F449566

General Info

Members Datasets Scaffolds Average Seq Length
465 310 451 177

Family's Representative Sequence

Representative Sequence 3300049744|Ga0501083_0000127|Ga0501083_0000127_1668_2288
Length 206
Sequence VKLFARFGKGKHMSRVGKKPVVIPSGVTADISAQGGSASGGKDTFLKVKGPKGELTLAIHPKVSVEKTDEGMVVKVKHETNKQERALWGLFRALINNMVVGVTEGFTKTLEINGVGYKAAMSGKKLVLNLGYSHPIEMEVPAGLETKVDKNVITITGADRQAVGQFAAVIRIQRPPEPYKGKGIKYSDETIRRKAGKVVKAVGGGK

Samples

Sample ID Description Type Environment
1 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
2 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
3 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
4 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
5 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
6 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
7 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
8 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
9 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
10 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
11 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
12 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
16 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
107 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
108 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
149 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
154 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
157 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
158 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
159 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
160 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
161 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
162 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
163 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
164 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
165 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
166 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
171 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
173 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
177 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
180 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
188 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
189 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
201 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
204 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
205 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
208 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
209 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
212 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
213 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
214 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
215 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
216 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
217 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
218 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
219 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
223 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
224 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
225 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
229 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
230 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
231 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
232 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
239 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
252 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
253 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
254 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
263 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
264 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
265 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
266 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
267 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
268 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
269 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
270 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
271 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
272 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
273 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
274 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
275 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
276 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
277 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
278 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
279 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
285 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
286 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
287 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
288 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
289 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
292 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
293 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
294 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
295 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
296 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
297 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
298 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
299 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
300 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
306 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
307 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified
308 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
309 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
310 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.83
Metatranscriptomes 5.16
Isolates 3.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.16
Nodule 1.51
Rhizoplane 2.15
Rhizosphere 86.24
Stem 0
Stem Tuber 0
Unclassified 4.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000535 3300001904 Bacteria 7069
2 JGI24736J21556_1007818 3300001904 Bacteria 1791
3 JGI24743J22301_10010320 3300001991 Bacteria 1666
4 JGI24735J21928_10012565 3300002067 Bacteria 2674
5 JGI25406J46586_10000001 3300003203 Bacteria 251772
6 Ga0058859_10022019 3300004798 Bacteria 1452
7 Ga0058863_11792460 3300004799 Bacteria 1940
8 Ga0058861_12054136 3300004800 Bacteria 3266
9 Ga0058862_12698388 3300004803 Bacteria 1963
10 Ga0065714_10252458 3300005288 Bacteria 751
11 Ga0065712_10267158 3300005290 Unclassified 924
12 Ga0065712_10301275 3300005290 Bacteria 859
13 Ga0065715_10212898 3300005293 Bacteria 1305
14 Ga0065707_10133191 3300005295 Bacteria 1885
15 Ga0070658_10012380 3300005327 Bacteria 6848
16 Ga0070658_10322598 3300005327 Archaea 1319
17 Ga0070658_10562326 3300005327 Bacteria 987
18 Ga0070676_10032758 3300005328 Bacteria 2979
19 Ga0070683_100003081 3300005329 Bacteria 13424
20 Ga0070683_100140844 3300005329 Bacteria 2285
21 Ga0070690_100167796 3300005330 Unclassified 1509
22 Ga0070690_100175638 3300005330 Bacteria 1477
23 Ga0070677_10077247 3300005333 Bacteria 1416
24 Ga0068869_100268537 3300005334 Bacteria 1368
25 Ga0070666_10002665 3300005335 Bacteria 10770
26 Ga0070666_10254245 3300005335 Bacteria 1244
27 Ga0070680_101133331 3300005336 Bacteria 676
28 Ga0070682_100115504 3300005337 Bacteria 1795
29 Ga0070689_100292113 3300005340 Bacteria 1355
30 Ga0070687_100035423 3300005343 Bacteria 2478
31 Ga0070668_100316003 3300005347 Bacteria 1314
32 Ga0070675_100195349 3300005354 Bacteria 1755
33 Ga0070674_100061977 3300005356 Bacteria 2612
34 Ga0070674_100477710 3300005356 Bacteria 1034
35 Ga0070673_100025448 3300005364 Bacteria 4356
36 Ga0070673_100179188 3300005364 Bacteria 1813
37 Ga0070667_100541668 3300005367 Bacteria 1069
38 Ga0070714_100287287 3300005435 Bacteria 1530
39 Ga0070701_10013814 3300005438 Bacteria 3684
40 Ga0070705_100217179 3300005440 Bacteria 1322
41 Ga0070705_101234394 3300005440 Bacteria 617
42 Ga0070700_100037218 3300005441 Bacteria 2958
43 Ga0070694_100080432 3300005444 Bacteria 2264
44 Ga0070708_100091045 3300005445 Bacteria 2777
45 Ga0070708_100594236 3300005445 Bacteria 1043
46 Ga0070685_10015156 3300005466 Bacteria 4091
47 Ga0070706_100357086 3300005467 Bacteria 1362
48 Ga0070707_100000292 3300005468 Bacteria 49172
49 Ga0070707_100528407 3300005468 Bacteria 1142
50 Ga0070698_100007384 3300005471 Bacteria 11891
51 Ga0070698_100326511 3300005471 Bacteria 1465
52 Ga0070699_100202470 3300005518 Bacteria 1766
53 Ga0070679_100234077 3300005530 Bacteria 1796
54 Ga0070679_100243390 3300005530 Bacteria 1756
55 Ga0070679_100881841 3300005530 Bacteria 838
56 Ga0070684_100056547 3300005535 Bacteria 3424
57 Ga0070684_100095201 3300005535 Bacteria 2653
58 Ga0070684_100202332 3300005535 Bacteria 1809
59 Ga0070684_100950737 3300005535 Bacteria 806
60 Ga0068853_100083191 3300005539 Bacteria 2804
61 Ga0070672_100223373 3300005543 Bacteria 1580
62 Ga0070672_100522321 3300005543 Bacteria 1029
63 Ga0070672_101018380 3300005543 Bacteria 734
64 Ga0070686_100088453 3300005544 Bacteria 2067
65 Ga0070695_100008633 3300005545 Bacteria 6053
66 Ga0070696_100148598 3300005546 Bacteria 1718
67 Ga0070665_100474722 3300005548 Bacteria 1261
68 Ga0070704_100089057 3300005549 Bacteria 2294
69 Ga0070704_100464119 3300005549 Bacteria 1093
70 Ga0068855_100293461 3300005563 Bacteria 1802
71 Ga0068855_100305522 3300005563 Bacteria 1761
72 Ga0068855_100384175 3300005563 Bacteria 1541
73 Ga0068855_100808242 3300005563 Unclassified 996
74 Ga0068857_100192841 3300005577 Bacteria 1856
75 Ga0068852_100604169 3300005616 Bacteria 1101
76 Ga0068859_100342824 3300005617 Bacteria 1588
77 Ga0068851_10019197 3300005834 Bacteria 3301
78 Ga0068863_100038569 3300005841 Bacteria 4544
79 Ga0068863_100342260 3300005841 Bacteria 1455
80 Ga0068858_100020832 3300005842 Bacteria 6128
81 Ga0068858_100594385 3300005842 Bacteria 1073
82 Ga0068860_100111708 3300005843 Bacteria 2613
83 Ga0081455_10344702 3300005937 Bacteria 1053
84 Ga0081539_10059040 3300005985 Bacteria 2114
85 Ga0081539_10077680 3300005985 Bacteria 1754
86 Ga0070717_11166309 3300006028 Bacteria 701
87 Ga0075368_10002415 3300006042 Bacteria 6093
88 Ga0075363_100009208 3300006048 Bacteria 4637
89 Ga0075363_100063933 3300006048 Bacteria 1987
90 Ga0075364_10024908 3300006051 Bacteria 3804
91 Ga0075364_10114644 3300006051 Bacteria 1801
92 Ga0070716_100099735 3300006173 Bacteria 1778
93 Ga0075362_10025610 3300006177 Bacteria 2513
94 Ga0075367_10035085 3300006178 Bacteria 2901
95 Ga0097621_100907756 3300006237 Bacteria 821
96 Ga0075428_100010507 3300006844 Bacteria 10286
97 Ga0075430_100148259 3300006846 Bacteria 1954
98 Ga0075431_100373156 3300006847 Bacteria 1431
99 Ga0075433_10045975 3300006852 Bacteria 3796
100 Ga0075433_10108788 3300006852 Bacteria 2459
101 Ga0075433_10129756 3300006852 Bacteria 2239
102 Ga0075434_100072156 3300006871 Bacteria 3444
103 Ga0075434_100156699 3300006871 Bacteria 2296
104 Ga0075429_100087811 3300006880 Bacteria 2710
105 Ga0068865_100170664 3300006881 Bacteria 1667
106 Ga0075436_100032597 3300006914 Bacteria 3592
107 Ga0075436_100184363 3300006914 Bacteria 1476
108 Ga0075436_100691897 3300006914 Bacteria 755
109 Ga0097620_100342811 3300006931 Bacteria 1588
110 Ga0079104_1000280 3300006946 Bacteria 65859
111 Ga0079104_1010677 3300006946 Bacteria 3002
112 Ga0079104_1028321 3300006946 Bacteria 1424
113 Ga0079104_1040574 3300006946 Bacteria 1089
114 Ga0075435_100011633 3300007076 Bacteria 6486
115 Ga0105251_10017161 3300009011 Bacteria 3889
116 Ga0105240_10068403 3300009093 Bacteria 4398
117 Ga0105240_11713787 3300009093 Bacteria 656
118 Ga0105245_10004821 3300009098 Bacteria 11893
119 Ga0105245_10093563 3300009098 Bacteria 2769
120 Ga0114129_10065627 3300009147 Bacteria 5065
121 Ga0105241_10051425 3300009174 Bacteria 3142
122 Ga0105248_10113808 3300009177 Bacteria 3051
123 Ga0105237_10056200 3300009545 Bacteria 3940
124 Ga0105238_10011584 3300009551 Bacteria 8885
125 Ga0105249_10664651 3300009553 Bacteria 1100
126 Ga0105239_10032725 3300010375 Bacteria 5713
127 Ga0105239_10102431 3300010375 Bacteria 3168
128 Ga0157373_10001369 3300013100 Bacteria 18710
129 Ga0157370_10198056 3300013104 Bacteria 1864
130 Ga0157370_10257422 3300013104 Bacteria 1613
131 Ga0157378_10005509 3300013297 Bacteria 11097
132 Ga0157378_10044546 3300013297 Bacteria 3940
133 Ga0157378_10174062 3300013297 Unclassified 2021
134 Ga0163162_10907605 3300013306 Bacteria 994
135 Ga0157375_12109976 3300013308 Bacteria 671
136 Ga0163163_10053826 3300014325 Bacteria 3974
137 Ga0157380_10140157 3300014326 Bacteria 2076
138 Ga0157377_10135165 3300014745 Bacteria 1510
139 Ga0182006_1062258 3300015261 Bacteria 1404
140 Ga0182006_1079482 3300015261 Bacteria 1199
141 Ga0206355_1444440 3300020076 Bacteria 811
142 Ga0206351_10771532 3300020077 Bacteria 2259
143 Ga0206352_11184891 3300020078 Bacteria 1832
144 Ga0206350_10810608 3300020080 Bacteria 5805
145 Ga0213876_10156320 3300021384 Bacteria 1213
146 Ga0224712_10000184 3300022467 Bacteria 10959
147 Ga0207656_10021980 3300025321 Bacteria 2555
148 Ga0207713_1028456 3300025735 Bacteria 2520
149 Ga0207682_10028076 3300025893 Bacteria 2244
150 Ga0207680_10001681 3300025903 Bacteria 10452
151 Ga0207680_10023603 3300025903 Bacteria 3362
152 Ga0207647_10000001 3300025904 Bacteria 506349
153 Ga0207647_10054869 3300025904 Bacteria 2450
154 Ga0207647_10056801 3300025904 Bacteria 2401
155 Ga0207705_10011835 3300025909 Bacteria 6304
156 Ga0207684_10216735 3300025910 Bacteria 1652
157 Ga0207654_10027464 3300025911 Bacteria 3093
158 Ga0207707_10625759 3300025912 Bacteria 909
159 Ga0207695_10010441 3300025913 Bacteria 11360
160 Ga0207671_10098988 3300025914 Bacteria 2206
161 Ga0207693_10350498 3300025915 Bacteria 1155
162 Ga0207662_10005790 3300025918 Bacteria 6615
163 Ga0207657_10032769 3300025919 Bacteria 4690
164 Ga0207652_10198175 3300025921 Bacteria 1807
165 Ga0207652_10541848 3300025921 Bacteria 1046
166 Ga0207652_10588609 3300025921 Bacteria 998
167 Ga0207652_10719467 3300025921 Bacteria 890
168 Ga0207646_10001393 3300025922 Bacteria 29980
169 Ga0207646_10196281 3300025922 Bacteria 1823
170 Ga0207694_10058395 3300025924 Bacteria 3001
171 Ga0207687_10015188 3300025927 Bacteria 5046
172 Ga0207664_10051819 3300025929 Bacteria 3243
173 Ga0207709_11018855 3300025935 Bacteria 677
174 Ga0207669_10043775 3300025937 Bacteria 2624
175 Ga0207665_10056664 3300025939 Bacteria 2646
176 Ga0207691_10271540 3300025940 Bacteria 1460
177 Ga0207691_10312457 3300025940 Bacteria 1348
178 Ga0207691_10452485 3300025940 Bacteria 1093
179 Ga0207661_10002899 3300025944 Bacteria 11851
180 Ga0207661_10103266 3300025944 Bacteria 2399
181 Ga0207667_10276788 3300025949 Bacteria 1715
182 Ga0207667_10379187 3300025949 Bacteria 1441
183 Ga0207651_10025687 3300025960 Bacteria 3666
184 Ga0207658_10134659 3300025986 Bacteria 1990
185 Ga0207677_10125596 3300026023 Bacteria 1938
186 Ga0207703_10043924 3300026035 Bacteria 3589
187 Ga0207639_10132032 3300026041 Bacteria 2069
188 Ga0207708_10061239 3300026075 Bacteria 2873
189 Ga0207702_10407713 3300026078 Bacteria 1312
190 Ga0207641_10185679 3300026088 Bacteria 1907
191 Ga0207648_10332848 3300026089 Bacteria 1366
192 Ga0207674_10217783 3300026116 Bacteria 1857
193 Ga0209281_1000059 3300027111 Bacteria 295913
194 Ga0209281_1000337 3300027111 Bacteria 79938
195 Ga0209281_1000435 3300027111 Bacteria 61761
196 Ga0209813_10000406 3300027866 Bacteria 10561
197 Ga0268266_11386116 3300028379 Bacteria 679
198 Ga0268265_10363120 3300028380 Bacteria 1326
199 Ga0268264_10121832 3300028381 Bacteria 2299
200 Ga0265334_10018557 3300028573 Bacteria 2867
201 Ga0265322_10027648 3300028654 Bacteria 1621
202 Ga0265338_10030478 3300028800 Bacteria 5313
203 Ga0265338_10099324 3300028800 Bacteria 2378
204 Ga0265324_10019999 3300029957 Bacteria 2409
205 Ga0265328_10010665 3300031239 Bacteria 3692
206 Ga0265328_10034301 3300031239 Bacteria 1879
207 Ga0265320_10003506 3300031240 Bacteria 10517
208 Ga0265329_10002134 3300031242 Bacteria 9169
209 Ga0265339_10013165 3300031249 Bacteria 5020
210 Ga0265331_10022569 3300031250 Bacteria 3210
211 Ga0265331_10248136 3300031250 Bacteria 798
212 Ga0265313_10025503 3300031595 Bacteria 3131
213 Ga0316575_10038599 3300031665 Bacteria 1884
214 Ga0265314_10020637 3300031711 Bacteria 5085
215 Ga0316576_10020212 3300031727 Bacteria 4577
216 Ga0316576_10028618 3300031727 Bacteria 3930
217 Ga0316576_10036550 3300031727 Bacteria 3512
218 Ga0316576_10052895 3300031727 Bacteria 2958
219 Ga0316576_10082478 3300031727 Bacteria 2387
220 Ga0316578_10354771 3300031728 Bacteria 873
221 Ga0307413_10001014 3300031824 Bacteria 10155
222 Ga0307416_100037641 3300032002 Bacteria 3725
223 Ga0307414_10000673 3300032004 Bacteria 17502
224 Ga0316580_10030960 3300032139 Bacteria 1657
225 Ga0316593_10200638 3300032168 Bacteria 737
226 Ga0307510_10128269 3300033180 Bacteria 2218
227 Ga0316592_1005208 3300033524 Unclassified 2458
228 Ga0316592_1008100 3300033524 Bacteria 2066
229 Ga0316588_1012952 3300033528 Bacteria 1803
230 Ga0316588_1024940 3300033528 Unclassified 1378
231 Ga0316588_1034897 3300033528 Bacteria 1189
232 Ga0316596_1001043 3300033541 Bacteria 5368
233 Ga0316596_1016449 3300033541 Bacteria 1853
234 Ga0373926_0025205 3300035083 Bacteria 2075
235 Ga0373923_0013935 3300035111 Bacteria 3009
236 Ga0373936_0025847 3300035113 Bacteria 2298
237 Ga0373939_0290036 3300035114 Bacteria 649
238 Ga0373953_0001433 3300035117 Bacteria 6907
239 Ga0373953_0078441 3300035117 Bacteria 1370
240 Ga0373954_0002529 3300035118 Bacteria 7673
241 Ga0373956_0058659 3300035119 Bacteria 1740
242 Ga0373957_0037711 3300035120 Bacteria 1806
243 Ga0373943_0057911 3300035170 Bacteria 1927
244 Ga0373946_0465893 3300035171 Unclassified 645
245 Ga0373955_0008379 3300035172 Bacteria 4800
246 Ga0373955_0012189 3300035172 Bacteria 4127
247 Ga0373955_0323870 3300035172 Bacteria 931
248 Ga0373962_0019963 3300035242 Bacteria 1756
249 Ga0316574_0034560 3300035398 Bacteria 3083
250 Ga0373924_0385641 3300035410 Bacteria 626
251 Ga0373935_0119014 3300035692 Bacteria 1762
252 Ga0373933_0052084 3300035724 Bacteria 2448
253 Ga0373933_0100571 3300035724 Bacteria 1793
254 Ga0373933_0228217 3300035724 Bacteria 1196
255 Ga0373933_0434530 3300035724 Bacteria 858
256 Ga0373937_0039877 3300036401 Bacteria 4280
257 Ga0373937_0050665 3300036401 Bacteria 3803
258 Ga0373925_0022049 3300037068 Bacteria 4642
259 Ga0395899_0021136 3300037312 Bacteria 4936
260 Ga0395900_0130829 3300037418 Bacteria 2572
261 Ga0395900_0169317 3300037418 Bacteria 2225
262 Ga0395898_0259888 3300037466 Bacteria 1656
263 Ga0395898_0519672 3300037466 Bacteria 1132
264 Ga0395901_0342676 3300038443 Bacteria 1544
265 Ga0395901_0554807 3300038443 Bacteria 1164
266 Ga0400486_30747 3300038742 Bacteria 1547
267 Ga0436365_0047289 3300039437 Bacteria 7014
268 Ga0436365_0252966 3300039437 Bacteria 1722
269 Ga0436365_0454085 3300039437 Bacteria 2191
270 Ga0436365_1611975 3300039437 Bacteria 824
271 Ga0436362_0255382 3300039453 Bacteria 1158
272 Ga0451845_0735073 3300041501 Bacteria 1623
273 Ga0451853_2946566 3300041512 Bacteria 2040
274 Ga0451853_3612113 3300041512 Bacteria 834
275 Ga0450910_020842 3300042147 Bacteria 990
276 Ga0451577_0003056 3300042876 Bacteria 19007
277 Ga0451577_0006236 3300042876 Bacteria 11958
278 Ga0451577_0030192 3300042876 Bacteria 4897
279 Ga0451577_0142636 3300042876 Bacteria 2153
280 Ga0466969_0419684 3300044656 Bacteria 608
281 Ga0466963_0395345 3300044694 Bacteria 975
282 Ga0466964_0079439 3300044706 Bacteria 1405
283 Ga0453684_0000041 3300044712 Bacteria 690022
284 Ga0453684_0001066 3300044712 Bacteria 87216
285 Ga0453684_0014647 3300044712 Bacteria 12516
286 Ga0453684_0555181 3300044712 Bacteria 1264
287 Ga0453684_0996925 3300044712 Bacteria 891
288 Ga0466968_0482376 3300044735 Bacteria 616
289 Ga0451576_0062715 3300045051 Bacteria 3874
290 Ga0451576_0063362 3300045051 Bacteria 3853
291 Ga0451576_0306814 3300045051 Bacteria 1660
292 Ga0451576_0455285 3300045051 Bacteria 1343
293 Ga0451576_1141606 3300045051 Bacteria 815
294 Ga0495592_0005667 3300046454 Bacteria 9231
295 Ga0495592_0039694 3300046454 Bacteria 3535
296 Ga0495592_0102898 3300046454 Bacteria 2033
297 Ga0495591_016124 3300046458 Bacteria 2615
298 Ga0495641_0054267 3300046461 Bacteria 1821
299 Ga0495651_0002307 3300046462 Bacteria 14726
300 Ga0495651_0192132 3300046462 Unclassified 1436
301 Ga0495653_0015203 3300046463 Bacteria 6274
302 Ga0495653_0019992 3300046463 Bacteria 5428
303 Ga0495653_0037864 3300046463 Bacteria 3787
304 Ga0495653_0453133 3300046463 Bacteria 807
305 Ga0495582_0159873 3300046473 Bacteria 1281
306 Ga0495608_0000670 3300046511 Bacteria 23642
307 Ga0495618_0026915 3300046514 Bacteria 3578
308 Ga0495620_0017318 3300046515 Bacteria 3595
309 Ga0495628_0019333 3300046516 Bacteria 5632
310 Ga0495628_0040395 3300046516 Bacteria 3728
311 Ga0495628_0042913 3300046516 Bacteria 3605
312 Ga0495630_0017678 3300046517 Bacteria 5227
313 Ga0495630_0293270 3300046517 Bacteria 1243
314 Ga0495652_0018013 3300046529 Bacteria 6301
315 Ga0495652_0133957 3300046529 Bacteria 1957
316 Ga0495652_0146626 3300046529 Bacteria 1849
317 Ga0495652_0240591 3300046529 Bacteria 1347
318 Ga0495654_0110712 3300046530 Bacteria 1253
319 Ga0495640_0122566 3300046533 Bacteria 1688
320 Ga0495640_0156271 3300046533 Bacteria 1464
321 Ga0495640_0360479 3300046533 Unclassified 896
322 Ga0495587_0014842 3300046536 Bacteria 4874
323 Ga0495587_0249964 3300046536 Unclassified 997
324 Ga0495587_0311471 3300046536 Bacteria 879
325 Ga0495645_0059278 3300046543 Bacteria 2776
326 Ga0495645_0063981 3300046543 Bacteria 2662
327 Ga0495667_0050299 3300046559 Bacteria 2751
328 Ga0495667_0397826 3300046559 Unclassified 868
329 Ga0495634_0048412 3300046642 Bacteria 2862
330 Ga0495634_0057228 3300046642 Bacteria 2603
331 Ga0495635_0069461 3300046663 Bacteria 2415
332 Ga0495635_0095252 3300046663 Bacteria 2035
333 Ga0495635_0533199 3300046663 Unclassified 771
334 Ga0495657_0038178 3300046675 Bacteria 3306
335 Ga0495657_0129594 3300046675 Bacteria 1581
336 Ga0495599_0002847 3300046678 Bacteria 10079
337 Ga0495599_0049077 3300046678 Bacteria 2646
338 Ga0495646_0137961 3300046680 Bacteria 1366
339 Ga0495646_0192316 3300046680 Bacteria 1115
340 Ga0495658_0348637 3300046683 Unclassified 941
341 Ga0495658_0538338 3300046683 Bacteria 748
342 Ga0495613_0220347 3300046689 Bacteria 1332
343 Ga0495600_0004535 3300046809 Bacteria 8323
344 Ga0495600_0151608 3300046809 Bacteria 1501
345 Ga0495600_0437035 3300046809 Bacteria 810
346 Ga0495604_0044614 3300047317 Bacteria 3462
347 Ga0495604_0167202 3300047317 Bacteria 1550
348 Ga0495674_0066935 3300047319 Bacteria 3114
349 Ga0495672_0006039 3300047320 Bacteria 9463
350 Ga0495680_0078703 3300047322 Bacteria 2494
351 Ga0495680_0139261 3300047322 Bacteria 1776
352 Ga0495675_0000975 3300047444 Bacteria 17364
353 Ga0495675_0002584 3300047444 Bacteria 10850
354 Ga0495675_0398209 3300047444 Bacteria 803
355 Ga0495684_0057456 3300047471 Bacteria 2965
356 Ga0495684_0095749 3300047471 Bacteria 2247
357 Ga0495684_0164535 3300047471 Unclassified 1653
358 Ga0495684_0226312 3300047471 Bacteria 1369
359 Ga0496100_0217454 3300048903 Bacteria 1401
360 Ga0496101_0347080 3300048904 Bacteria 1166
361 Ga0496102_0067414 3300048905 Bacteria 3283
362 Ga0496106_0112458 3300048909 Bacteria 2122
363 Ga0496108_1577170 3300048911 Bacteria 544
364 Ga0496110_0105501 3300048913 Bacteria 2528
365 Ga0496111_0554903 3300048914 Bacteria 843
366 Ga0496112_0273283 3300048915 Unclassified 1638
367 Ga0496112_0852106 3300048915 Bacteria 835
368 Ga0496114_1062747 3300048917 Bacteria 694
369 Ga0496122_0239688 3300048925 Bacteria 1024
370 Ga0496124_0289073 3300048927 Bacteria 1191
371 Ga0496126_0000190 3300048929 Bacteria 137687
372 Ga0496126_0179750 3300048929 Bacteria 1798
373 Ga0501311_004736 3300049527 Bacteria 1463
374 Ga0501034_0002020 3300049571 Bacteria 25539
375 Ga0501034_0256368 3300049571 Bacteria 1693
376 Ga0501040_0383220 3300049576 Bacteria 1009
377 Ga0501042_0414186 3300049578 Bacteria 976
378 Ga0501042_0728848 3300049578 Bacteria 721
379 Ga0501043_0508829 3300049579 Bacteria 899
380 Ga0501046_0391829 3300049580 Bacteria 1004
381 Ga0501047_0037417 3300049581 Bacteria 4693
382 Ga0501048_0487124 3300049582 Bacteria 884
383 Ga0501068_0041718 3300049584 Bacteria 2758
384 Ga0501070_0097827 3300049586 Bacteria 2427
385 Ga0501070_0133667 3300049586 Bacteria 2048
386 Ga0501071_0160335 3300049587 Bacteria 1681
387 Ga0501071_0514368 3300049587 Bacteria 918
388 Ga0501072_0704799 3300049588 Bacteria 793
389 Ga0501073_0073037 3300049589 Bacteria 2389
390 Ga0501074_0212749 3300049590 Bacteria 1377
391 Ga0501075_0062590 3300049591 Bacteria 2805
392 Ga0501075_0712354 3300049591 Bacteria 764
393 Ga0501076_0079520 3300049592 Bacteria 2631
394 Ga0501076_0259125 3300049592 Bacteria 1424
395 Ga0501076_1227162 3300049592 Bacteria 617
396 Ga0501079_0434321 3300049741 Bacteria 1031
397 Ga0501080_0286093 3300049742 Bacteria 1498
398 Ga0501081_0404243 3300049743 Bacteria 1011
399 Ga0501081_0443239 3300049743 Bacteria 964
400 Ga0501083_0000127 3300049744 Bacteria 52007
401 Ga0501035_0018430 3300049822 Bacteria 6432
402 nmdc:mga03683_58535_c1 3300050489 Bacteria 1624
403 nmdc:mga03683_862_c1 3300050489 Bacteria 8724
404 nmdc:mga03n38_129178_c1 3300050490 Bacteria 1250
405 nmdc:mga03n38_14808_c1 3300050490 Bacteria 2999
406 nmdc:mga03n38_243517_c1 3300050490 Bacteria 947
407 nmdc:mga00v17_21650_c1 3300050491 Bacteria 3698
408 nmdc:mga00v17_98762_c1 3300050491 Bacteria 1841
409 nmdc:mga06z11_18440_c1 3300050494 Bacteria 3188
410 nmdc:mga04h51_11198_c1 3300050495 Bacteria 2484
411 nmdc:mga05p37_78937_c1 3300050507 Bacteria 4053
412 nmdc:mga09592_160521_c1 3300050508 Bacteria 1942
413 nmdc:mga09592_51122_c1 3300050508 Bacteria 3486
414 nmdc:mga0qj67_7823_c1 3300050509 Bacteria 7902
415 nmdc:mga06r32_1143515_c1 3300050510 Bacteria 726
416 nmdc:mga06r32_674179_c1 3300050510 Bacteria 1001
417 nmdc:mga0n895_204846_c1 3300050512 Bacteria 2003
418 nmdc:mga0n895_56240_c1 3300050512 Bacteria 3875
419 nmdc:mga0rr50_354464_c1 3300050513 Bacteria 1234
420 nmdc:mga08x19_572176_c1 3300050514 Bacteria 800
421 nmdc:mga08x19_80561_c1 3300050514 Bacteria 2137
422 nmdc:mga08x19_81630_c1 3300050514 Bacteria 2123
423 nmdc:mga0a205_436525_c1 3300050515 Bacteria 1170
424 nmdc:mga0a205_567090_c1 3300050515 Bacteria 990
425 Ga0495601_0005352 3300053077 Bacteria 7476
426 Ga0495601_0080551 3300053077 Bacteria 2089
427 Ga0495601_0180268 3300053077 Bacteria 1381
428 Ga0495595_0001372 3300053084 Bacteria 9454
429 Ga0495595_0024335 3300053084 Bacteria 2674
430 Ga0495619_0005930 3300053085 Bacteria 7740
431 Ga0495619_0090875 3300053085 Bacteria 2067
432 Ga0495619_0157287 3300053085 Bacteria 1569
433 Ga0500583_0202879 3300053092 Bacteria 985
434 Ga0500641_0149408 3300053096 Bacteria 1009
435 Ga0500568_0014440 3300053139 Bacteria 3566
436 Ga0500568_0028292 3300053139 Bacteria 2337
437 Ga0500568_0043000 3300053139 Bacteria 1807
438 Ga0500573_0013689 3300053140 Bacteria 4576
439 Ga0500627_0085685 3300053158 Bacteria 1407
440 Ga0590071_051639 3300059421 Bacteria 997
441 Ga0590074_002898 3300059423 Bacteria 2827
442 Ga0590075_001597 3300059424 Bacteria 5601
443 Ga0590077_013957 3300059426 Bacteria 1671
444 Ga0587093_013249 3300059478 Bacteria 1012
445 Ga0587070_012594 3300059491 Bacteria 1289
446 Ga0587077_007424 3300059493 Bacteria 1596
447 Ga0587077_062247 3300059493 Bacteria 812
448 Ga0587083_0014617 3300059505 Bacteria 1355
449 Ga0587076_055699 3300059645 Bacteria 784
450 Ga0501082_0784681 3300060353 Bacteria 833
451 Ga0530510_0329770 3300061734 Bacteria 1145

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006914 Ga0075436_100184363 Ga0075436_1001843631 142
2 3300035117 Ga0373953_0078441 Ga0373953_0078441_375_911 142
3 3300035172 Ga0373955_0323870 Ga0373955_0323870_283_819 142
4 3300036401 Ga0373937_0050665 Ga0373937_0050665_1946_2482 142
5 3300046463 Ga0495653_0019992 Ga0495653_0019992_1665_2201 142
6 3300046663 Ga0495635_0069461 Ga0495635_0069461_1526_2062 142
7 3300046809 Ga0495600_0004535 Ga0495600_0004535_3580_4116 142
8 3300047471 Ga0495684_0095749 Ga0495684_0095749_541_1077 142
9 3300046680 Ga0495646_0192316 Ga0495646_0192316_229_744 144
10 3300049586 Ga0501070_0133667 Ga0501070_0133667_17_520 145
11 3300006173 Ga0070716_100099735 Ga0070716_1000997352 146
12 3300049743 Ga0501081_0404243 Ga0501081_0404243_469_972 146
13 3300031824 Ga0307413_10001014 Ga0307413_100010147 147
14 3300032004 Ga0307414_10000673 Ga0307414_100006737 147
15 3300044656 Ga0466969_0419684 Ga0466969_0419684_40_561 148
16 3300048911 Ga0496108_1577170 Ga0496108_1577170_11_520 148
17 3300045051 Ga0451576_0063362 Ga0451576_0063362_996_1529 150
18 3300046516 Ga0495628_0019333 Ga0495628_0019333_4909_5445 150
19 3300006852 Ga0075433_10129756 Ga0075433_101297565 151
20 3300039437 Ga0436365_1611975 Ga0436365_1611975_281_814 151
21 3300049579 Ga0501043_0508829 Ga0501043_0508829_310_855 151
22 3300049741 Ga0501079_0434321 Ga0501079_0434321_133_660 151
23 3300050515 nmdc:mga0a205_436525_c1 nmdc:mga0a205_436525_c1_366_902 151
24 3300037312 Ga0395899_0021136 Ga0395899_0021136_2071_2640 152
25 3300049589 Ga0501073_0073037 Ga0501073_0073037_538_1077 152
26 3300005295 Ga0065707_10133191 Ga0065707_101331913 153
27 3300005333 Ga0070677_10077247 Ga0070677_100772472 153
28 3300005535 Ga0070684_100950737 Ga0070684_1009507371 153
29 3300006847 Ga0075431_100373156 Ga0075431_1003731562 153
30 3300009553 Ga0105249_10664651 Ga0105249_106646512 153
31 3300014326 Ga0157380_10140157 Ga0157380_101401575 153
32 3300025893 Ga0207682_10028076 Ga0207682_100280762 153
33 3300025944 Ga0207661_10103266 Ga0207661_101032662 153
34 3300026089 Ga0207648_10332848 Ga0207648_103328483 153
35 3300028379 Ga0268266_11386116 Ga0268266_113861162 153
36 3300048904 Ga0496101_0347080 Ga0496101_0347080_146_697 153
37 3300053140 Ga0500573_0013689 Ga0500573_0013689_2274_2816 153
38 3300006880 Ga0075429_100087811 Ga0075429_1000878114 154
39 3300035111 Ga0373923_0013935 Ga0373923_0013935_1228_1746 154
40 3300035113 Ga0373936_0025847 Ga0373936_0025847_1362_1880 154
41 3300035117 Ga0373953_0001433 Ga0373953_0001433_5149_5667 154
42 3300035118 Ga0373954_0002529 Ga0373954_0002529_6771_7289 154
43 3300035119 Ga0373956_0058659 Ga0373956_0058659_636_1154 154
44 3300035120 Ga0373957_0037711 Ga0373957_0037711_415_933 154
45 3300035172 Ga0373955_0012189 Ga0373955_0012189_3515_4033 154
46 3300035410 Ga0373924_0385641 Ga0373924_0385641_39_557 154
47 3300035692 Ga0373935_0119014 Ga0373935_0119014_1008_1526 154
48 3300035724 Ga0373933_0100571 Ga0373933_0100571_305_823 154
49 3300046454 Ga0495592_0005667 Ga0495592_0005667_8491_9009 154
50 3300046462 Ga0495651_0002307 Ga0495651_0002307_6344_6862 154
51 3300046463 Ga0495653_0037864 Ga0495653_0037864_2970_3488 154
52 3300046511 Ga0495608_0000670 Ga0495608_0000670_11273_11791 154
53 3300046517 Ga0495630_0293270 Ga0495630_0293270_702_1220 154
54 3300046529 Ga0495652_0133957 Ga0495652_0133957_400_918 154
55 3300046536 Ga0495587_0014842 Ga0495587_0014842_1466_1984 154
56 3300046559 Ga0495667_0050299 Ga0495667_0050299_1661_2179 154
57 3300046663 Ga0495635_0095252 Ga0495635_0095252_1330_1848 154
58 3300046675 Ga0495657_0038178 Ga0495657_0038178_1953_2471 154
59 3300046678 Ga0495599_0002847 Ga0495599_0002847_9531_10049 154
60 3300046809 Ga0495600_0437035 Ga0495600_0437035_31_549 154
61 3300047317 Ga0495604_0044614 Ga0495604_0044614_1599_2117 154
62 3300047444 Ga0495675_0000975 Ga0495675_0000975_2080_2598 154
63 3300047471 Ga0495684_0226312 Ga0495684_0226312_600_1118 154
64 3300049576 Ga0501040_0383220 Ga0501040_0383220_444_962 154
65 3300049578 Ga0501042_0414186 Ga0501042_0414186_303_848 154
66 3300049580 Ga0501046_0391829 Ga0501046_0391829_243_788 154
67 3300049582 Ga0501048_0487124 Ga0501048_0487124_139_684 154
68 3300049587 Ga0501071_0160335 Ga0501071_0160335_1005_1550 154
69 3300049588 Ga0501072_0704799 Ga0501072_0704799_110_655 154
70 3300049591 Ga0501075_0062590 Ga0501075_0062590_1764_2309 154
71 3300049592 Ga0501076_0079520 Ga0501076_0079520_958_1503 154
72 3300049742 Ga0501080_0286093 Ga0501080_0286093_348_893 154
73 3300049743 Ga0501081_0443239 Ga0501081_0443239_161_706 154
74 3300050508 nmdc:mga09592_51122_c1 nmdc:mga09592_51122_c1_753_1286 154
75 3300050509 nmdc:mga0qj67_7823_c1 nmdc:mga0qj67_7823_c1_216_749 154
76 3300050510 nmdc:mga06r32_1143515_c1 nmdc:mga06r32_1143515_c1_14_547 154
77 3300050510 nmdc:mga06r32_674179_c1 nmdc:mga06r32_674179_c1_52_585 154
78 3300053084 Ga0495595_0001372 Ga0495595_0001372_1534_2052 154
79 3300053085 Ga0495619_0090875 Ga0495619_0090875_648_1166 154
80 3300061734 Ga0530510_0329770 Ga0530510_0329770_109_654 154
81 3300005327 Ga0070658_10012380 Ga0070658_100123805 155
82 3300005563 Ga0068855_100305522 Ga0068855_1003055222 155
83 iso_pu_bacteria 2643221600 2644009204 155
84 iso_pu_bacteria 2643221716 2644643926 155
85 iso_pu_bacteria 2643221725 2644681821 155
86 iso_pu_bacteria 2802428842 2802655269 155
87 iso_pu_bacteria 2883354860 2883356692 155
88 iso_pu_bacteria 2919191525 2919194231 155
89 iso_pu_bacteria 2919509842 2919511836 155
90 iso_pu_bacteria 2919683626 2919684604 155
91 iso_pu_bacteria 2965320100 2965321933 155
92 iso_pu_bacteria 2977268062 2977272065 155
93 iso_pu_bacteria 8054307821 8054311439 155
94 iso_pu_bacteria 8055419101 8055423572 155
95 iso_pu_bacteria 8055592153 8055595074 155
96 3300025909 Ga0207705_10011835 Ga0207705_100118355 156
97 3300025949 Ga0207667_10379187 Ga0207667_103791871 156
98 3300042147 Ga0450910_020842 Ga0450910_020842_113_646 156
99 3300048915 Ga0496112_0852106 Ga0496112_0852106_106_642 156
100 iso_pu_bacteria 8007375930 8007379637 156
101 3300002067 JGI24735J21928_10012565 JGI24735J21928_100125652 157
102 3300005539 Ga0068853_100083191 Ga0068853_1000831911 157
103 3300010375 Ga0105239_10102431 Ga0105239_101024316 157
104 3300050508 nmdc:mga09592_160521_c1 nmdc:mga09592_160521_c1_717_1250 157
105 3300050512 nmdc:mga0n895_56240_c1 nmdc:mga0n895_56240_c1_2827_3360 157
106 3300050515 nmdc:mga0a205_567090_c1 nmdc:mga0a205_567090_c1_420_953 157
107 3300005330 Ga0070690_100175638 Ga0070690_1001756383 158
108 3300005544 Ga0070686_100088453 Ga0070686_1000884533 158
109 3300005549 Ga0070704_100089057 Ga0070704_1000890575 158
110 3300020078 Ga0206352_11184891 Ga0206352_111848912 158
111 3300025919 Ga0207657_10032769 Ga0207657_1003276910 158
112 3300025935 Ga0207709_11018855 Ga0207709_110188551 158
113 3300026041 Ga0207639_10132032 Ga0207639_101320324 158
114 3300037418 Ga0395900_0130829 Ga0395900_0130829_460_1047 158
115 3300038443 Ga0395901_0342676 Ga0395901_0342676_434_1021 158
116 3300059478 Ga0587093_013249 Ga0587093_013249_27_614 158
117 3300059493 Ga0587077_007424 Ga0587077_007424_579_1166 158
118 3300001904 JGI24736J21556_1007818 JGI24736J21556_10078184 159
119 3300005288 Ga0065714_10252458 Ga0065714_102524581 159
120 3300005293 Ga0065715_10212898 Ga0065715_102128982 159
121 3300005347 Ga0070668_100316003 Ga0070668_1003160033 159
122 3300005356 Ga0070674_100477710 Ga0070674_1004777101 159
123 3300005546 Ga0070696_100148598 Ga0070696_1001485984 159
124 3300005616 Ga0068852_100604169 Ga0068852_1006041692 159
125 3300005834 Ga0068851_10019197 Ga0068851_100191972 159
126 3300006028 Ga0070717_11166309 Ga0070717_111663091 159
127 3300006042 Ga0075368_10002415 Ga0075368_100024153 159
128 3300006048 Ga0075363_100009208 Ga0075363_1000092085 159
129 3300006048 Ga0075363_100063933 Ga0075363_1000639332 159
130 3300006051 Ga0075364_10024908 Ga0075364_100249082 159
131 3300006051 Ga0075364_10114644 Ga0075364_101146444 159
132 3300006177 Ga0075362_10025610 Ga0075362_100256101 159
133 3300006178 Ga0075367_10035085 Ga0075367_100350856 159
134 3300006846 Ga0075430_100148259 Ga0075430_1001482592 159
135 3300006946 Ga0079104_1000280 Ga0079104_100028020 159
136 3300009011 Ga0105251_10017161 Ga0105251_100171612 159
137 3300009093 Ga0105240_10068403 Ga0105240_1006840310 159
138 3300009093 Ga0105240_11713787 Ga0105240_117137872 159
139 3300009174 Ga0105241_10051425 Ga0105241_100514252 159
140 3300009545 Ga0105237_10056200 Ga0105237_100562009 159
141 3300009551 Ga0105238_10011584 Ga0105238_1001158418 159
142 3300013100 Ga0157373_10001369 Ga0157373_1000136916 159
143 3300013104 Ga0157370_10198056 Ga0157370_101980564 159
144 3300013104 Ga0157370_10257422 Ga0157370_102574222 159
145 3300013308 Ga0157375_12109976 Ga0157375_121099761 159
146 3300015261 Ga0182006_1062258 Ga0182006_10622581 159
147 3300015261 Ga0182006_1079482 Ga0182006_10794821 159
148 3300021384 Ga0213876_10156320 Ga0213876_101563203 159
149 3300025321 Ga0207656_10021980 Ga0207656_100219804 159
150 3300025735 Ga0207713_1028456 Ga0207713_10284562 159
151 3300025911 Ga0207654_10027464 Ga0207654_100274643 159
152 3300025913 Ga0207695_10010441 Ga0207695_1001044110 159
153 3300025914 Ga0207671_10098988 Ga0207671_100989884 159
154 3300025924 Ga0207694_10058395 Ga0207694_100583952 159
155 3300025939 Ga0207665_10056664 Ga0207665_100566643 159
156 3300025940 Ga0207691_10452485 Ga0207691_104524852 159
157 3300027111 Ga0209281_1000337 Ga0209281_100033731 159
158 3300027866 Ga0209813_10000406 Ga0209813_100004064 159
159 3300031239 Ga0265328_10010665 Ga0265328_100106655 159
160 3300031239 Ga0265328_10034301 Ga0265328_100343014 159
161 3300031250 Ga0265331_10248136 Ga0265331_102481362 159
162 3300033180 Ga0307510_10128269 Ga0307510_101282692 159
163 3300035398 Ga0316574_0034560 Ga0316574_0034560_1750_2292 159
164 3300037068 Ga0373925_0022049 Ga0373925_0022049_1234_1767 159
165 3300039437 Ga0436365_0047289 Ga0436365_0047289_1488_2021 159
166 3300039437 Ga0436365_0454085 Ga0436365_0454085_970_1503 159
167 3300039453 Ga0436362_0255382 Ga0436362_0255382_399_932 159
168 3300041512 Ga0451853_3612113 Ga0451853_3612113_43_585 159
169 3300042876 Ga0451577_0142636 Ga0451577_0142636_1170_1703 159
170 3300044712 Ga0453684_0001066 Ga0453684_0001066_7244_7777 159
171 3300049581 Ga0501047_0037417 Ga0501047_0037417_946_1488 159
172 3300049822 Ga0501035_0018430 Ga0501035_0018430_4700_5242 159
173 3300050489 nmdc:mga03683_58535_c1 nmdc:mga03683_58535_c1_178_711 159
174 3300050489 nmdc:mga03683_862_c1 nmdc:mga03683_862_c1_5972_6505 159
175 3300050490 nmdc:mga03n38_129178_c1 nmdc:mga03n38_129178_c1_301_834 159
176 3300050490 nmdc:mga03n38_14808_c1 nmdc:mga03n38_14808_c1_569_1102 159
177 3300050490 nmdc:mga03n38_243517_c1 nmdc:mga03n38_243517_c1_18_551 159
178 3300050491 nmdc:mga00v17_21650_c1 nmdc:mga00v17_21650_c1_271_804 159
179 3300050491 nmdc:mga00v17_98762_c1 nmdc:mga00v17_98762_c1_1142_1675 159
180 3300050494 nmdc:mga06z11_18440_c1 nmdc:mga06z11_18440_c1_1524_2057 159
181 3300050495 nmdc:mga04h51_11198_c1 nmdc:mga04h51_11198_c1_685_1218 159
182 3300053085 Ga0495619_0157287 Ga0495619_0157287_103_636 159
183 3300053092 Ga0500583_0202879 Ga0500583_0202879_163_696 159
184 3300053096 Ga0500641_0149408 Ga0500641_0149408_300_833 159
185 3300059505 Ga0587083_0014617 Ga0587083_0014617_312_857 159
186 3300059645 Ga0587076_055699 Ga0587076_055699_130_672 159
187 3300001991 JGI24743J22301_10010320 JGI24743J22301_100103202 160
188 3300003203 JGI25406J46586_10000001 JGI25406J46586_10000001199 160
189 3300005290 Ga0065712_10267158 Ga0065712_102671582 160
190 3300005290 Ga0065712_10301275 Ga0065712_103012752 160
191 3300005328 Ga0070676_10032758 Ga0070676_100327588 160
192 3300005330 Ga0070690_100167796 Ga0070690_1001677963 160
193 3300005334 Ga0068869_100268537 Ga0068869_1002685372 160
194 3300005337 Ga0070682_100115504 Ga0070682_1001155044 160
195 3300005343 Ga0070687_100035423 Ga0070687_1000354234 160
196 3300005438 Ga0070701_10013814 Ga0070701_100138149 160
197 3300005440 Ga0070705_101234394 Ga0070705_1012343941 160
198 3300005441 Ga0070700_100037218 Ga0070700_1000372182 160
199 3300005444 Ga0070694_100080432 Ga0070694_1000804322 160
200 3300005466 Ga0070685_10015156 Ga0070685_100151564 160
201 3300005467 Ga0070706_100357086 Ga0070706_1003570861 160
202 3300005468 Ga0070707_100000292 Ga0070707_10000029213 160
203 3300005468 Ga0070707_100528407 Ga0070707_1005284072 160
204 3300005471 Ga0070698_100007384 Ga0070698_1000073846 160
205 3300005471 Ga0070698_100326511 Ga0070698_1003265114 160
206 3300005535 Ga0070684_100202332 Ga0070684_1002023323 160
207 3300005543 Ga0070672_101018380 Ga0070672_1010183802 160
208 3300005545 Ga0070695_100008633 Ga0070695_1000086339 160
209 3300005617 Ga0068859_100342824 Ga0068859_1003428243 160
210 3300005841 Ga0068863_100038569 Ga0068863_1000385693 160
211 3300005841 Ga0068863_100342260 Ga0068863_1003422603 160
212 3300005937 Ga0081455_10344702 Ga0081455_103447022 160
213 3300005985 Ga0081539_10059040 Ga0081539_100590404 160
214 3300005985 Ga0081539_10077680 Ga0081539_100776802 160
215 3300006844 Ga0075428_100010507 Ga0075428_1000105078 160
216 3300006852 Ga0075433_10045975 Ga0075433_100459756 160
217 3300006852 Ga0075433_10108788 Ga0075433_101087882 160
218 3300006871 Ga0075434_100072156 Ga0075434_1000721563 160
219 3300006871 Ga0075434_100156699 Ga0075434_1001566992 160
220 3300006914 Ga0075436_100032597 Ga0075436_1000325975 160
221 3300006914 Ga0075436_100691897 Ga0075436_1006918972 160
222 3300006931 Ga0097620_100342811 Ga0097620_1003428113 160
223 3300007076 Ga0075435_100011633 Ga0075435_1000116338 160
224 3300009147 Ga0114129_10065627 Ga0114129_100656276 160
225 3300013297 Ga0157378_10005509 Ga0157378_1000550910 160
226 3300013297 Ga0157378_10174062 Ga0157378_101740623 160
227 3300025910 Ga0207684_10216735 Ga0207684_102167352 160
228 3300025918 Ga0207662_10005790 Ga0207662_1000579011 160
229 3300025922 Ga0207646_10001393 Ga0207646_1000139338 160
230 3300025922 Ga0207646_10196281 Ga0207646_101962811 160
231 3300025960 Ga0207651_10025687 Ga0207651_100256874 160
232 3300026075 Ga0207708_10061239 Ga0207708_100612393 160
233 3300026088 Ga0207641_10185679 Ga0207641_101856793 160
234 3300028380 Ga0268265_10363120 Ga0268265_103631202 160
235 3300035083 Ga0373926_0025205 Ga0373926_0025205_741_1280 160
236 3300035114 Ga0373939_0290036 Ga0373939_0290036_26_562 160
237 3300035170 Ga0373943_0057911 Ga0373943_0057911_470_1009 160
238 3300035171 Ga0373946_0465893 Ga0373946_0465893_74_613 160
239 3300035172 Ga0373955_0008379 Ga0373955_0008379_3857_4396 160
240 3300035724 Ga0373933_0052084 Ga0373933_0052084_785_1324 160
241 3300035724 Ga0373933_0434530 Ga0373933_0434530_17_556 160
242 3300038742 Ga0400486_30747 Ga0400486_30747_401_937 160
243 3300042876 Ga0451577_0003056 Ga0451577_0003056_14715_15254 160
244 3300044694 Ga0466963_0395345 Ga0466963_0395345_180_716 160
245 3300044712 Ga0453684_0996925 Ga0453684_0996925_77_613 160
246 3300044735 Ga0466968_0482376 Ga0466968_0482376_17_577 160
247 3300045051 Ga0451576_0062715 Ga0451576_0062715_626_1165 160
248 3300045051 Ga0451576_0306814 Ga0451576_0306814_741_1280 160
249 3300045051 Ga0451576_0455285 Ga0451576_0455285_691_1227 160
250 3300045051 Ga0451576_1141606 Ga0451576_1141606_183_722 160
251 3300046454 Ga0495592_0102898 Ga0495592_0102898_338_877 160
252 3300046461 Ga0495641_0054267 Ga0495641_0054267_1142_1681 160
253 3300046462 Ga0495651_0192132 Ga0495651_0192132_535_1074 160
254 3300046473 Ga0495582_0159873 Ga0495582_0159873_700_1236 160
255 3300046516 Ga0495628_0040395 Ga0495628_0040395_1468_2007 160
256 3300046517 Ga0495630_0017678 Ga0495630_0017678_1639_2178 160
257 3300046529 Ga0495652_0018013 Ga0495652_0018013_253_792 160
258 3300046533 Ga0495640_0156271 Ga0495640_0156271_383_919 160
259 3300046533 Ga0495640_0360479 Ga0495640_0360479_321_860 160
260 3300046536 Ga0495587_0249964 Ga0495587_0249964_381_920 160
261 3300046543 Ga0495645_0063981 Ga0495645_0063981_195_734 160
262 3300046559 Ga0495667_0397826 Ga0495667_0397826_310_849 160
263 3300046642 Ga0495634_0048412 Ga0495634_0048412_2264_2803 160
264 3300046663 Ga0495635_0533199 Ga0495635_0533199_203_742 160
265 3300046683 Ga0495658_0348637 Ga0495658_0348637_163_702 160
266 3300046683 Ga0495658_0538338 Ga0495658_0538338_82_621 160
267 3300046689 Ga0495613_0220347 Ga0495613_0220347_45_581 160
268 3300046809 Ga0495600_0151608 Ga0495600_0151608_372_911 160
269 3300047322 Ga0495680_0139261 Ga0495680_0139261_255_791 160
270 3300047444 Ga0495675_0002584 Ga0495675_0002584_6659_7198 160
271 3300047471 Ga0495684_0164535 Ga0495684_0164535_33_572 160
272 3300048915 Ga0496112_0273283 Ga0496112_0273283_1034_1573 160
273 3300048925 Ga0496122_0239688 Ga0496122_0239688_432_974 160
274 3300048929 Ga0496126_0179750 Ga0496126_0179750_1045_1587 160
275 3300049527 Ga0501311_004736 Ga0501311_004736_378_917 160
276 3300049571 Ga0501034_0002020 Ga0501034_0002020_8243_8797 160
277 3300049592 Ga0501076_0259125 Ga0501076_0259125_236_775 160
278 3300050507 nmdc:mga05p37_78937_c1 nmdc:mga05p37_78937_c1_1934_2473 160
279 3300050512 nmdc:mga0n895_204846_c1 nmdc:mga0n895_204846_c1_1100_1639 160
280 3300050514 nmdc:mga08x19_572176_c1 nmdc:mga08x19_572176_c1_113_652 160
281 3300050514 nmdc:mga08x19_80561_c1 nmdc:mga08x19_80561_c1_113_652 160
282 3300050514 nmdc:mga08x19_81630_c1 nmdc:mga08x19_81630_c1_1453_1992 160
283 3300053077 Ga0495601_0180268 Ga0495601_0180268_52_591 160
284 3300053139 Ga0500568_0043000 Ga0500568_0043000_225_761 160
285 3300004798 Ga0058859_10022019 Ga0058859_100220193 161
286 3300005340 Ga0070689_100292113 Ga0070689_1002921133 161
287 3300006237 Ga0097621_100907756 Ga0097621_1009077562 161
288 3300006946 Ga0079104_1010677 Ga0079104_10106778 161
289 3300006946 Ga0079104_1028321 Ga0079104_10283212 161
290 3300006946 Ga0079104_1040574 Ga0079104_10405741 161
291 3300027111 Ga0209281_1000059 Ga0209281_100005962 161
292 3300027111 Ga0209281_1000435 Ga0209281_100043563 161
293 3300031727 Ga0316576_10020212 Ga0316576_100202124 161
294 3300031727 Ga0316576_10036550 Ga0316576_100365503 161
295 3300031727 Ga0316576_10052895 Ga0316576_100528952 161
296 3300032002 Ga0307416_100037641 Ga0307416_1000376416 161
297 3300032168 Ga0316593_10200638 Ga0316593_102006381 161
298 3300033524 Ga0316592_1005208 Ga0316592_10052081 161
299 3300033528 Ga0316588_1024940 Ga0316588_10249403 161
300 3300033528 Ga0316588_1034897 Ga0316588_10348973 161
301 3300033541 Ga0316596_1001043 Ga0316596_100104310 161
302 3300039437 Ga0436365_0252966 Ga0436365_0252966_1123_1674 161
303 3300046458 Ga0495591_016124 Ga0495591_016124_1758_2339 161
304 3300046463 Ga0495653_0453133 Ga0495653_0453133_94_675 161
305 3300046515 Ga0495620_0017318 Ga0495620_0017318_2788_3372 161
306 3300046530 Ga0495654_0110712 Ga0495654_0110712_158_742 161
307 3300047320 Ga0495672_0006039 Ga0495672_0006039_1231_1773 161
308 3300048927 Ga0496124_0289073 Ga0496124_0289073_530_1111 161
309 3300048929 Ga0496126_0000190 Ga0496126_0000190_7787_8329 161
310 3300049571 Ga0501034_0256368 Ga0501034_0256368_125_676 161
311 3300049584 Ga0501068_0041718 Ga0501068_0041718_1084_1635 161
312 3300049586 Ga0501070_0097827 Ga0501070_0097827_1319_1870 161
313 3300049590 Ga0501074_0212749 Ga0501074_0212749_780_1331 161
314 3300053139 Ga0500568_0014440 Ga0500568_0014440_2001_2537 161
315 3300053139 Ga0500568_0028292 Ga0500568_0028292_971_1522 161
316 3300059491 Ga0587070_012594 Ga0587070_012594_653_1204 161
317 3300059493 Ga0587077_062247 Ga0587077_062247_158_706 161
318 3300060353 Ga0501082_0784681 Ga0501082_0784681_159_710 161
319 3300001904 JGI24736J21556_1000535 JGI24736J21556_10005358 162
320 3300004799 Ga0058863_11792460 Ga0058863_117924602 162
321 3300004800 Ga0058861_12054136 Ga0058861_120541362 162
322 3300004803 Ga0058862_12698388 Ga0058862_126983883 162
323 3300005327 Ga0070658_10322598 Ga0070658_103225982 162
324 3300005327 Ga0070658_10562326 Ga0070658_105623261 162
325 3300005329 Ga0070683_100003081 Ga0070683_10000308119 162
326 3300005329 Ga0070683_100140844 Ga0070683_1001408442 162
327 3300005335 Ga0070666_10002665 Ga0070666_1000266516 162
328 3300005335 Ga0070666_10254245 Ga0070666_102542453 162
329 3300005336 Ga0070680_101133331 Ga0070680_1011333311 162
330 3300005354 Ga0070675_100195349 Ga0070675_1001953492 162
331 3300005356 Ga0070674_100061977 Ga0070674_1000619773 162
332 3300005364 Ga0070673_100025448 Ga0070673_1000254485 162
333 3300005364 Ga0070673_100179188 Ga0070673_1001791883 162
334 3300005367 Ga0070667_100541668 Ga0070667_1005416682 162
335 3300005435 Ga0070714_100287287 Ga0070714_1002872873 162
336 3300005440 Ga0070705_100217179 Ga0070705_1002171792 162
337 3300005445 Ga0070708_100091045 Ga0070708_1000910456 162
338 3300005445 Ga0070708_100594236 Ga0070708_1005942361 162
339 3300005518 Ga0070699_100202470 Ga0070699_1002024703 162
340 3300005530 Ga0070679_100234077 Ga0070679_1002340771 162
341 3300005530 Ga0070679_100243390 Ga0070679_1002433902 162
342 3300005530 Ga0070679_100881841 Ga0070679_1008818411 162
343 3300005535 Ga0070684_100056547 Ga0070684_1000565476 162
344 3300005535 Ga0070684_100095201 Ga0070684_1000952013 162
345 3300005543 Ga0070672_100223373 Ga0070672_1002233733 162
346 3300005543 Ga0070672_100522321 Ga0070672_1005223211 162
347 3300005548 Ga0070665_100474722 Ga0070665_1004747221 162
348 3300005549 Ga0070704_100464119 Ga0070704_1004641192 162
349 3300005563 Ga0068855_100293461 Ga0068855_1002934612 162
350 3300005563 Ga0068855_100384175 Ga0068855_1003841753 162
351 3300005563 Ga0068855_100808242 Ga0068855_1008082421 162
352 3300005577 Ga0068857_100192841 Ga0068857_1001928412 162
353 3300005842 Ga0068858_100020832 Ga0068858_10002083210 162
354 3300005842 Ga0068858_100594385 Ga0068858_1005943852 162
355 3300005843 Ga0068860_100111708 Ga0068860_1001117082 162
356 3300006881 Ga0068865_100170664 Ga0068865_1001706641 162
357 3300009098 Ga0105245_10004821 Ga0105245_100048212 162
358 3300009098 Ga0105245_10093563 Ga0105245_100935633 162
359 3300009177 Ga0105248_10113808 Ga0105248_101138087 162
360 3300010375 Ga0105239_10032725 Ga0105239_1003272512 162
361 3300013297 Ga0157378_10044546 Ga0157378_100445463 162
362 3300013306 Ga0163162_10907605 Ga0163162_109076052 162
363 3300014325 Ga0163163_10053826 Ga0163163_100538265 162
364 3300014745 Ga0157377_10135165 Ga0157377_101351654 162
365 3300020076 Ga0206355_1444440 Ga0206355_14444402 162
366 3300020077 Ga0206351_10771532 Ga0206351_107715324 162
367 3300020080 Ga0206350_10810608 Ga0206350_108106083 162
368 3300022467 Ga0224712_10000184 Ga0224712_1000018418 162
369 3300025903 Ga0207680_10001681 Ga0207680_1000168116 162
370 3300025903 Ga0207680_10023603 Ga0207680_100236034 162
371 3300025904 Ga0207647_10000001 Ga0207647_10000001484 162
372 3300025904 Ga0207647_10054869 Ga0207647_100548693 162
373 3300025904 Ga0207647_10056801 Ga0207647_100568013 162
374 3300025912 Ga0207707_10625759 Ga0207707_106257591 162
375 3300025915 Ga0207693_10350498 Ga0207693_103504981 162
376 3300025921 Ga0207652_10198175 Ga0207652_101981753 162
377 3300025921 Ga0207652_10541848 Ga0207652_105418483 162
378 3300025921 Ga0207652_10588609 Ga0207652_105886093 162
379 3300025921 Ga0207652_10719467 Ga0207652_107194672 162
380 3300025927 Ga0207687_10015188 Ga0207687_1001518812 162
381 3300025929 Ga0207664_10051819 Ga0207664_100518194 162
382 3300025937 Ga0207669_10043775 Ga0207669_100437753 162
383 3300025940 Ga0207691_10271540 Ga0207691_102715402 162
384 3300025940 Ga0207691_10312457 Ga0207691_103124572 162
385 3300025944 Ga0207661_10002899 Ga0207661_100028997 162
386 3300025949 Ga0207667_10276788 Ga0207667_102767882 162
387 3300025986 Ga0207658_10134659 Ga0207658_101346592 162
388 3300026023 Ga0207677_10125596 Ga0207677_101255963 162
389 3300026035 Ga0207703_10043924 Ga0207703_100439245 162
390 3300026078 Ga0207702_10407713 Ga0207702_104077133 162
391 3300026116 Ga0207674_10217783 Ga0207674_102177834 162
392 3300028381 Ga0268264_10121832 Ga0268264_101218321 162
393 3300028573 Ga0265334_10018557 Ga0265334_100185573 162
394 3300028654 Ga0265322_10027648 Ga0265322_100276482 162
395 3300028800 Ga0265338_10030478 Ga0265338_100304788 162
396 3300028800 Ga0265338_10099324 Ga0265338_100993244 162
397 3300029957 Ga0265324_10019999 Ga0265324_100199993 162
398 3300031240 Ga0265320_10003506 Ga0265320_1000350618 162
399 3300031242 Ga0265329_10002134 Ga0265329_1000213418 162
400 3300031249 Ga0265339_10013165 Ga0265339_100131654 162
401 3300031250 Ga0265331_10022569 Ga0265331_100225693 162
402 3300031595 Ga0265313_10025503 Ga0265313_100255032 162
403 3300031665 Ga0316575_10038599 Ga0316575_100385992 162
404 3300031711 Ga0265314_10020637 Ga0265314_100206377 162
405 3300031727 Ga0316576_10028618 Ga0316576_100286182 162
406 3300031727 Ga0316576_10082478 Ga0316576_100824781 162
407 3300031728 Ga0316578_10354771 Ga0316578_103547712 162
408 3300032139 Ga0316580_10030960 Ga0316580_100309602 162
409 3300033524 Ga0316592_1008100 Ga0316592_10081003 162
410 3300033528 Ga0316588_1012952 Ga0316588_10129523 162
411 3300033541 Ga0316596_1016449 Ga0316596_10164492 162
412 3300035242 Ga0373962_0019963 Ga0373962_0019963_1126_1665 162
413 3300035724 Ga0373933_0228217 Ga0373933_0228217_593_1144 162
414 3300036401 Ga0373937_0039877 Ga0373937_0039877_3405_3956 162
415 3300037418 Ga0395900_0169317 Ga0395900_0169317_98_655 162
416 3300037466 Ga0395898_0259888 Ga0395898_0259888_922_1479 162
417 3300037466 Ga0395898_0519672 Ga0395898_0519672_207_758 162
418 3300038443 Ga0395901_0554807 Ga0395901_0554807_295_846 162
419 3300041501 Ga0451845_0735073 Ga0451845_0735073_912_1463 162
420 3300041512 Ga0451853_2946566 Ga0451853_2946566_1059_1610 162
421 3300042876 Ga0451577_0006236 Ga0451577_0006236_1774_2328 162
422 3300042876 Ga0451577_0030192 Ga0451577_0030192_1352_1903 162
423 3300044706 Ga0466964_0079439 Ga0466964_0079439_436_987 162
424 3300044712 Ga0453684_0000041 Ga0453684_0000041_579982_580536 162
425 3300044712 Ga0453684_0014647 Ga0453684_0014647_7090_7641 162
426 3300044712 Ga0453684_0555181 Ga0453684_0555181_577_1125 162
427 3300046454 Ga0495592_0039694 Ga0495592_0039694_741_1292 162
428 3300046463 Ga0495653_0015203 Ga0495653_0015203_2198_2749 162
429 3300046514 Ga0495618_0026915 Ga0495618_0026915_711_1262 162
430 3300046516 Ga0495628_0042913 Ga0495628_0042913_96_647 162
431 3300046529 Ga0495652_0146626 Ga0495652_0146626_728_1279 162
432 3300046529 Ga0495652_0240591 Ga0495652_0240591_256_813 162
433 3300046533 Ga0495640_0122566 Ga0495640_0122566_55_606 162
434 3300046536 Ga0495587_0311471 Ga0495587_0311471_46_597 162
435 3300046543 Ga0495645_0059278 Ga0495645_0059278_1705_2256 162
436 3300046642 Ga0495634_0057228 Ga0495634_0057228_264_815 162
437 3300046675 Ga0495657_0129594 Ga0495657_0129594_431_982 162
438 3300046678 Ga0495599_0049077 Ga0495599_0049077_384_935 162
439 3300046680 Ga0495646_0137961 Ga0495646_0137961_259_816 162
440 3300047317 Ga0495604_0167202 Ga0495604_0167202_148_699 162
441 3300047319 Ga0495674_0066935 Ga0495674_0066935_312_863 162
442 3300047322 Ga0495680_0078703 Ga0495680_0078703_331_882 162
443 3300047444 Ga0495675_0398209 Ga0495675_0398209_147_698 162
444 3300047471 Ga0495684_0057456 Ga0495684_0057456_2259_2810 162
445 3300048903 Ga0496100_0217454 Ga0496100_0217454_170_721 162
446 3300048905 Ga0496102_0067414 Ga0496102_0067414_1356_1901 162
447 3300048909 Ga0496106_0112458 Ga0496106_0112458_986_1531 162
448 3300048913 Ga0496110_0105501 Ga0496110_0105501_680_1225 162
449 3300048914 Ga0496111_0554903 Ga0496111_0554903_196_741 162
450 3300048917 Ga0496114_1062747 Ga0496114_1062747_31_576 162
451 3300049578 Ga0501042_0728848 Ga0501042_0728848_117_668 162
452 3300049587 Ga0501071_0514368 Ga0501071_0514368_271_822 162
453 3300049591 Ga0501075_0712354 Ga0501075_0712354_111_662 162
454 3300049592 Ga0501076_1227162 Ga0501076_1227162_24_575 162
455 3300049744 Ga0501083_0000127 Ga0501083_0000127_1668_2288 162
456 3300050513 nmdc:mga0rr50_354464_c1 nmdc:mga0rr50_354464_c1_12_569 162
457 3300053077 Ga0495601_0005352 Ga0495601_0005352_5239_5790 162
458 3300053077 Ga0495601_0080551 Ga0495601_0080551_473_1030 162
459 3300053084 Ga0495595_0024335 Ga0495595_0024335_539_1090 162
460 3300053085 Ga0495619_0005930 Ga0495619_0005930_5363_5914 162
461 3300053158 Ga0500627_0085685 Ga0500627_0085685_501_1040 162
462 3300059421 Ga0590071_051639 Ga0590071_051639_218_769 162
463 3300059423 Ga0590074_002898 Ga0590074_002898_1967_2518 162
464 3300059424 Ga0590075_001597 Ga0590075_001597_3444_3995 162
465 3300059426 Ga0590077_013957 Ga0590077_013957_935_1486 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

113

187

0.98

PF00347

Ribosomal_L6

Ribosomal protein L6

23

105

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cgk-assembly1.cif.gz_g lincomycin and avilamycin bound to the 50s subunit 0.9271 2 154
8ceu-assembly1.cif.gz_g retapamulin and capreomycin bound to the 50s subunit 0.9255 2 154
6xyw-assembly1.cif.gz_Af structure of the plant mitochondrial ribosome 0.9231 64 159
6v3b-assembly1.cif.gz_G cryo-em structure of the acinetobacter baumannii ribosome: 70s in empty state 0.9175 2 154
8cvm-assembly1.cif.gz_g cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9156 2 157
ID Description Score Start End Superfamily
af_O21037_77_170_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9737 66 157 3.90.930.12
af_Q25814_82_167_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9631 66 147 3.90.930.12
af_Q09865_118_210_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9622 66 155 3.90.930.12
2awbG02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.96 66 157 3.90.930.12
af_Q6AU10_7_103_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9545 68 161 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A1Q3BQV3-F1-model_v4 Ribosomal_L6 domain-containing protein 0.985 66 159 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A0G1Y946-F1-model_v4 50S ribosomal protein L6 0.9846 64 159 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A382BX83-F1-model_v4 Large ribosomal subunit protein uL6 alpha-beta domain-containing protein 0.9836 51 159 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A2J1D431-F1-model_v4 deleted 0.981 57 150
AF-A0A438WPT2-F1-model_v4 50S ribosomal protein L6 0.9805 68 161 GO:0002181
GO:0003735
GO:0019843
GO:0022625

Feature Viewer

pLDDT pTM Quality
88.51 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map