacteria 1450
234 Ga0207698_11001206 3300026142 Bacteria 846
235 Ga0209588_1033679 3300027671 Bacteria 1643
236 Ga0207428_10199167 3300027907 Bacteria 1507
237 Ga0268266_10119131 3300028379 Bacteria 2347
238 Ga0268265_10009005 3300028380 Bacteria 6753
239 Ga0268265_10418295 3300028380 Bacteria 1244
240 Ga0268264_10003478 3300028381 Bacteria 13579
241 Ga0265334_10003596 3300028573 Bacteria 7025
242 Ga0265318_10064413 3300028577 Bacteria 1364
243 Ga0265336_10042458 3300028666 Bacteria 1388
244 Ga0316180_1069828 3300030736 Bacteria 1250
245 Ga0316183_1033629 3300030742 Bacteria 1489
246 Ga0316182_1132571 3300030745 Bacteria 3146
247 Ga0265332_10017433 3300031238 Bacteria 3170
248 Ga0265332_10043921 3300031238 Bacteria 1928
249 Ga0265320_10087112 3300031240 Bacteria 1451
250 Ga0265340_10001034 3300031247 Bacteria 15874
251 Ga0265339_10019986 3300031249 Bacteria 3920
252 Ga0265339_10054382 3300031249 Bacteria 2174
253 Ga0265331_10198715 3300031250 Bacteria 903
254 Ga0307513_10047318 3300031456 Bacteria 4680
255 Ga0307408_100006368 3300031548 Bacteria 7829
256 Ga0307408_100223481 3300031548 Bacteria 1538
257 Ga0265313_10116937 3300031595 Bacteria 1167
258 Ga0307514_10050558 3300031649 Bacteria 3225
259 Ga0307514_10270762 3300031649 Bacteria 983
260 Ga0265314_10104984 3300031711 Bacteria 1808
261 Ga0265342_10080343 3300031712 Bacteria 1884
262 Ga0265342_10087233 3300031712 Bacteria 1793
263 Ga0265342_10098996 3300031712 Bacteria 1663
264 Ga0316576_10027200 3300031727 Bacteria 4020
265 Ga0316578_10073973 3300031728 Bacteria 2020
266 Ga0307405_10073144 3300031731 Bacteria 2212
267 Ga0307406_10000486 3300031901 Bacteria 22944
268 Ga0307406_10025407 3300031901 Bacteria 3547
269 Ga0307406_10217128 3300031901 Bacteria 1419
270 Ga0307412_10121971 3300031911 Bacteria 1878
271 Ga0307409_100006489 3300031995 Bacteria 6881
272 Ga0307416_100032044 3300032002 Bacteria 3966
273 Ga0307416_100057957 3300032002 Bacteria 3137
274 Ga0307416_100524482 3300032002 Bacteria 1253
275 Ga0307414_10012517 3300032004 Bacteria 5019
276 Ga0307411_10124629 3300032005 Bacteria 1871
277 Ga0307415_100004161 3300032126 Bacteria 7462
278 Ga0373923_0020992 3300035111 Bacteria 2545
279 Ga0373936_0110414 3300035113 Bacteria 1167
280 Ga0373953_0004188 3300035117 Bacteria 4577
281 Ga0373953_0044935 3300035117 Bacteria 1768
282 Ga0373954_0021718 3300035118 Bacteria 2907
283 Ga0373954_0037098 3300035118 Bacteria 2264
284 Ga0373954_0162441 3300035118 Bacteria 1093
285 Ga0373956_0001926 3300035119 Bacteria 8568
286 Ga0373955_0002241 3300035172 Bacteria 8399
287 Ga0373955_0018048 3300035172 Bacteria 3501
288 Ga0373955_0020020 3300035172 Bacteria 3356
289 Ga0373935_0522652 3300035692 Bacteria 863
290 Ga0373933_0023206 3300035724 Bacteria 3542
291 Ga0373933_0137823 3300035724 Bacteria 1538
292 Ga0373947_0000655 3300035725 Bacteria 20520
293 Ga0373937_0015128 3300036401 Bacteria 6818
294 Ga0373937_0051618 3300036401 Bacteria 3769
295 Ga0316584_0194304 3300036712 Bacteria 1499
296 Ga0373925_0113682 3300037068 Bacteria 2094
297 Ga0395900_0062990 3300037418 Bacteria 3812
298 Ga0395900_0154378 3300037418 Bacteria 2345
299 Ga0395898_0080007 3300037466 Bacteria 3152
300 Ga0395905_0086635 3300037471 Bacteria 2936
301 Ga0436364_0254095 3300037853 Bacteria 2287
302 Ga0395901_0350027 3300038443 Bacteria 1525
303 Ga0395901_0526866 3300038443 Bacteria 1200
304 Ga0436361_0551039 3300039447 Bacteria 1226
305 Ga0439466_0050775 3300041411 Bacteria 1359
306 Ga0451797_0287736 3300041453 Bacteria 1582
307 Ga0439442_046863 3300042002 Bacteria 910
308 Ga0439455_0040871 3300042012 Bacteria 1187
309 Ga0439457_030854 3300042014 Bacteria 1188
310 Ga0450920_003019 3300042122 Bacteria 2903
311 Ga0450898_021116 3300042134 Bacteria 1145
312 Ga0450899_011639 3300042135 Bacteria 983
313 Ga0450906_002617 3300042145 Bacteria 3929
314 Ga0450910_008745 3300042147 Bacteria 1427
315 Ga0450908_007581 3300042184 Bacteria 2045
316 Ga0439434_0015635 3300042435 Bacteria 2263
317 Ga0450918_001025 3300042531 Bacteria 5788
318 Ga0466969_0085474 3300044656 Bacteria 1500
319 Ga0466963_0146043 3300044694 Bacteria 1641
320 Ga0466957_0119196 3300044842 Bacteria 1681
321 Ga0466959_0238043 3300045049 Bacteria 1258
322 Ga0466959_0262217 3300045049 Bacteria 1189
323 Ga0466967_0229166 3300045976 Bacteria 1768
324 Ga0495592_0075681 3300046454 Bacteria 2444
325 Ga0495592_0150819 3300046454 Bacteria 1608
326 Ga0495603_0001446 3300046455 Bacteria 13824
327 Ga0495629_0002323 3300046459 Bacteria 14650
328 Ga0495638_0034018 3300046460 Bacteria 3255
329 Ga0495638_0038110 3300046460 Bacteria 3057
330 Ga0495641_0018034 3300046461 Bacteria 3656
331 Ga0495651_0030928 3300046462 Bacteria 4175
332 Ga0495653_0274350 3300046463 Bacteria 1109
333 Ga0495580_0001310 3300046472 Bacteria 21988
334 Ga0495582_0038764 3300046473 Bacteria 2622
335 Ga0495639_0002198 3300046475 Bacteria 8585
336 Ga0495664_0050064 3300046477 Bacteria 2480
337 Ga0495594_0000020 3300046499 Bacteria 80534
338 Ga0495608_0201436 3300046511 Bacteria 1254
339 Ga0495616_0001372 3300046513 Bacteria 16955
340 Ga0495631_0000357 3300046518 Bacteria 31485
341 Ga0495632_0028005 3300046519 Bacteria 2944
342 Ga0495632_0089802 3300046519 Bacteria 1458
343 Ga0495644_0066617 3300046523 Bacteria 1353
344 Ga0495666_0044301 3300046526 Bacteria 2148
345 Ga0495640_0004368 3300046533 Bacteria 11283
346 Ga0495640_0041442 3300046533 Bacteria 3217
347 Ga0495586_0022066 3300046535 Bacteria 3397
348 Ga0495587_0022519 3300046536 Bacteria 3879
349 Ga0495621_0013528 3300046539 Bacteria 2566
350 Ga0495645_0030003 3300046543 Bacteria 3961
351 Ga0495667_0055164 3300046559 Bacteria 2613
352 Ga0495667_0062817 3300046559 Bacteria 2433
353 Ga0495668_0087195 3300046616 Bacteria 1712
354 Ga0495668_0257666 3300046616 Bacteria 955
355 Ga0495634_0000998 3300046642 Bacteria 26678
356 Ga0495634_0084156 3300046642 Bacteria 2074
357 Ga0495625_0023437 3300046660 Bacteria 4715
358 Ga0495588_0017874 3300046674 Bacteria 3451
359 Ga0495657_0061830 3300046675 Bacteria 2476
360 Ga0495599_0050288 3300046678 Bacteria 2611
361 Ga0495646_0114041 3300046680 Bacteria 1536
362 Ga0495647_0012506 3300046681 Bacteria 2924
363 Ga0495658_0002975 3300046683 Bacteria 8485
364 Ga0495658_0112848 3300046683 Bacteria 1636
365 Ga0495649_0002661 3300046694 Bacteria 12441
366 Ga0495600_0118974 3300046809 Bacteria 1718
367 Ga0495581_0001284 3300047315 Bacteria 13842
368 Ga0495680_0110046 3300047322 Bacteria 2042
369 Ga0495681_0040622 3300047470 Bacteria 2264
370 Ga0495684_0187319 3300047471 Bacteria 1532
371 Ga0495593_0024795 3300047673 Bacteria 3320
372 Ga0495602_0179989 3300048088 Bacteria 1632
373 Ga0495602_0193623 3300048088 Bacteria 1556
374 Ga0495614_0014477 3300048089 Bacteria 3452
375 Ga0495614_0043684 3300048089 Bacteria 1922
376 Ga0495615_0043689 3300048090 Bacteria 1129
377 Ga0496100_0524981 3300048903 Bacteria 914
378 Ga0496102_0351959 3300048905 Bacteria 1387
379 Ga0496104_0457456 3300048907 Bacteria 1188
380 Ga0496115_0167799 3300048918 Bacteria 1815
381 Ga0496117_0221267 3300048920 Bacteria 1053
382 Ga0496118_0007796 3300048921 Bacteria 11237
383 Ga0496118_0011373 3300048921 Bacteria 8697
384 Ga0496121_0043109 3300048924 Bacteria 3912
385 Ga0496121_0112126 3300048924 Bacteria 2078
386 Ga0496123_0181076 3300048926 Bacteria 1101
387 Ga0496124_0099455 3300048927 Bacteria 2359
388 Ga0496125_0000090 3300048928 Bacteria 214433
389 Ga0496125_0030463 3300048928 Bacteria 4827
390 Ga0496125_0172703 3300048928 Bacteria 1450
391 Ga0496126_0020436 3300048929 Bacteria 6488
392 Ga0501034_0725181 3300049571 Bacteria 891
393 Ga0501048_0022574 3300049582 Bacteria 4601
394 Ga0501076_0397971 3300049592 Bacteria 1132
395 Ga0501077_0030891 3300049593 Bacteria 3409
396 Ga0501081_0176580 3300049743 Bacteria 1544
397 Ga0501081_0185799 3300049743 Bacteria 1504
398 Ga0501044_0117100 3300049823 Bacteria 2669
399 nmdc:mga03n38_323832_c1 3300050490 Bacteria 833
400 nmdc:mga00v17_266122_c1 3300050491 Bacteria 1112
401 nmdc:mga00v17_83274_c1 3300050491 Bacteria 2000
402 nmdc:mga0k408_12116_c1 3300050493 Bacteria 4709
403 nmdc:mga06z11_224799_c1 3300050494 Bacteria 1098
404 nmdc:mga07m45_153827_c1 3300050496 Bacteria 1334
405 nmdc:mga07m45_744_c1 3300050496 Bacteria 13919
406 nmdc:mga05p37_37510_c1 3300050507 Bacteria 5943
407 nmdc:mga09592_1422_c1 3300050508 Bacteria 19206
408 nmdc:mga06r32_20567_c1 3300050510 Bacteria 6077
409 nmdc:mga06r32_238629_c1 3300050510 Bacteria 1806
410 nmdc:mga0sz30_97307_c1 3300050516 Bacteria 1284
411 Ga0495595_0144481 3300053084 Bacteria 1168
412 Ga0500651_0003290 3300053093 Bacteria 8799
413 Ga0500566_0086204 3300053094 Bacteria 1741
414 Ga0500571_041184 3300053110 Bacteria 2479
415 Ga0500594_0000605 3300053118 Bacteria 7670
416 Ga0500607_001419 3300053121 Bacteria 21691
417 Ga0500626_018009 3300053128 Bacteria 3112
418 Ga0500655_002769 3300053133 Bacteria 3181
419 Ga0500658_0000671 3300053134 Bacteria 14108
420 Ga0500658_0008577 3300053134 Bacteria 3774
421 Ga0500559_0006687 3300053136 Bacteria 5181
422 Ga0500564_057711 3300053138 Bacteria 1765
423 Ga0500574_001300 3300053141 Bacteria 3656
424 Ga0500634_0036187 3300053161 Bacteria 2687
425 Ga0500638_096775 3300053162 Bacteria 1382
426 Ga0500636_0086514 3300053177 Bacteria 1800
427 Ga0500565_005492 3300053734 Bacteria 1123
428 Ga0500596_015623 3300053735 Bacteria 1140
429 Ga0501084_0238241 3300054114 Bacteria 1536
430 Ga0501082_0147924 3300060353 Bacteria 2040

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025272 Ga0209455_1001620 Ga0209455_10016204 208
2 3300005983 Ga0081540_1001538 Ga0081540_10015383 209
3 3300025905 Ga0207685_10048310 Ga0207685_100483102 212
4 3300005343 Ga0070687_100097993 Ga0070687_1000979932 216
5 3300010375 Ga0105239_10245201 Ga0105239_102452012 216
6 3300013306 Ga0163162_10384683 Ga0163162_103846832 216
7 3300017792 Ga0163161_10068192 Ga0163161_100681922 216
8 3300025927 Ga0207687_10504518 Ga0207687_105045181 216
9 3300026035 Ga0207703_10303201 Ga0207703_103032012 216
10 3300026075 Ga0207708_10038512 Ga0207708_100385123 216
11 3300027907 Ga0207428_10199167 Ga0207428_101991671 216
12 3300046519 Ga0495632_0089802 Ga0495632_0089802_380_1219 216
13 3300046523 Ga0495644_0066617 Ga0495644_0066617_421_1260 216
14 3300048090 Ga0495615_0043689 Ga0495615_0043689_269_1108 216
15 3300035725 Ga0373947_0000655 Ga0373947_0000655_15236_16015 217
16 3300046454 Ga0495592_0075681 Ga0495592_0075681_1625_2404 217
17 3300046455 Ga0495603_0001446 Ga0495603_0001446_2836_3615 217
18 3300046459 Ga0495629_0002323 Ga0495629_0002323_9578_10357 217
19 3300046472 Ga0495580_0001310 Ga0495580_0001310_11491_12270 217
20 3300046499 Ga0495594_0000020 Ga0495594_0000020_68606_69385 217
21 3300046642 Ga0495634_0000998 Ga0495634_0000998_12869_13648 217
22 3300046681 Ga0495647_0012506 Ga0495647_0012506_562_1341 217
23 3300035111 Ga0373923_0020992 Ga0373923_0020992_18_767 218
24 3300035117 Ga0373953_0044935 Ga0373953_0044935_703_1452 218
25 3300035118 Ga0373954_0021718 Ga0373954_0021718_72_821 218
26 3300035118 Ga0373954_0162441 Ga0373954_0162441_63_827 218
27 3300035119 Ga0373956_0001926 Ga0373956_0001926_7232_7981 218
28 3300035172 Ga0373955_0018048 Ga0373955_0018048_441_1190 218
29 3300035692 Ga0373935_0522652 Ga0373935_0522652_54_803 218
30 3300035724 Ga0373933_0023206 Ga0373933_0023206_855_1604 218
31 3300036401 Ga0373937_0051618 Ga0373937_0051618_2255_3019 218
32 3300046461 Ga0495641_0018034 Ga0495641_0018034_2087_2866 218
33 3300046463 Ga0495653_0274350 Ga0495653_0274350_220_999 218
34 3300046473 Ga0495582_0038764 Ga0495582_0038764_1275_2054 218
35 3300046475 Ga0495639_0002198 Ga0495639_0002198_1314_2093 218
36 3300046477 Ga0495664_0050064 Ga0495664_0050064_1642_2421 218
37 3300046526 Ga0495666_0044301 Ga0495666_0044301_904_1683 218
38 3300046533 Ga0495640_0004368 Ga0495640_0004368_7108_7887 218
39 3300046559 Ga0495667_0062817 Ga0495667_0062817_1529_2308 218
40 3300046683 Ga0495658_0002975 Ga0495658_0002975_1959_2738 218
41 3300047315 Ga0495581_0001284 Ga0495581_0001284_6573_7352 218
42 3300048089 Ga0495614_0014477 Ga0495614_0014477_2509_3288 218
43 3300005335 Ga0070666_10084208 Ga0070666_100842082 219
44 3300005338 Ga0068868_100286023 Ga0068868_1002860232 219
45 3300005457 Ga0070662_100072262 Ga0070662_1000722622 219
46 3300005459 Ga0068867_100229619 Ga0068867_1002296192 219
47 3300005615 Ga0070702_100024390 Ga0070702_1000243903 219
48 3300005719 Ga0068861_100257473 Ga0068861_1002574732 219
49 3300006881 Ga0068865_100017638 Ga0068865_1000176383 219
50 3300025901 Ga0207688_10066945 Ga0207688_100669452 219
51 3300025903 Ga0207680_10056727 Ga0207680_100567272 219
52 3300025933 Ga0207706_10046141 Ga0207706_100461413 219
53 3300025935 Ga0207709_10073961 Ga0207709_100739613 219
54 3300025937 Ga0207669_10001982 Ga0207669_100019822 219
55 3300025938 Ga0207704_10302329 Ga0207704_103023292 219
56 3300025940 Ga0207691_10086708 Ga0207691_100867083 219
57 3300025941 Ga0207711_10165933 Ga0207711_101659332 219
58 3300025972 Ga0207668_10030055 Ga0207668_100300554 219
59 3300025986 Ga0207658_10630026 Ga0207658_106300261 219
60 3300026089 Ga0207648_10080794 Ga0207648_100807942 219
61 3300026118 Ga0207675_100169498 Ga0207675_1001694981 219
62 3300026121 Ga0207683_10267137 Ga0207683_102671371 219
63 3300048907 Ga0496104_0457456 Ga0496104_0457456_260_1030 219
64 3300037418 Ga0395900_0154378 Ga0395900_0154378_171_935 221
65 3300037471 Ga0395905_0086635 Ga0395905_0086635_1387_2151 221
66 3300038443 Ga0395901_0526866 Ga0395901_0526866_255_1019 221
67 3300048918 Ga0496115_0167799 Ga0496115_0167799_119_889 221
68 3300005437 Ga0070710_10042195 Ga0070710_100421951 222
69 3300006175 Ga0070712_100008525 Ga0070712_1000085257 222
70 3300025915 Ga0207693_10004956 Ga0207693_1000495613 222
71 3300031249 Ga0265339_10054382 Ga0265339_100543822 222
72 3300039447 Ga0436361_0551039 Ga0436361_0551039_22_777 223
73 3300045049 Ga0466959_0262217 Ga0466959_0262217_120_908 226
74 3300005435 Ga0070714_100210404 Ga0070714_1002104042 227
75 3300025928 Ga0207700_10809185 Ga0207700_108091851 227
76 3300025929 Ga0207664_10296341 Ga0207664_102963411 227
77 3300009147 Ga0114129_10768320 Ga0114129_107683201 228
78 3300009147 Ga0114129_10001539 Ga0114129_1000153919 231
79 3300035118 Ga0373954_0037098 Ga0373954_0037098_1557_2252 231
80 3300035724 Ga0373933_0137823 Ga0373933_0137823_13_708 231
81 3300046616 Ga0495668_0087195 Ga0495668_0087195_1002_1697 231
82 3300049582 Ga0501048_0022574 Ga0501048_0022574_3721_4416 231
83 3300050507 nmdc:mga05p37_37510_c1 nmdc:mga05p37_37510_c1_4671_5366 231
84 3300050508 nmdc:mga09592_1422_c1 nmdc:mga09592_1422_c1_527_1222 231
85 3300050510 nmdc:mga06r32_20567_c1 nmdc:mga06r32_20567_c1_3180_3875 231
86 3300005548 Ga0070665_100250342 Ga0070665_1002503422 233
87 3300028379 Ga0268266_10119131 Ga0268266_101191312 233
88 3300031250 Ga0265331_10198715 Ga0265331_101987151 233
89 3300031712 Ga0265342_10098996 Ga0265342_100989962 233
90 3300046535 Ga0495586_0022066 Ga0495586_0022066_998_1756 233
91 3300049593 Ga0501077_0030891 Ga0501077_0030891_1987_2745 235
92 3300005356 Ga0070674_100070459 Ga0070674_1000704593 236
93 3300005456 Ga0070678_100568516 Ga0070678_1005685162 236
94 3300005445 Ga0070708_100019314 Ga0070708_1000193141 239
95 3300037853 Ga0436364_0254095 Ga0436364_0254095_1407_2162 239
96 3300003187 JGI25151J46595_10004304 JGI25151J46595_100043043 242
97 3300005841 Ga0068863_100371203 Ga0068863_1003712032 242
98 3300025294 Ga0209025_1000272 Ga0209025_100027262 242
99 3300035113 Ga0373936_0110414 Ga0373936_0110414_343_1071 242
100 3300035172 Ga0373955_0002241 Ga0373955_0002241_782_1510 242
101 3300053084 Ga0495595_0144481 Ga0495595_0144481_47_775 242
102 3300005328 Ga0070676_10036061 Ga0070676_100360611 243
103 3300005347 Ga0070668_100277407 Ga0070668_1002774072 243
104 3300005441 Ga0070700_100013129 Ga0070700_1000131293 243
105 3300005459 Ga0068867_100005317 Ga0068867_10000531713 243
106 3300005718 Ga0068866_10003878 Ga0068866_100038786 243
107 3300005719 Ga0068861_100001145 Ga0068861_10000114520 243
108 3300005842 Ga0068858_100072171 Ga0068858_1000721716 243
109 3300005843 Ga0068860_100003560 Ga0068860_10000356017 243
110 3300006881 Ga0068865_100007676 Ga0068865_1000076769 243
111 3300009098 Ga0105245_10599234 Ga0105245_105992342 243
112 3300013297 Ga0157378_10083933 Ga0157378_100839335 243
113 3300013306 Ga0163162_10009102 Ga0163162_100091025 243
114 3300014968 Ga0157379_10187931 Ga0157379_101879312 243
115 3300017792 Ga0163161_10031678 Ga0163161_100316784 243
116 3300025907 Ga0207645_10043587 Ga0207645_100435875 243
117 3300025940 Ga0207691_10250381 Ga0207691_102503812 243
118 3300026035 Ga0207703_10160222 Ga0207703_101602223 243
119 3300026075 Ga0207708_10043809 Ga0207708_100438094 243
120 3300026089 Ga0207648_10000556 Ga0207648_1000055621 243
121 3300026118 Ga0207675_100012870 Ga0207675_10001287011 243
122 3300028380 Ga0268265_10009005 Ga0268265_100090056 243
123 3300028381 Ga0268264_10003478 Ga0268264_100034786 243
124 3300005295 Ga0065707_10083747 Ga0065707_100837477 245
125 3300049571 Ga0501034_0725181 Ga0501034_0725181_140_877 245
126 3300030742 Ga0316183_1033629 Ga0316183_10336292 246
127 3300030745 Ga0316182_1132571 Ga0316182_11325712 246
128 iso_pu_bacteria 2920107658 2920113131 247
129 iso_pu_bacteria 2945945610 2945949436 247
130 iso_pu_bacteria 2643221683 2644466955 248
131 iso_pu_bacteria 2818991446 2819601067 248
132 iso_pu_bacteria 2831265667 2831271622 248
133 iso_pu_bacteria 2899924645 2899927587 248
134 iso_pu_bacteria 2904449895 2904450708 248
135 iso_pu_bacteria 2904456579 2904459792 248
136 iso_pu_bacteria 2904541872 2904547898 248
137 iso_pu_bacteria 2928084124 2928086935 248
138 iso_pu_bacteria 2929160207 2929161722 248
139 iso_pu_bacteria 2929520902 2929521425 248
140 iso_pu_bacteria 2945972063 2945973485 248
141 iso_pu_bacteria 2954767861 2954770907 248
142 3300036401 Ga0373937_0015128 Ga0373937_0015128_3697_4452 249
143 3300046454 Ga0495592_0150819 Ga0495592_0150819_494_1249 249
144 3300046511 Ga0495608_0201436 Ga0495608_0201436_228_983 249
145 3300047471 Ga0495684_0187319 Ga0495684_0187319_526_1281 249
146 3300009093 Ga0105240_10028434 Ga0105240_100284347 251
147 iso_pu_bacteria 2599185214 2599625759 251
148 iso_pu_bacteria 2599185226 2599673772 251
149 iso_pu_bacteria 2599185227 2599683442 251
150 iso_pu_bacteria 2599185229 2599695070 251
151 iso_pu_bacteria 2885198086 2885200932 251
152 iso_pu_bacteria 2885211737 2885214285 251
153 iso_pu_bacteria 2928070936 2928073151 251
154 3300002773 JGI25152J39213_1000643 JGI25152J39213_100064318 252
155 3300002773 JGI25152J39213_1001773 JGI25152J39213_10017739 252
156 3300002773 JGI25152J39213_1013927 JGI25152J39213_10139272 252
157 3300002774 JGI25150J39212_1002523 JGI25150J39212_10025232 252
158 3300002987 JGI25159J45721_1000618 JGI25159J45721_100061818 252
159 3300002987 JGI25159J45721_1009047 JGI25159J45721_10090472 252
160 3300003187 JGI25151J46595_10000720 JGI25151J46595_100007207 252
161 3300003187 JGI25151J46595_10001285 JGI25151J46595_1000128518 252
162 3300003187 JGI25151J46595_10037192 JGI25151J46595_100371922 252
163 3300003187 JGI25151J46595_10038008 JGI25151J46595_100380082 252
164 3300003215 JGI25153J46596_10000941 JGI25153J46596_1000094118 252
165 3300003215 JGI25153J46596_10030604 JGI25153J46596_100306042 252
166 3300003215 JGI25153J46596_10031231 JGI25153J46596_100312312 252
167 3300003354 JGI25160J50197_1000746 JGI25160J50197_100074618 252
168 3300003354 JGI25160J50197_1003671 JGI25160J50197_10036712 252
169 3300003374 JGI25161J50226_1001326 JGI25161J50226_10013262 252
170 3300003374 JGI25161J50226_1006164 JGI25161J50226_10061642 252
171 3300003374 JGI25161J50226_1008386 JGI25161J50226_10083862 252
172 3300003578 Ga0006562J51391_1039874 Ga0006562J51391_10398743 252
173 3300003578 Ga0006562J51391_1039876 Ga0006562J51391_10398762 252
174 3300003578 Ga0006562J51391_1104774 Ga0006562J51391_11047742 252
175 3300003578 Ga0006562J51391_1104775 Ga0006562J51391_11047752 252
176 3300003760 Ga0055527_1007787 Ga0055527_10077872 252
177 3300003761 Ga0055535_1000477 Ga0055535_10004772 252
178 3300003762 Ga0055542_1000022 Ga0055542_1000022246 252
179 3300003771 Ga0055526_1001330 Ga0055526_100133018 252
180 3300003771 Ga0055526_1004201 Ga0055526_10042012 252
181 3300003773 Ga0055537_1000381 Ga0055537_100038121 252
182 3300003773 Ga0055537_1000687 Ga0055537_100068718 252
183 3300003775 Ga0055524_1000997 Ga0055524_100099718 252
184 3300003775 Ga0055524_1001643 Ga0055524_10016432 252
185 3300003781 Ga0055536_1000337 Ga0055536_100033735 252
186 3300003781 Ga0055536_1000465 Ga0055536_100046514 252
187 3300003781 Ga0055536_1024073 Ga0055536_10240733 252
188 3300003784 Ga0055534_1000016 Ga0055534_100001644 252
189 3300003784 Ga0055534_1000564 Ga0055534_10005644 252
190 3300003790 Ga0055528_1000144 Ga0055528_100014436 252
191 3300003790 Ga0055528_1000877 Ga0055528_10008774 252
192 3300003791 Ga0055530_10000456 Ga0055530_100004564 252
193 3300003792 Ga0055540_1000458 Ga0055540_10004582 252
194 3300003792 Ga0055540_1000746 Ga0055540_10007466 252
195 3300003792 Ga0055540_1000844 Ga0055540_100084411 252
196 3300003794 Ga0055531_10000488 Ga0055531_100004884 252
197 3300003794 Ga0055531_10026157 Ga0055531_100261572 252
198 3300004625 Ga0055543_1001142 Ga0055543_100114212 252
199 3300004625 Ga0055543_1001312 Ga0055543_10013123 252
200 3300005262 Ga0065165_1007683 Ga0065165_10076837 252
201 3300005288 Ga0065714_10004476 Ga0065714_100044765 252
202 3300005337 Ga0070682_100052544 Ga0070682_1000525443 252
203 3300005337 Ga0070682_100242766 Ga0070682_1002427662 252
204 3300005341 Ga0070691_10086528 Ga0070691_100865282 252
205 3300005354 Ga0070675_100289277 Ga0070675_1002892772 252
206 3300005455 Ga0070663_100709177 Ga0070663_1007091771 252
207 3300005458 Ga0070681_10634515 Ga0070681_106345151 252
208 3300005530 Ga0070679_100301766 Ga0070679_1003017662 252
209 3300005539 Ga0068853_100002638 Ga0068853_10000263814 252
210 3300005539 Ga0068853_100009610 Ga0068853_1000096102 252
211 3300005539 Ga0068853_100113287 Ga0068853_1001132872 252
212 3300005563 Ga0068855_100258755 Ga0068855_1002587552 252
213 3300005563 Ga0068855_100288879 Ga0068855_1002888792 252
214 3300005577 Ga0068857_100046193 Ga0068857_1000461932 252
215 3300005614 Ga0068856_100296667 Ga0068856_1002966672 252
216 3300005616 Ga0068852_100169886 Ga0068852_1001698862 252
217 3300005834 Ga0068851_10009304 Ga0068851_100093046 252
218 3300005844 Ga0068862_100186011 Ga0068862_1001860113 252
219 3300005844 Ga0068862_100488368 Ga0068862_1004883681 252
220 3300006051 Ga0075364_10096395 Ga0075364_100963953 252
221 3300006051 Ga0075364_10172637 Ga0075364_101726372 252
222 3300006177 Ga0075362_10011862 Ga0075362_100118622 252
223 3300006178 Ga0075367_10048115 Ga0075367_100481152 252
224 3300006195 Ga0075366_10100193 Ga0075366_101001932 252
225 3300006353 Ga0075370_10000420 Ga0075370_1000042011 252
226 3300006353 Ga0075370_10040199 Ga0075370_100401993 252
227 3300006353 Ga0075370_10049583 Ga0075370_100495833 252
228 3300006353 Ga0075370_10147516 Ga0075370_101475162 252
229 3300006847 Ga0075431_100048183 Ga0075431_1000481834 252
230 3300009093 Ga0105240_10073311 Ga0105240_100733114 252
231 3300009148 Ga0105243_10001847 Ga0105243_1000184717 252
232 3300009148 Ga0105243_10042264 Ga0105243_100422646 252
233 3300009174 Ga0105241_10020303 Ga0105241_100203033 252
234 3300009545 Ga0105237_10049123 Ga0105237_100491233 252
235 3300009545 Ga0105237_10061298 Ga0105237_100612983 252
236 3300010375 Ga0105239_10104451 Ga0105239_101044512 252
237 3300013100 Ga0157373_10119024 Ga0157373_101190242 252
238 3300013100 Ga0157373_10218710 Ga0157373_102187102 252
239 3300013104 Ga0157370_10006457 Ga0157370_100064575 252
240 3300013105 Ga0157369_10016894 Ga0157369_100168944 252
241 3300013307 Ga0157372_10034145 Ga0157372_100341454 252
242 3300013307 Ga0157372_10119616 Ga0157372_101196165 252
243 3300014326 Ga0157380_10820902 Ga0157380_108209021 252
244 3300014497 Ga0182008_10012241 Ga0182008_100122415 252
245 3300017792 Ga0163161_10000088 Ga0163161_1000008810 252
246 3300017792 Ga0163161_10043125 Ga0163161_100431254 252
247 3300021388 Ga0213875_10094188 Ga0213875_100941882 252
248 3300025208 Ga0209436_105690 Ga0209436_1056902 252
249 3300025228 Ga0209672_104029 Ga0209672_1040292 252
250 3300025229 Ga0209147_100987 Ga0209147_10098711 252
251 3300025242 Ga0209258_100009 Ga0209258_100009909 252
252 3300025245 Ga0207425_1000169 Ga0207425_100016912 252
253 3300025245 Ga0207425_1018326 Ga0207425_10183261 252
254 3300025253 Ga0209677_100491 Ga0209677_10049110 252
255 3300025254 Ga0209148_1000007 Ga0209148_1000007909 252
256 3300025258 Ga0209129_1000024 Ga0209129_1000024162 252
257 3300025258 Ga0209129_1002535 Ga0209129_10025351 252
258 3300025258 Ga0209129_1004377 Ga0209129_10043772 252
259 3300025258 Ga0209129_1013109 Ga0209129_10131092 252
260 3300025263 Ga0209565_1000046 Ga0209565_1000046211 252
261 3300025263 Ga0209565_1000286 Ga0209565_100028642 252
262 3300025272 Ga0209455_1005471 Ga0209455_10054713 252
263 3300025273 Ga0209673_1000058 Ga0209673_1000058117 252
264 3300025273 Ga0209673_1000300 Ga0209673_10003005 252
265 3300025273 Ga0209673_1000410 Ga0209673_10004105 252
266 3300025273 Ga0209673_1005378 Ga0209673_10053784 252
267 3300025284 Ga0209130_1000157 Ga0209130_100015751 252
268 3300025284 Ga0209130_1000383 Ga0209130_100038342 252
269 3300025291 Ga0209675_1000010 Ga0209675_1000010148 252
270 3300025291 Ga0209675_1000151 Ga0209675_100015183 252
271 3300025292 Ga0209676_1000028 Ga0209676_1000028177 252
272 3300025292 Ga0209676_1000275 Ga0209676_100027560 252
273 3300025292 Ga0209676_1000581 Ga0209676_100058125 252
274 3300025292 Ga0209676_1024666 Ga0209676_10246662 252
275 3300025294 Ga0209025_1000289 Ga0209025_100028959 252
276 3300025294 Ga0209025_1001337 Ga0209025_100133711 252
277 3300025294 Ga0209025_1009321 Ga0209025_10093218 252
278 3300025294 Ga0209025_1023151 Ga0209025_10231511 252
279 3300025294 Ga0209025_1044655 Ga0209025_10446552 252
280 3300025295 Ga0209564_1000209 Ga0209564_100020911 252
281 3300025295 Ga0209564_1000326 Ga0209564_10003266 252
282 3300025297 Ga0209758_1000049 Ga0209758_100004981 252
283 3300025297 Ga0209758_1014963 Ga0209758_10149632 252
284 3300025297 Ga0209758_1037808 Ga0209758_10378082 252
285 3300025298 Ga0209050_1000002 Ga0209050_100000266 252
286 3300025298 Ga0209050_1000122 Ga0209050_100012254 252
287 3300025299 Ga0209256_1000088 Ga0209256_100008847 252
288 3300025299 Ga0209256_1000253 Ga0209256_100025363 252
289 3300025302 Ga0207426_1000038 Ga0207426_1000038241 252
290 3300025302 Ga0207426_1000053 Ga0207426_1000053117 252
291 3300025303 Ga0209051_1000015 Ga0209051_1000015106 252
292 3300025303 Ga0209051_1000168 Ga0209051_100016859 252
293 3300025303 Ga0209051_1000179 Ga0209051_100017961 252
294 3300025303 Ga0209051_1000496 Ga0209051_100049631 252
295 3300025303 Ga0209051_1000509 Ga0209051_100050926 252
296 3300025303 Ga0209051_1028614 Ga0209051_10286142 252
297 3300025304 Ga0209257_1000814 Ga0209257_10008146 252
298 3300025304 Ga0209257_1001051 Ga0209257_100105132 252
299 3300025321 Ga0207656_10112669 Ga0207656_101126692 252
300 3300025904 Ga0207647_10074704 Ga0207647_100747042 252
301 3300025909 Ga0207705_10098124 Ga0207705_100981241 252
302 3300025911 Ga0207654_10049090 Ga0207654_100490902 252
303 3300025913 Ga0207695_10066784 Ga0207695_100667844 252
304 3300025914 Ga0207671_10104794 Ga0207671_101047942 252
305 3300025919 Ga0207657_10006953 Ga0207657_1000695312 252
306 3300025924 Ga0207694_10060495 Ga0207694_100604953 252
307 3300025926 Ga0207659_10429164 Ga0207659_104291641 252
308 3300025935 Ga0207709_10000284 Ga0207709_1000028425 252
309 3300025935 Ga0207709_10009407 Ga0207709_100094076 252
310 3300025935 Ga0207709_10056076 Ga0207709_100560765 252
311 3300026041 Ga0207639_10004496 Ga0207639_1000449610 252
312 3300026041 Ga0207639_10017328 Ga0207639_100173285 252
313 3300026067 Ga0207678_10606381 Ga0207678_106063811 252
314 3300026078 Ga0207702_10121567 Ga0207702_101215672 252
315 3300026088 Ga0207641_10475874 Ga0207641_104758742 252
316 3300026089 Ga0207648_10059198 Ga0207648_100591983 252
317 3300026089 Ga0207648_10305519 Ga0207648_103055192 252
318 3300026116 Ga0207674_10051401 Ga0207674_100514013 252
319 3300026121 Ga0207683_10307692 Ga0207683_103076923 252
320 3300026142 Ga0207698_11001206 Ga0207698_110012061 252
321 3300027671 Ga0209588_1033679 Ga0209588_10336792 252
322 3300028380 Ga0268265_10418295 Ga0268265_104182951 252
323 3300028573 Ga0265334_10003596 Ga0265334_100035963 252
324 3300028577 Ga0265318_10064413 Ga0265318_100644132 252
325 3300028666 Ga0265336_10042458 Ga0265336_100424581 252
326 3300030736 Ga0316180_1069828 Ga0316180_10698282 252
327 3300031238 Ga0265332_10017433 Ga0265332_100174332 252
328 3300031238 Ga0265332_10043921 Ga0265332_100439211 252
329 3300031240 Ga0265320_10087112 Ga0265320_100871122 252
330 3300031247 Ga0265340_10001034 Ga0265340_1000103413 252
331 3300031249 Ga0265339_10019986 Ga0265339_100199862 252
332 3300031456 Ga0307513_10047318 Ga0307513_100473183 252
333 3300031548 Ga0307408_100006368 Ga0307408_1000063683 252
334 3300031548 Ga0307408_100223481 Ga0307408_1002234812 252
335 3300031595 Ga0265313_10116937 Ga0265313_101169371 252
336 3300031649 Ga0307514_10050558 Ga0307514_100505582 252
337 3300031649 Ga0307514_10270762 Ga0307514_102707622 252
338 3300031711 Ga0265314_10104984 Ga0265314_101049842 252
339 3300031712 Ga0265342_10080343 Ga0265342_100803432 252
340 3300031712 Ga0265342_10087233 Ga0265342_100872332 252
341 3300031727 Ga0316576_10027200 Ga0316576_100272002 252
342 3300031728 Ga0316578_10073973 Ga0316578_100739732 252
343 3300031731 Ga0307405_10073144 Ga0307405_100731442 252
344 3300031901 Ga0307406_10000486 Ga0307406_1000048617 252
345 3300031901 Ga0307406_10025407 Ga0307406_100254072 252
346 3300031901 Ga0307406_10217128 Ga0307406_102171282 252
347 3300031911 Ga0307412_10121971 Ga0307412_101219712 252
348 3300031995 Ga0307409_100006489 Ga0307409_1000064894 252
349 3300032002 Ga0307416_100032044 Ga0307416_1000320442 252
350 3300032002 Ga0307416_100057957 Ga0307416_1000579572 252
351 3300032002 Ga0307416_100524482 Ga0307416_1005244822 252
352 3300032004 Ga0307414_10012517 Ga0307414_100125174 252
353 3300032005 Ga0307411_10124629 Ga0307411_101246293 252
354 3300032126 Ga0307415_100004161 Ga0307415_1000041615 252
355 3300035117 Ga0373953_0004188 Ga0373953_0004188_1469_2239 252
356 3300035172 Ga0373955_0020020 Ga0373955_0020020_1937_2722 252
357 3300036712 Ga0316584_0194304 Ga0316584_0194304_179_946 252
358 3300037068 Ga0373925_0113682 Ga0373925_0113682_790_1560 252
359 3300037418 Ga0395900_0062990 Ga0395900_0062990_1292_2056 252
360 3300037466 Ga0395898_0080007 Ga0395898_0080007_1736_2500 252
361 3300038443 Ga0395901_0350027 Ga0395901_0350027_22_792 252
362 3300041411 Ga0439466_0050775 Ga0439466_0050775_300_1058 252
363 3300041453 Ga0451797_0287736 Ga0451797_0287736_766_1524 252
364 3300042002 Ga0439442_046863 Ga0439442_046863_31_789 252
365 3300042012 Ga0439455_0040871 Ga0439455_0040871_121_879 252
366 3300042014 Ga0439457_030854 Ga0439457_030854_405_1163 252
367 3300042122 Ga0450920_003019 Ga0450920_003019_148_906 252
368 3300042134 Ga0450898_021116 Ga0450898_021116_168_926 252
369 3300042135 Ga0450899_011639 Ga0450899_011639_44_802 252
370 3300042145 Ga0450906_002617 Ga0450906_002617_3074_3832 252
371 3300042147 Ga0450910_008745 Ga0450910_008745_33_791 252
372 3300042184 Ga0450908_007581 Ga0450908_007581_772_1530 252
373 3300042435 Ga0439434_0015635 Ga0439434_0015635_750_1508 252
374 3300042531 Ga0450918_001025 Ga0450918_001025_1955_2713 252
375 3300044656 Ga0466969_0085474 Ga0466969_0085474_278_1048 252
376 3300044694 Ga0466963_0146043 Ga0466963_0146043_52_822 252
377 3300044842 Ga0466957_0119196 Ga0466957_0119196_851_1621 252
378 3300045049 Ga0466959_0238043 Ga0466959_0238043_388_1158 252
379 3300045976 Ga0466967_0229166 Ga0466967_0229166_373_1143 252
380 3300046460 Ga0495638_0034018 Ga0495638_0034018_78_836 252
381 3300046460 Ga0495638_0038110 Ga0495638_0038110_358_1116 252
382 3300046462 Ga0495651_0030928 Ga0495651_0030928_2840_3610 252
383 3300046513 Ga0495616_0001372 Ga0495616_0001372_4860_5618 252
384 3300046518 Ga0495631_0000357 Ga0495631_0000357_20348_21106 252
385 3300046519 Ga0495632_0028005 Ga0495632_0028005_1561_2319 252
386 3300046533 Ga0495640_0041442 Ga0495640_0041442_1976_2746 252
387 3300046536 Ga0495587_0022519 Ga0495587_0022519_893_1663 252
388 3300046539 Ga0495621_0013528 Ga0495621_0013528_411_1169 252
389 3300046543 Ga0495645_0030003 Ga0495645_0030003_1245_2015 252
390 3300046559 Ga0495667_0055164 Ga0495667_0055164_1352_2122 252
391 3300046616 Ga0495668_0257666 Ga0495668_0257666_157_915 252
392 3300046642 Ga0495634_0084156 Ga0495634_0084156_309_1094 252
393 3300046660 Ga0495625_0023437 Ga0495625_0023437_1862_2620 252
394 3300046674 Ga0495588_0017874 Ga0495588_0017874_2374_3132 252
395 3300046675 Ga0495657_0061830 Ga0495657_0061830_1638_2408 252
396 3300046678 Ga0495599_0050288 Ga0495599_0050288_1329_2099 252
397 3300046680 Ga0495646_0114041 Ga0495646_0114041_410_1195 252
398 3300046683 Ga0495658_0112848 Ga0495658_0112848_285_1043 252
399 3300046694 Ga0495649_0002661 Ga0495649_0002661_4822_5580 252
400 3300046809 Ga0495600_0118974 Ga0495600_0118974_764_1534 252
401 3300047322 Ga0495680_0110046 Ga0495680_0110046_1074_1844 252
402 3300047470 Ga0495681_0040622 Ga0495681_0040622_830_1588 252
403 3300047673 Ga0495593_0024795 Ga0495593_0024795_1361_2119 252
404 3300048088 Ga0495602_0179989 Ga0495602_0179989_32_790 252
405 3300048088 Ga0495602_0193623 Ga0495602_0193623_10_780 252
406 3300048089 Ga0495614_0043684 Ga0495614_0043684_665_1423 252
407 3300048903 Ga0496100_0524981 Ga0496100_0524981_88_858 252
408 3300048905 Ga0496102_0351959 Ga0496102_0351959_110_868 252
409 3300048920 Ga0496117_0221267 Ga0496117_0221267_96_854 252
410 3300048921 Ga0496118_0007796 Ga0496118_0007796_10205_10963 252
411 3300048921 Ga0496118_0011373 Ga0496118_0011373_3164_3934 252
412 3300048924 Ga0496121_0043109 Ga0496121_0043109_3055_3825 252
413 3300048924 Ga0496121_0112126 Ga0496121_0112126_115_885 252
414 3300048926 Ga0496123_0181076 Ga0496123_0181076_100_858 252
415 3300048927 Ga0496124_0099455 Ga0496124_0099455_353_1111 252
416 3300048928 Ga0496125_0000090 Ga0496125_0000090_180878_181648 252
417 3300048928 Ga0496125_0030463 Ga0496125_0030463_1942_2700 252
418 3300048928 Ga0496125_0172703 Ga0496125_0172703_167_937 252
419 3300048929 Ga0496126_0020436 Ga0496126_0020436_2542_3312 252
420 3300049592 Ga0501076_0397971 Ga0501076_0397971_242_1000 252
421 3300049743 Ga0501081_0176580 Ga0501081_0176580_507_1265 252
422 3300049743 Ga0501081_0185799 Ga0501081_0185799_664_1422 252
423 3300049823 Ga0501044_0117100 Ga0501044_0117100_32_799 252
424 3300050490 nmdc:mga03n38_323832_c1 nmdc:mga03n38_323832_c1_54_812 252
425 3300050491 nmdc:mga00v17_266122_c1 nmdc:mga00v17_266122_c1_94_852 252
426 3300050491 nmdc:mga00v17_83274_c1 nmdc:mga00v17_83274_c1_92_850 252
427 3300050493 nmdc:mga0k408_12116_c1 nmdc:mga0k408_12116_c1_394_1152 252
428 3300050494 nmdc:mga06z11_224799_c1 nmdc:mga06z11_224799_c1_171_929 252
429 3300050496 nmdc:mga07m45_153827_c1 nmdc:mga07m45_153827_c1_416_1174 252
430 3300050496 nmdc:mga07m45_744_c1 nmdc:mga07m45_744_c1_13063_13821 252
431 3300050510 nmdc:mga06r32_238629_c1 nmdc:mga06r32_238629_c1_489_1247 252
432 3300050516 nmdc:mga0sz30_97307_c1 nmdc:mga0sz30_97307_c1_72_830 252
433 3300053093 Ga0500651_0003290 Ga0500651_0003290_5963_6721 252
434 3300053094 Ga0500566_0086204 Ga0500566_0086204_567_1325 252
435 3300053110 Ga0500571_041184 Ga0500571_041184_1412_2170 252
436 3300053118 Ga0500594_0000605 Ga0500594_0000605_388_1146 252
437 3300053121 Ga0500607_001419 Ga0500607_001419_20749_21507 252
438 3300053128 Ga0500626_018009 Ga0500626_018009_2040_2798 252
439 3300053133 Ga0500655_002769 Ga0500655_002769_165_923 252
440 3300053134 Ga0500658_0000671 Ga0500658_0000671_364_1122 252
441 3300053134 Ga0500658_0008577 Ga0500658_0008577_1391_2149 252
442 3300053136 Ga0500559_0006687 Ga0500559_0006687_4259_5017 252
443 3300053138 Ga0500564_057711 Ga0500564_057711_96_854 252
444 3300053141 Ga0500574_001300 Ga0500574_001300_591_1349 252
445 3300053161 Ga0500634_0036187 Ga0500634_0036187_263_1021 252
446 3300053162 Ga0500638_096775 Ga0500638_096775_163_921 252
447 3300053177 Ga0500636_0086514 Ga0500636_0086514_194_952 252
448 3300053734 Ga0500565_005492 Ga0500565_005492_56_814 252
449 3300053735 Ga0500596_015623 Ga0500596_015623_88_846 252
450 3300054114 Ga0501084_0238241 Ga0501084_0238241_325_1083 252
451 3300060353 Ga0501082_0147924 Ga0501082_0147924_277_1035 252
452 iso_pu_bacteria 2508501128 2509150388 252
453 iso_pu_bacteria 2513237098 2513678221 252
454 iso_pu_bacteria 2513237104 2513719577 252
455 iso_pu_bacteria 2667528175 2671122393 252
456 iso_pu_bacteria 2838054893 2838055535 252
457 iso_pu_bacteria 2885374607 2885375320 252
458 iso_pu_bacteria 2885383462 2885385448 252
459 iso_pu_bacteria 2903768456 2903774082 252
460 iso_pu_bacteria 2928037797 2928042501 252
461 iso_pu_bacteria 2928044640 2928049072 252
462 iso_pu_bacteria 2928051484 2928051626 252
463 iso_pu_bacteria 2928064002 2928070845 252
464 iso_pu_bacteria 8056673599 8056673985 252
465 iso_pu_bacteria 8056681323 8056688286 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

9

190

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

15

238

0.92

PF08659

KR

KR domain

10

167

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4y98-assembly1.cif.gz_A crystal structure of ligd-apo form from sphingobium sp. strain syk-6 0.9698 3 186
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9664 4 247
2ew8-assembly1.cif.gz_D crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 0.9643 4 248
8jfi-assembly2.cif.gz_E crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadp+ and 3-keto-hexanoyl-acp from helicobacter pylori 0.961 3 248
4cqm-assembly1.cif.gz_J crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9607 5 250
ID Description Score Start End Superfamily
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9782 4 186 3.40.50.720
4y98A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9698 3 186 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9635 4 182 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.963 2 82 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9621 2 196 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V6TDN1-F1-model_v4 2-deoxy-D-gluconate 3-dehydrogenase 0.9875 1 210 GO:0016616
GO:0030497
AF-A0A2D7SLN4-F1-model_v4 2-deoxy-D-gluconate 3-dehydrogenase 0.981 1 250 GO:0016616
AF-A0A0S6UUC8-F1-model_v4 2-deoxy-D-gluconate 3-dehydrogenase 0.9782 2 250 GO:0016616
AF-A0A7K1CQN7-F1-model_v4 deleted 0.9782 1 250
AF-A0A2V6TDN1-F1-model_v4 2-deoxy-D-gluconate 3-dehydrogenase 0.9737 1 210 GO:0016616
GO:0030497

Feature Viewer

pLDDT pTM Quality
93.5 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map