F449541

General Info

Members Datasets Scaffolds Average Seq Length
465 335 930 360

Family's Representative Sequence

Representative Sequence 3300046524|Ga0495648_0000328|Ga0495648_0000328_15550_16827
Length 425
Sequence VISRLEQISAYNATTLCGAARILGIFIQPDRNATMSNPPVSDQRAVPCILMRGGTSRGPFFLESDLPADAAARNQLLLAAMGSPDPRQIDGLGGAHPLTSKVGIVRRSTTPGVDLDFSFAQLQPDNDTVDVTPNCGNMLAAVLPFALERGLLPVAQGTTTARILTLNTGMQCDVTLQTPNGRLQYGGDARIDGVPGTASPISINFLDTVGSVCPALLPTGAPLNRIAVTATSRHAAQTADVGTGVAPIVSVEAFEVDATLIDNGMPMVLVRASDFGVTGYEPAAELTASAELRARLEALRLAAGPLMGLGDVAAKNYPKMCLISAPRDGGAVNTRCFIPHVCHDSIGVLAAVTVATACVLPGSLAEGIAATQPGARQTLSIEHPTGEFSVELELDPNNPGQVLRAALLRTARPIMRGEVLIPAHL

Samples

Sample ID Description Type Environment
1 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
54 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
55 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
56 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
57 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
62 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
64 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
65 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
96 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
97 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
98 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
99 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
100 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
101 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
102 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
103 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
104 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
105 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
106 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
107 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
110 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
111 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
112 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
113 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
114 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
117 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
120 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
121 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
124 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
125 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
126 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
127 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
130 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
131 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
132 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
133 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
134 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
139 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
140 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
141 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
142 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
143 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
144 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
145 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
146 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
147 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
148 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
149 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
155 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
156 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
157 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
158 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
159 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
160 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
165 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
183 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
184 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
185 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
186 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
187 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
188 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
189 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
190 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
193 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
194 2509276019 Ensifer aridi TW10 Isolate Nodule
195 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
196 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
197 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
198 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
199 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
200 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
201 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
202 2516143018 Ensifer sp. BR816 Isolate Nodule
203 2547132374 Acidovorax radicis N35 Isolate Unclassified
204 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
205 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
206 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
207 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
208 2643221570 Acidovorax sp. Root568 Isolate Unclassified
209 2643221609 Acidovorax sp. Root217 Isolate Unclassified
210 2643221611 Acidovorax sp. Root219 Isolate Unclassified
211 2643221652 Acidovorax sp. Root402 Isolate Unclassified
212 2643221717 Acidovorax sp. Root267 Isolate Unclassified
213 2643221723 Ensifer sp. Root278 Isolate Unclassified
214 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
215 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
216 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
217 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
218 2734482264 Dyella sp. AD052 Isolate Unclassified
219 2738541297 Duganella sp. GV083 Isolate Unclassified
220 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
221 2738541357 Duganella sp. GV053 Isolate Unclassified
222 2738543003 Duganella sp. GV066 Isolate Unclassified
223 2738543009 Luteibacter sp. OK325 Isolate Unclassified
224 2738543012 Acidovorax sp. CF301 Isolate Unclassified
225 2738543026 Duganella sp. GV089 Isolate Unclassified
226 2738543029 Duganella sp. GV039 Isolate Unclassified
227 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
228 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
229 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
230 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
231 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
232 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
233 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
234 2791355265 Rhizobium sp. H4 Isolate Nodule
235 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
236 2802429634 Rhizobium anhuiense S10 Isolate Nodule
237 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
238 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
239 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
240 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
241 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
242 2816332133 Acidovorax radicis 2721A Isolate Unclassified
243 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
244 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
245 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
246 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
247 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
248 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
249 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
250 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
251 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
252 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
253 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
254 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
255 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
256 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
257 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
258 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
259 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
260 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
261 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
262 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
263 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
264 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
265 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
266 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
267 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
268 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
269 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
270 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
271 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
272 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
273 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
274 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
275 2857564685 Duganella sp. R-74599 Isolate Unclassified
276 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
277 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
278 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
279 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
280 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
281 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
282 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
283 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
284 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
285 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
286 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
287 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
288 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
289 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
290 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
291 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
292 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
293 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
294 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
295 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
296 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
297 2919085039 Luteibacter sp. 1214 Isolate Unclassified
298 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
299 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
300 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
301 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
302 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
303 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
304 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
305 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
306 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
307 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
308 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
309 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
310 2941471342 Luteibacter sp. 621 Isolate Unclassified
311 2952252522 Salinicola sp. DM10 Isolate Unclassified
312 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
313 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
314 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
315 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
316 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
317 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
318 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
319 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
320 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
321 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
322 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
323 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
324 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
325 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
326 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
327 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
328 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
329 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
330 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
331 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
332 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
333 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
334 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
335 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 69.25
Metatranscriptomes 0
Isolates 30.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.99
Nodule 14.19
Rhizoplane 1.29
Rhizosphere 43.01
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495648_0000328 3300046524 Bacteria 52422
2 JGI24736J21556_1001307 3300001904 Bacteria 4567
3 JGI24740J21852_10000002 3300001979 Bacteria 158865
4 JGI24735J21928_10025980 3300002067 Bacteria 1764
5 JGI25162J39368_1000144 3300002737 Bacteria 77232
6 JGI25152J39213_1006505 3300002773 Bacteria 3167
7 JGI25150J39212_1002431 3300002774 Bacteria 4647
8 JGI25159J45721_1001625 3300002987 Bacteria 9143
9 JGI25151J46595_10000162 3300003187 Bacteria 86356
10 JGI25151J46595_10001390 3300003187 Bacteria 16685
11 JGI25151J46595_10002227 3300003187 Bacteria 11972
12 JGI25151J46595_10015023 3300003187 Bacteria 3432
13 JGI25406J46586_10005302 3300003203 Bacteria 5981
14 JGI25165J46597_1000075 3300003214 Bacteria 181212
15 JGI25153J46596_10007943 3300003215 Bacteria 5140
16 JGI25153J46596_10011794 3300003215 Bacteria 3835
17 rootH2_10009642 3300003320 Bacteria 34527
18 rootH2_10080170 3300003320 Bacteria 5981
19 rootL2_10018242 3300003322 Bacteria 15247
20 rootL2_10138337 3300003322 Bacteria 4657
21 rootH1_10159869 3300003323 Bacteria 6051
22 JGI25160J50197_1002208 3300003354 Bacteria 9143
23 JGI25161J50226_1001090 3300003374 Bacteria 9143
24 Ga0055542_1000797 3300003762 Bacteria 23317
25 Ga0055526_1000029 3300003771 Bacteria 148855
26 Ga0055526_1003147 3300003771 Bacteria 10689
27 Ga0055536_1005210 3300003781 Bacteria 6417
28 Ga0055536_1008430 3300003781 Bacteria 4426
29 Ga0055540_1014280 3300003792 Bacteria 2372
30 Ga0055531_10004242 3300003794 Bacteria 8818
31 Ga0055543_1000310 3300004625 Bacteria 33955
32 Ga0055543_1000822 3300004625 Bacteria 15203
33 Ga0065165_1001819 3300005262 Bacteria 20888
34 Ga0065165_1002081 3300005262 Bacteria 18368
35 Ga0065165_1004196 3300005262 Bacteria 9181
36 Ga0065707_10001627 3300005295 Bacteria 6301
37 Ga0070666_10000003 3300005335 Bacteria 463666
38 Ga0070661_100012005 3300005344 Bacteria 6053
39 Ga0070665_100043702 3300005548 Bacteria 4501
40 Ga0068855_100016956 3300005563 Bacteria 8760
41 Ga0068857_100019220 3300005577 Bacteria 5998
42 Ga0068854_100036656 3300005578 Bacteria 3439
43 Ga0068856_100080384 3300005614 Bacteria 3233
44 Ga0068858_100059154 3300005842 Bacteria 3542
45 Ga0081539_10000076 3300005985 Bacteria 229037
46 Ga0075364_10008309 3300006051 Bacteria 6199
47 Ga0075367_10026005 3300006178 Bacteria 3315
48 Ga0075369_10041403 3300006186 Bacteria 1972
49 Ga0105250_10000186 3300009092 Bacteria 53643
50 Ga0105240_10000236 3300009093 Bacteria 110204
51 Ga0105247_10044682 3300009101 Bacteria 2717
52 Ga0105237_10003670 3300009545 Bacteria 18091
53 Ga0105238_10004877 3300009551 Bacteria 13269
54 Ga0123341_1008686 3300009765 Bacteria 9285
55 Ga0105239_10000110 3300010375 Bacteria 115508
56 Ga0157370_10000858 3300013104 Bacteria 38572
57 Ga0157369_10001146 3300013105 Bacteria 33054
58 Ga0171463_1009 3300013249 Bacteria 288284
59 Ga0163162_10000378 3300013306 Bacteria 40518
60 Ga0182008_10048928 3300014497 Bacteria 2099
61 Ga0157379_10000207 3300014968 Bacteria 45489
62 Ga0182006_1000061 3300015261 Bacteria 156823
63 Ga0182006_1000802 3300015261 Bacteria 21095
64 Ga0182007_10027827 3300015262 Bacteria 1946
65 Ga0182005_1000036 3300015265 Bacteria 166586
66 Ga0183363_1251 3300015690 Bacteria 8986
67 Ga0214544_1007618 3300021320 Bacteria 18826
68 Ga0214542_1000014 3300021321 Bacteria 233825
69 Ga0214542_1028231 3300021321 Bacteria 2454
70 Ga0214543_1000003 3300021327 Bacteria 692327
71 Ga0214543_1000056 3300021327 Bacteria 134292
72 Ga0213872_10000547 3300021361 Bacteria 29250
73 Ga0209436_101175 3300025208 Bacteria 9633
74 Ga0209437_100131 3300025233 Bacteria 181264
75 Ga0207425_1001139 3300025245 Bacteria 11971
76 Ga0207425_1016755 3300025245 Bacteria 1622
77 Ga0209148_1000302 3300025254 Bacteria 70861
78 Ga0209148_1006061 3300025254 Bacteria 2666
79 Ga0209129_1001890 3300025258 Bacteria 11066
80 Ga0209129_1002589 3300025258 Bacteria 8672
81 Ga0209129_1002913 3300025258 Bacteria 7853
82 Ga0209233_1000132 3300025261 Bacteria 203971
83 Ga0209455_1000284 3300025272 Bacteria 54580
84 Ga0209673_1000022 3300025273 Bacteria 413125
85 Ga0209673_1000621 3300025273 Bacteria 54117
86 Ga0209130_1000234 3300025284 Bacteria 71914
87 Ga0209675_1016062 3300025291 Bacteria 2195
88 Ga0209676_1001969 3300025292 Bacteria 16369
89 Ga0209025_1000146 3300025294 Bacteria 180022
90 Ga0209025_1000418 3300025294 Bacteria 85091
91 Ga0209025_1001085 3300025294 Bacteria 39382
92 Ga0209025_1004748 3300025294 Bacteria 11560
93 Ga0209025_1053444 3300025294 Bacteria 1584
94 Ga0209564_1000009 3300025295 Bacteria 950196
95 Ga0209564_1000117 3300025295 Bacteria 207096
96 Ga0209564_1001607 3300025295 Bacteria 21963
97 Ga0209564_1003761 3300025295 Bacteria 9903
98 Ga0209758_1000603 3300025297 Bacteria 55707
99 Ga0209758_1000614 3300025297 Bacteria 55061
100 Ga0209758_1012086 3300025297 Bacteria 4888
101 Ga0209050_1006671 3300025298 Bacteria 6756
102 Ga0209256_1000565 3300025299 Bacteria 52844
103 Ga0209256_1000622 3300025299 Bacteria 48813
104 Ga0207426_1000299 3300025302 Bacteria 97846
105 Ga0207426_1000410 3300025302 Bacteria 71914
106 Ga0207426_1005203 3300025302 Bacteria 6040
107 Ga0209051_1003919 3300025303 Bacteria 9487
108 Ga0209051_1014268 3300025303 Bacteria 3718
109 Ga0209051_1015011 3300025303 Bacteria 3586
110 Ga0209257_1002072 3300025304 Bacteria 21152
111 Ga0209257_1008072 3300025304 Bacteria 6128
112 Ga0207696_1000072 3300025711 Bacteria 224214
113 Ga0207680_10000006 3300025903 Bacteria 635950
114 Ga0207647_10000237 3300025904 Bacteria 45127
115 Ga0207705_10316817 3300025909 Bacteria 1198
116 Ga0207695_10000207 3300025913 Bacteria 160390
117 Ga0207695_10001342 3300025913 Bacteria 41747
118 Ga0207671_10134248 3300025914 Bacteria 1902
119 Ga0207694_10004641 3300025924 Bacteria 10694
120 Ga0207667_10009983 3300025949 Bacteria 11135
121 Ga0207703_10134084 3300026035 Bacteria 2142
122 Ga0207702_10060630 3300026078 Bacteria 3225
123 Ga0209371_1000821 3300027312 Bacteria 25570
124 Ga0268266_10000021 3300028379 Bacteria 522453
125 Ga0268256_1000474 3300030500 Bacteria 34547
126 Ga0307408_100061180 3300031548 Bacteria 2748
127 Ga0307408_100314102 3300031548 Bacteria 1318
128 Ga0307412_10000680 3300031911 Bacteria 19712
129 Ga0307510_10008270 3300033180 Bacteria 12399
130 Ga0395905_0086103 3300037471 Bacteria 2945
131 Ga0436361_0527730 3300039447 Bacteria 33218
132 Ga0439436_0038647 3300041404 Bacteria 1372
133 Ga0439465_0007071 3300041413 Bacteria 3566
134 Ga0451835_0842717 3300041492 Bacteria 7578
135 Ga0451837_1735123 3300041494 Bacteria 6003
136 Ga0451839_0809352 3300041496 Bacteria 6794
137 Ga0451841_0076186 3300041498 Bacteria 14121
138 Ga0451845_0279688 3300041501 Bacteria 5115
139 Ga0451847_0353095 3300041503 Bacteria 6606
140 Ga0451849_0356336 3300041505 Bacteria 6650
141 Ga0451851_0671713 3300041507 Bacteria 6075
142 Ga0451843_1145762 3300041509 Bacteria 6496
143 Ga0451855_1072631 3300041511 Bacteria 4476
144 Ga0451853_1661544 3300041512 Bacteria 4200
145 Ga0450908_000040 3300042184 Bacteria 25605
146 Ga0466982_0000162 3300044672 Bacteria 16814
147 Ga0466965_0027638 3300044683 Bacteria 2755
148 Ga0495617_000003 3300046452 Bacteria 541914
149 Ga0495617_000114 3300046452 Bacteria 56455
150 Ga0495617_000412 3300046452 Bacteria 23404
151 Ga0495590_0015416 3300046457 Bacteria 2775
152 Ga0495638_0000148 3300046460 Bacteria 110710
153 Ga0495638_0013155 3300046460 Bacteria 5646
154 Ga0495653_0000002 3300046463 Bacteria 507262
155 Ga0495650_0000457 3300046471 Bacteria 63668
156 Ga0495650_0000564 3300046471 Bacteria 52182
157 Ga0495650_0000653 3300046471 Bacteria 45690
158 Ga0495650_0001488 3300046471 Bacteria 22356
159 Ga0495605_0000068 3300046474 Bacteria 137743
160 Ga0495585_0000063 3300046492 Bacteria 109530
161 Ga0495585_0003226 3300046492 Bacteria 11126
162 Ga0495585_0003309 3300046492 Bacteria 10940
163 Ga0495596_0026988 3300046500 Bacteria 2312
164 Ga0495607_0000029 3300046501 Bacteria 155005
165 Ga0495607_0000100 3300046501 Bacteria 91570
166 Ga0495607_0010394 3300046501 Bacteria 6259
167 Ga0495583_0000160 3300046506 Bacteria 113560
168 Ga0495606_0000001 3300046507 Bacteria 592123
169 Ga0495606_0000351 3300046507 Bacteria 78808
170 Ga0495606_0000427 3300046507 Bacteria 70054
171 Ga0495606_0009348 3300046507 Bacteria 8307
172 Ga0495606_0136142 3300046507 Bacteria 1454
173 Ga0495610_0000003 3300046512 Bacteria 1203910
174 Ga0495610_0005195 3300046512 Bacteria 9323
175 Ga0495610_0006502 3300046512 Bacteria 8025
176 Ga0495616_0000183 3300046513 Bacteria 53040
177 Ga0495616_0071680 3300046513 Bacteria 1674
178 Ga0495620_0000090 3300046515 Bacteria 73605
179 Ga0495620_0012505 3300046515 Bacteria 4379
180 Ga0495631_0000055 3300046518 Bacteria 69950
181 Ga0495631_0000458 3300046518 Bacteria 27678
182 Ga0495631_0003605 3300046518 Bacteria 8447
183 Ga0495632_0004019 3300046519 Bacteria 10164
184 Ga0495632_0005237 3300046519 Bacteria 8630
185 Ga0495632_0021572 3300046519 Bacteria 3469
186 Ga0495643_0072622 3300046522 Bacteria 1804
187 Ga0495644_0025930 3300046523 Bacteria 2224
188 Ga0495648_0000324 3300046524 Bacteria 53060
189 Ga0495648_0005227 3300046524 Bacteria 10854
190 Ga0495648_0019556 3300046524 Bacteria 4758
191 Ga0495642_0057561 3300046528 Bacteria 1607
192 Ga0495654_0013276 3300046530 Bacteria 4412
193 Ga0495609_0015702 3300046538 Bacteria 3540
194 Ga0495597_0001231 3300046542 Bacteria 19066
195 Ga0495597_0112907 3300046542 Bacteria 1138
196 Ga0495633_0029457 3300046558 Bacteria 2671
197 Ga0495668_0000095 3300046616 Bacteria 141321
198 Ga0495668_0000437 3300046616 Bacteria 53630
199 Ga0495668_0014476 3300046616 Bacteria 4623
200 Ga0495668_0114183 3300046616 Bacteria 1477
201 Ga0495611_0000003 3300046648 Bacteria 395679
202 Ga0495611_0000018 3300046648 Bacteria 126654
203 Ga0495611_0039521 3300046648 Bacteria 2100
204 Ga0495625_0000019 3300046660 Bacteria 298330
205 Ga0495625_0007982 3300046660 Bacteria 9095
206 Ga0495625_0021457 3300046660 Bacteria 4975
207 Ga0495625_0037328 3300046660 Bacteria 3565
208 Ga0495625_0052768 3300046660 Bacteria 2910
209 Ga0495625_0096971 3300046660 Bacteria 2030
210 Ga0495661_0001253 3300046665 Bacteria 21924
211 Ga0495661_0023855 3300046665 Bacteria 3965
212 Ga0495661_0025609 3300046665 Bacteria 3809
213 Ga0495670_0003618 3300046691 Bacteria 7591
214 Ga0495670_0094988 3300046691 Bacteria 1529
215 Ga0495671_0000010 3300046692 Bacteria 368641
216 Ga0495671_0000611 3300046692 Bacteria 26141
217 Ga0495671_0011248 3300046692 Bacteria 4934
218 Ga0495649_0000715 3300046694 Bacteria 27013
219 Ga0495649_0006019 3300046694 Bacteria 7593
220 Ga0495649_0030153 3300046694 Bacteria 2996
221 Ga0495589_0000018 3300046794 Bacteria 204851
222 Ga0495589_0060422 3300046794 Bacteria 1861
223 Ga0495660_0000164 3300046810 Bacteria 71324
224 Ga0495660_0000223 3300046810 Bacteria 56336
225 Ga0495683_0001383 3300047323 Bacteria 16072
226 Ga0495677_0006096 3300047445 Bacteria 4558
227 Ga0495677_0022598 3300047445 Bacteria 2281
228 Ga0495679_000017 3300047446 Bacteria 263230
229 Ga0495679_023404 3300047446 Bacteria 2095
230 Ga0495673_0000003 3300047469 Bacteria 1491337
231 Ga0495673_0000004 3300047469 Bacteria 1354526
232 Ga0495673_0000016 3300047469 Bacteria 580643
233 Ga0495673_0000133 3300047469 Bacteria 137275
234 Ga0495673_0000318 3300047469 Bacteria 62287
235 Ga0495686_0000033 3300047472 Bacteria 342031
236 Ga0495686_0007793 3300047472 Bacteria 7968
237 Ga0495686_0009430 3300047472 Bacteria 7031
238 Ga0495686_0027170 3300047472 Bacteria 3738
239 Ga0495686_0028491 3300047472 Bacteria 3637
240 Ga0495626_0007741 3300048091 Bacteria 5953
241 Ga0495626_0009104 3300048091 Bacteria 5386
242 Ga0495626_0009717 3300048091 Bacteria 5183
243 Ga0495626_0023942 3300048091 Bacteria 2999
244 Ga0495626_0038465 3300048091 Bacteria 2268
245 Ga0496102_0048907 3300048905 Bacteria 3846
246 Ga0496104_0107254 3300048907 Bacteria 2676
247 Ga0496105_0000587 3300048908 Bacteria 24213
248 Ga0496107_0072073 3300048910 Bacteria 2511
249 Ga0496117_0019850 3300048920 Bacteria 5502
250 Ga0496117_0021293 3300048920 Bacteria 5251
251 Ga0496117_0111165 3300048920 Bacteria 1706
252 Ga0496118_0000865 3300048921 Bacteria 47971
253 Ga0496118_0006417 3300048921 Bacteria 12929
254 Ga0496118_0007263 3300048921 Bacteria 11811
255 Ga0496119_0000029 3300048922 Bacteria 243194
256 Ga0496119_0013661 3300048922 Bacteria 6443
257 Ga0496120_0000039 3300048923 Bacteria 202237
258 Ga0496121_0000109 3300048924 Bacteria 187307
259 Ga0496121_0000408 3300048924 Bacteria 85494
260 Ga0496121_0000633 3300048924 Bacteria 65667
261 Ga0496121_0000922 3300048924 Bacteria 53157
262 Ga0496121_0029177 3300048924 Bacteria 5111
263 Ga0496121_0036240 3300048924 Bacteria 4399
264 Ga0496121_0077179 3300048924 Bacteria 2653
265 Ga0496121_0158870 3300048924 Bacteria 1655
266 Ga0496121_0279235 3300048924 Bacteria 1143
267 Ga0496122_0010820 3300048925 Bacteria 9344
268 Ga0496122_0013752 3300048925 Bacteria 7891
269 Ga0496122_0016368 3300048925 Bacteria 7021
270 Ga0496122_0043065 3300048925 Bacteria 3542
271 Ga0496122_0159425 3300048925 Bacteria 1378
272 Ga0496123_0003670 3300048926 Bacteria 16942
273 Ga0496123_0028107 3300048926 Bacteria 4171
274 Ga0496123_0067543 3300048926 Bacteria 2257
275 Ga0496123_0080283 3300048926 Bacteria 1989
276 Ga0496123_0102124 3300048926 Bacteria 1665
277 Ga0496124_0004873 3300048927 Bacteria 15435
278 Ga0496125_0000093 3300048928 Bacteria 210896
279 Ga0496125_0000376 3300048928 Bacteria 83515
280 Ga0496125_0013631 3300048928 Bacteria 7981
281 Ga0496125_0088219 3300048928 Bacteria 2339
282 Ga0496125_0143355 3300048928 Bacteria 1657
283 Ga0496126_0004543 3300048929 Bacteria 16500
284 Ga0496126_0013643 3300048929 Bacteria 8248
285 Ga0496126_0027549 3300048929 Bacteria 5426
286 Ga0496126_0031219 3300048929 Bacteria 5037
287 Ga0495678_000152 3300049459 Bacteria 83891
288 Ga0495682_0001052 3300049460 Bacteria 16275
289 Ga0501038_0013297 3300049574 Bacteria 7505
290 Ga0501039_0091631 3300049575 Bacteria 2369
291 Ga0501040_0010626 3300049576 Bacteria 6020
292 Ga0501041_0004798 3300049577 Bacteria 7855
293 Ga0501041_0020846 3300049577 Bacteria 3923
294 Ga0501042_0040398 3300049578 Bacteria 3316
295 Ga0501048_0022502 3300049582 Bacteria 4609
296 Ga0501069_0044185 3300049585 Bacteria 2467
297 Ga0501070_0067011 3300049586 Bacteria 2973
298 Ga0501071_0008075 3300049587 Bacteria 6942
299 Ga0501072_0000859 3300049588 Bacteria 22302
300 Ga0501075_0005752 3300049591 Bacteria 8482
301 Ga0501075_0018233 3300049591 Bacteria 5076
302 Ga0501076_0023698 3300049592 Bacteria 4734
303 Ga0501077_0079815 3300049593 Bacteria 2073
304 Ga0501077_0122569 3300049593 Bacteria 1648
305 Ga0501079_0009427 3300049741 Bacteria 7399
306 Ga0501045_0004967 3300049824 Bacteria 9217
307 Ga0501045_0057165 3300049824 Bacteria 2854
308 nmdc:mga00v17_19841_c1 3300050491 Bacteria 3844
309 Ga0500643_000029 3300053087 Bacteria 211149
310 Ga0500555_000768 3300053103 Bacteria 11792
311 Ga0500572_001181 3300053111 Bacteria 7473
312 Ga0500593_000250 3300053117 Bacteria 22072
313 Ga0500618_015224 3300053125 Bacteria 1947
314 Ga0500618_015703 3300053125 Bacteria 1908
315 Ga0500618_022006 3300053125 Bacteria 1552
316 Ga0500568_0000221 3300053139 Bacteria 48978
317 Ga0500633_0000751 3300053160 Bacteria 5530
318 Ga0500636_0001339 3300053177 Bacteria 13366
319 Ga0500645_000287 3300053730 Bacteria 36290
320 Ga0501084_0016268 3300054114 Bacteria 6176
321 Ga0501084_0089176 3300054114 Bacteria 2589
322 Ga0530510_0022225 3300061734 Bacteria 4517
323 2509107271 2508501122 Bacteria 6292184
324 2509374762 2509276019 Bacteria 6802256
325 2510899576 2510461076 Bacteria 8618824
326 2513569951 2513237084 Bacteria 7231967
327 2513868678 2513237138 Bacteria 7368160
328 2513909315 2513237144 Bacteria 7530820
329 2513924704 2513237146 Bacteria 7166346
330 2514023323 2513237162 Bacteria 7468464
331 2515632505 2515154113 Bacteria 7807172
332 2516206313 2516143018 Bacteria 6951533
333 2548500518 2547132374 Bacteria 5530232
334 2585394556 2582581866 Bacteria 6859583
335 2585404854 2582581867 Bacteria 7184437
336 2585902624 2585427608 Bacteria 6544331
337 2599416257 2599185170 Bacteria 7295545
338 2643864469 2643221570 Bacteria 5103772
339 2644058160 2643221609 Bacteria 6756331
340 2644073200 2643221611 Bacteria 6820941
341 2644291841 2643221652 Bacteria 5140275
342 2644646933 2643221717 Bacteria 5676132
343 2644672051 2643221723 Bacteria 7095460
344 2657685964 2657244999 Bacteria 5946535
345 2671115525 2667528174 Bacteria 6435400
346 2692317940 2690316117 Bacteria 6800650
347 2721025881 2718218334 Bacteria 4765486
348 2735834155 2734482264 Unclassified 5014763
349 2738829761 2738541297 Bacteria 6549566
350 2739034501 2738541333 Bacteria 7106503
351 2739153557 2738541357 Bacteria 6549408
352 2739195477 2738543003 Bacteria 6549560
353 2739225565 2738543009 Bacteria 4944499
354 2739244493 2738543012 Bacteria 7115078
355 2739321953 2738543026 Bacteria 6549408
356 2739340194 2738543029 Bacteria 6549249
357 2753459171 2751185821 Bacteria 6189929
358 2765464485 2765235802 Bacteria 5618596
359 2776268355 2775506902 Bacteria 6208009
360 2776280300 2775506904 Bacteria 5954060
361 2792583707 2791355082 Bacteria 5973319
362 2792629920 2791355092 Bacteria 6248105
363 2792641284 2791355094 Bacteria 7011481
364 2793355225 2791355265 Bacteria 6539969
365 2804755453 2802429268 Bacteria 6094027
366 2806055647 2802429634 Bacteria 7083200
367 2806061327 2802429635 Bacteria 7650140
368 2806069851 2802429636 Bacteria 7597525
369 2808984142 2808606386 Bacteria 4471946
370 2809131946 2808606415 Bacteria 4576710
371 2809151569 2808606419 Bacteria 4576925
372 2816469936 2816332133 Bacteria 7249298
373 2819566082 2818991440 Bacteria 4774720
374 2819610805 2818991448 Bacteria 6772224
375 2838030391 2838029111 Bacteria 6603031
376 2838036381 2838035591 Bacteria 7166484
377 2838079118 2838074704 Bacteria 6785777
378 2838668492 2838661181 Bacteria 7385261
379 2838684233 2838680041 Bacteria 6545511
380 2838699723 2838694306 Bacteria 6853137
381 2838711991 2838707686 Bacteria 6619912
382 2842081699 2842077413 Bacteria 6508645
383 2842122275 2842118031 Bacteria 7033875
384 2842241403 2842237096 Bacteria 6620661
385 2842289847 2842285085 Bacteria 6011953
386 2842295355 2842291075 Bacteria 7076806
387 2842375898 2842370503 Bacteria 7038661
388 2842381870 2842377471 Bacteria 7140707
389 2842388824 2842384541 Bacteria 7057858
390 2842400327 2842395702 Bacteria 6780583
391 2842407013 2842402390 Bacteria 6681310
392 2842413905 2842409023 Bacteria 6687331
393 2842420547 2842415677 Bacteria 6596907
394 2842477329 2842475841 Bacteria 6603183
395 2842504126 2842502639 Bacteria 6604161
396 2842778627 2842775625 Bacteria 5587290
397 2842920574 2842918807 Bacteria 4289178
398 2847423559 2847417321 Bacteria 6913799
399 2848997332 2848992105 Bacteria 6810864
400 2850080209 2850079185 Bacteria 6848280
401 2852622972 2852618963 Bacteria 4577824
402 2854683223 2854681122 Bacteria 4548679
403 2854922531 2854916844 Bacteria 5725939
404 2856342332 2856342000 Bacteria 7176905
405 2857567036 2857564685 Bacteria 6290584
406 2874127213 2874123672 Bacteria 7238285
407 2884339218 2884338543 Bacteria 4610696
408 2885306710 2885305155 Bacteria 7348390
409 2885328670 2885326080 Bacteria 7134805
410 2885338821 2885334103 Bacteria 7216818
411 2888346636 2888343758 Bacteria 6611049
412 2896385748 2896384573 Bacteria 7700774
413 2899278526 2899275550 Bacteria 3958688
414 2903453180 2903448605 Bacteria 7357801
415 2904440012 2904439833 Bacteria 5931679
416 2904466353 2904463128 Bacteria 4775606
417 2904479825 2904479285 Bacteria 5073931
418 2904531040 2904530477 Bacteria 5876334
419 2904583800 2904578770 Bacteria 5302906
420 2904587315 2904584206 Bacteria 6028872
421 2904592650 2904589729 Bacteria 6113573
422 2904604568 2904601388 Bacteria 5884906
423 2913301067 2913295892 Bacteria 6333755
424 2917704944 2917699015 Bacteria 7043791
425 2919050340 2919046199 Bacteria 5567169
426 2919082389 2919079590 Bacteria 5946433
427 2919086068 2919085039 Bacteria 4532964
428 2919104882 2919100787 Bacteria 7710546
429 2919124414 2919119836 Bacteria 5208557
430 2919412181 2919408235 Bacteria 6149349
431 2920766419 2920760137 Bacteria 7427611
432 2920826233 2920822456 Bacteria 6897201
433 2923561832 2923556063 Bacteria 6793593
434 2928524853 2928521798 Bacteria 4960112
435 2929143826 2929138655 Bacteria 5810547
436 2933017262 2933016740 Bacteria 6355406
437 2935898426 2935894831 Bacteria 6620579
438 2936370478 2936367885 Bacteria 7324495
439 2936378138 2936375103 Bacteria 6652732
440 2941475838 2941471342 Bacteria 5018624
441 2952254287 2952252522 Bacteria 4171745
442 2953995862 2953994433 Bacteria 4303959
443 2954011525 2954011201 Bacteria 4762601
444 2957420739 2957415311 Bacteria 6991633
445 2968086546 2968083720 Bacteria 7351627
446 2990715055 2990710928 Bacteria 5002431
447 3004211222 3004203850 Bacteria 7307914
448 3005419839 3005416602 Bacteria 7064308
449 3005447586 3005445848 Bacteria 6906074
450 637078850 637000159 Bacteria 7596297
451 643822480 643692032 Bacteria 6891900
452 8005289455 8005289223 Bacteria 6634003
453 8005305213 8005301065 Bacteria 6614431
454 8005382148 8005376324 Bacteria 6590079
455 8005486781 8005484373 Bacteria 6297373
456 8005651452 8005645114 Bacteria 6950293
457 8005661087 8005658619 Bacteria 4500593
458 8005685779 8005682033 Bacteria 6726518
459 8005689235 8005688590 Bacteria 6610080
460 8005701233 8005695170 Bacteria 6912330
461 8024485808 8024479707 Bacteria 6954785
462 8049298069 8049293176 Bacteria 6128433
463 8055434810 8055431914 Bacteria 4551896
464 8055619051 8055617313 Bacteria 7548464
465 8057163693 8057160832 Bacteria 3268302
466 Ga0495648_0000328
467 JGI24736J21556_1001307
468 JGI24740J21852_10000002
469 JGI24735J21928_10025980
470 JGI25162J39368_1000144
471 JGI25152J39213_1006505
472 JGI25150J39212_1002431
473 JGI25159J45721_1001625
474 JGI25151J46595_10000162
475 JGI25151J46595_10001390
476 JGI25151J46595_10002227
477 JGI25151J46595_10015023
478 JGI25406J46586_10005302
479 JGI25165J46597_1000075
480 JGI25153J46596_10007943
481 JGI25153J46596_10011794
482 rootH2_10009642
483 rootH2_10080170
484 rootL2_10018242
485 rootL2_10138337
486 rootH1_10159869
487 JGI25160J50197_1002208
488 JGI25161J50226_1001090
489 Ga0055542_1000797
490 Ga0055526_1000029
491 Ga0055526_1003147
492 Ga0055536_1005210
493 Ga0055536_1008430
494 Ga0055540_1014280
495 Ga0055531_10004242
496 Ga0055543_1000310
497 Ga0055543_1000822
498 Ga0065165_1001819
499 Ga0065165_1002081
500 Ga0065165_1004196
501 Ga0065707_10001627
502 Ga0070666_10000003
503 Ga0070661_100012005
504 Ga0070665_100043702
505 Ga0068855_100016956
506 Ga0068857_100019220
507 Ga0068854_100036656
508 Ga0068856_100080384
509 Ga0068858_100059154
510 Ga0081539_10000076
511 Ga0075364_10008309
512 Ga0075367_10026005
513 Ga0075369_10041403
514 Ga0105250_10000186
515 Ga0105240_10000236
516 Ga0105247_10044682
517 Ga0105237_10003670
518 Ga0105238_10004877
519 Ga0123341_1008686
520 Ga0105239_10000110
521 Ga0157370_10000858
522 Ga0157369_10001146
523 Ga0171463_1009
524 Ga0163162_10000378
525 Ga0182008_10048928
526 Ga0157379_10000207
527 Ga0182006_1000061
528 Ga0182006_1000802
529 Ga0182007_10027827
530 Ga0182005_1000036
531 Ga0183363_1251
532 Ga0214544_1007618
533 Ga0214542_1000014
534 Ga0214542_1028231
535 Ga0214543_1000003
536 Ga0214543_1000056
537 Ga0213872_10000547
538 Ga0209436_101175
539 Ga0209437_100131
540 Ga0207425_1001139
541 Ga0207425_1016755
542 Ga0209148_1000302
543 Ga0209148_1006061
544 Ga0209129_1001890
545 Ga0209129_1002589
546 Ga0209129_1002913
547 Ga0209233_1000132
548 Ga0209455_1000284
549 Ga0209673_1000022
550 Ga0209673_1000621
551 Ga0209130_1000234
552 Ga0209675_1016062
553 Ga0209676_1001969
554 Ga0209025_1000146
555 Ga0209025_1000418
556 Ga0209025_1001085
557 Ga0209025_1004748
558 Ga0209025_1053444
559 Ga0209564_1000009
560 Ga0209564_1000117
561 Ga0209564_1001607
562 Ga0209564_1003761
563 Ga0209758_1000603
564 Ga0209758_1000614
565 Ga0209758_1012086
566 Ga0209050_1006671
567 Ga0209256_1000565
568 Ga0209256_1000622
569 Ga0207426_1000299
570 Ga0207426_1000410
571 Ga0207426_1005203
572 Ga0209051_1003919
573 Ga0209051_1014268
574 Ga0209051_1015011
575 Ga0209257_1002072
576 Ga0209257_1008072
577 Ga0207696_1000072
578 Ga0207680_10000006
579 Ga0207647_10000237
580 Ga0207705_10316817
581 Ga0207695_10000207
582 Ga0207695_10001342
583 Ga0207671_10134248
584 Ga0207694_10004641
585 Ga0207667_10009983
586 Ga0207703_10134084
587 Ga0207702_10060630
588 Ga0209371_1000821
589 Ga0268266_10000021
590 Ga0268256_1000474
591 Ga0307408_100061180
592 Ga0307408_100314102
593 Ga0307412_10000680
594 Ga0307510_10008270
595 Ga0395905_0086103
596 Ga0436361_0527730
597 Ga0439436_0038647
598 Ga0439465_0007071
599 Ga0451835_0842717
600 Ga0451837_1735123
601 Ga0451839_0809352
602 Ga0451841_0076186
603 Ga0451845_0279688
604 Ga0451847_0353095
605 Ga0451849_0356336
606 Ga0451851_0671713
607 Ga0451843_1145762
608 Ga0451855_1072631
609 Ga0451853_1661544
610 Ga0450908_000040
611 Ga0466982_0000162
612 Ga0466965_0027638
613 Ga0495617_000003
614 Ga0495617_000114
615 Ga0495617_000412
616 Ga0495590_0015416
617 Ga0495638_0000148
618 Ga0495638_0013155
619 Ga0495653_0000002
620 Ga0495650_0000457
621 Ga0495650_0000564
622 Ga0495650_0000653
623 Ga0495650_0001488
624 Ga0495605_0000068
625 Ga0495585_0000063
626 Ga0495585_0003226
627 Ga0495585_0003309
628 Ga0495596_0026988
629 Ga0495607_0000029
630 Ga0495607_0000100
631 Ga0495607_0010394
632 Ga0495583_0000160
633 Ga0495606_0000001
634 Ga0495606_0000351
635 Ga0495606_0000427
636 Ga0495606_0009348
637 Ga0495606_0136142
638 Ga0495610_0000003
639 Ga0495610_0005195
640 Ga0495610_0006502
641 Ga0495616_0000183
642 Ga0495616_0071680
643 Ga0495620_0000090
644 Ga0495620_0012505
645 Ga0495631_0000055
646 Ga0495631_0000458
647 Ga0495631_0003605
648 Ga0495632_0004019
649 Ga0495632_0005237
650 Ga0495632_0021572
651 Ga0495643_0072622
652 Ga0495644_0025930
653 Ga0495648_0000324
654 Ga0495648_0005227
655 Ga0495648_0019556
656 Ga0495642_0057561
657 Ga0495654_0013276
658 Ga0495609_0015702
659 Ga0495597_0001231
660 Ga0495597_0112907
661 Ga0495633_0029457
662 Ga0495668_0000095
663 Ga0495668_0000437
664 Ga0495668_0014476
665 Ga0495668_0114183
666 Ga0495611_0000003
667 Ga0495611_0000018
668 Ga0495611_0039521
669 Ga0495625_0000019
670 Ga0495625_0007982
671 Ga0495625_0021457
672 Ga0495625_0037328
673 Ga0495625_0052768
674 Ga0495625_0096971
675 Ga0495661_0001253
676 Ga0495661_0023855
677 Ga0495661_0025609
678 Ga0495670_0003618
679 Ga0495670_0094988
680 Ga0495671_0000010
681 Ga0495671_0000611
682 Ga0495671_0011248
683 Ga0495649_0000715
684 Ga0495649_0006019
685 Ga0495649_0030153
686 Ga0495589_0000018
687 Ga0495589_0060422
688 Ga0495660_0000164
689 Ga0495660_0000223
690 Ga0495683_0001383
691 Ga0495677_0006096
692 Ga0495677_0022598
693 Ga0495679_000017
694 Ga0495679_023404
695 Ga0495673_0000003
696 Ga0495673_0000004
697 Ga0495673_0000016
698 Ga0495673_0000133
699 Ga0495673_0000318
700 Ga0495686_0000033
701 Ga0495686_0007793
702 Ga0495686_0009430
703 Ga0495686_0027170
704 Ga0495686_0028491
705 Ga0495626_0007741
706 Ga0495626_0009104
707 Ga0495626_0009717
708 Ga0495626_0023942
709 Ga0495626_0038465
710 Ga0496102_0048907
711 Ga0496104_0107254
712 Ga0496105_0000587
713 Ga0496107_0072073
714 Ga0496117_0019850
715 Ga0496117_0021293
716 Ga0496117_0111165
717 Ga0496118_0000865
718 Ga0496118_0006417
719 Ga0496118_0007263
720 Ga0496119_0000029
721 Ga0496119_0013661
722 Ga0496120_0000039
723 Ga0496121_0000109
724 Ga0496121_0000408
725 Ga0496121_0000633
726 Ga0496121_0000922
727 Ga0496121_0029177
728 Ga0496121_0036240
729 Ga0496121_0077179
730 Ga0496121_0158870
731 Ga0496121_0279235
732 Ga0496122_0010820
733 Ga0496122_0013752
734 Ga0496122_0016368
735 Ga0496122_0043065
736 Ga0496122_0159425
737 Ga0496123_0003670
738 Ga0496123_0028107
739 Ga0496123_0067543
740 Ga0496123_0080283
741 Ga0496123_0102124
742 Ga0496124_0004873
743 Ga0496125_0000093
744 Ga0496125_0000376
745 Ga0496125_0013631
746 Ga0496125_0088219
747 Ga0496125_0143355
748 Ga0496126_0004543
749 Ga0496126_0013643
750 Ga0496126_0027549
751 Ga0496126_0031219
752 Ga0495678_000152
753 Ga0495682_0001052
754 Ga0501038_0013297
755 Ga0501039_0091631
756 Ga0501040_0010626
757 Ga0501041_0004798
758 Ga0501041_0020846
759 Ga0501042_0040398
760 Ga0501048_0022502
761 Ga0501069_0044185
762 Ga0501070_0067011
763 Ga0501071_0008075
764 Ga0501072_0000859
765 Ga0501075_0005752
766 Ga0501075_0018233
767 Ga0501076_0023698
768 Ga0501077_0079815
769 Ga0501077_0122569
770 Ga0501079_0009427
771 Ga0501045_0004967
772 Ga0501045_0057165
773 nmdc:mga00v17_19841_c1
774 Ga0500643_000029
775 Ga0500555_000768
776 Ga0500572_001181
777 Ga0500593_000250
778 Ga0500618_015224
779 Ga0500618_015703
780 Ga0500618_022006
781 Ga0500568_0000221
782 Ga0500633_0000751
783 Ga0500636_0001339
784 Ga0500645_000287
785 Ga0501084_0016268
786 Ga0501084_0089176
787 Ga0530510_0022225
788 2509107271
789 2509374762
790 2510899576
791 2513569951
792 2513868678
793 2513909315
794 2513924704
795 2514023323
796 2515632505
797 2516206313
798 2548500518
799 2585394556
800 2585404854
801 2585902624
802 2599416257
803 2643864469
804 2644058160
805 2644073200
806 2644291841
807 2644646933
808 2644672051
809 2657685964
810 2671115525
811 2692317940
812 2721025881
813 2735834155
814 2738829761
815 2739034501
816 2739153557
817 2739195477
818 2739225565
819 2739244493
820 2739321953
821 2739340194
822 2753459171
823 2765464485
824 2776268355
825 2776280300
826 2792583707
827 2792629920
828 2792641284
829 2793355225
830 2804755453
831 2806055647
832 2806061327
833 2806069851
834 2808984142
835 2809131946
836 2809151569
837 2816469936
838 2819566082
839 2819610805
840 2838030391
841 2838036381
842 2838079118
843 2838668492
844 2838684233
845 2838699723
846 2838711991
847 2842081699
848 2842122275
849 2842241403
850 2842289847
851 2842295355
852 2842375898
853 2842381870
854 2842388824
855 2842400327
856 2842407013
857 2842413905
858 2842420547
859 2842477329
860 2842504126
861 2842778627
862 2842920574
863 2847423559
864 2848997332
865 2850080209
866 2852622972
867 2854683223
868 2854922531
869 2856342332
870 2857567036
871 2874127213
872 2884339218
873 2885306710
874 2885328670
875 2885338821
876 2888346636
877 2896385748
878 2899278526
879 2903453180
880 2904440012
881 2904466353
882 2904479825
883 2904531040
884 2904583800
885 2904587315
886 2904592650
887 2904604568
888 2913301067
889 2917704944
890 2919050340
891 2919082389
892 2919086068
893 2919104882
894 2919124414
895 2919412181
896 2920766419
897 2920826233
898 2923561832
899 2928524853
900 2929143826
901 2933017262
902 2935898426
903 2936370478
904 2936378138
905 2941475838
906 2952254287
907 2953995862
908 2954011525
909 2957420739
910 2968086546
911 2990715055
912 3004211222
913 3005419839
914 3005447586
915 637078850
916 643822480
917 8005289455
918 8005305213
919 8005382148
920 8005486781
921 8005651452
922 8005661087
923 8005685779
924 8005689235
925 8005701233
926 8024485808
927 8049298069
928 8055434810
929 8055619051
930 8057163693

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04303

PrpF

PrpF protein

43

256

0.93

PF04303

PrpF

PrpF protein

246

422

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p3j-assembly1.cif.gz_A crystal structure of ligu 0.9498 1 351
6p3k-assembly2.cif.gz_B crystal structure of ligu(c100s) 0.9478 1 351
6p3j-assembly1.cif.gz_B crystal structure of ligu 0.9473 2 350
6p3j-assembly1.cif.gz_A crystal structure of ligu 0.9419 1 351
6p3k-assembly2.cif.gz_B crystal structure of ligu(c100s) 0.9374 1 351
ID Description Score Start End Superfamily
af_P0AAV8_179_330_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9362 180 328 3.10.310.10
af_P0AAV8_1_178_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9203 5 178 3.10.310.10
3g7kB02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9184 173 331 3.10.310.10
3g7kB01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9039 2 162 3.10.310.10
af_P0AAV8_1_178_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8955 5 178 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A2M8Q6N3-F1-model_v4 4-oxalomesaconate tautomerase 0.9965 177 296 GO:0016853
AF-K9NK90-F1-model_v4 deleted 0.996 197 271
AF-A0A441XJS6-F1-model_v4 4-oxalomesaconate tautomerase 0.991 172 250 GO:0016853
AF-A0A2M8Q6N3-F1-model_v4 4-oxalomesaconate tautomerase 0.9883 177 296 GO:0016853
AF-A0A3S4JUN3-F1-model_v4 PrpF protein 0.9804 182 280 GO:0016853

Map