F449574

General Info

Members Datasets Scaffolds Average Seq Length
465 290 930 284

Family's Representative Sequence

Representative Sequence 3300050513|nmdc:mga0rr50_73010_c1|nmdc:mga0rr50_73010_c1_602_1540
Length 312
Sequence LLALCSGLGEGRKDTKNLHRILSFLLRAAAILPLRALHAVGFVLGWAMYGMSPTYRRHLRDNLGQAGLDAPATRRAAIAAAGQMIAELPALWFRPRAKSLALVKGAEGVEAVLAARAAGKALLLLTPHHGCFEISAHYAAQIFPITVLYRAPKIAWLEPLMREGRAGDNLRLAPADVSGVRELFRALERGEAAGFLPDQVPGLGEGEWTEFFGKPAYTMTLAAKLAERPNIATFLAYAQRLPKGEGYRIVVRRFPAKDSSETAARRLNRALEDLVRECPEQYLWGYNRYKTPAGAEPPPGAGGNIPPAPPVA

Samples

Sample ID Description Type Environment
1 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
102 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
106 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
107 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
110 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
164 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
165 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
166 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
167 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
168 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
169 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
170 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
171 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
172 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
177 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
178 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
184 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
185 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
186 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
187 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
188 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
189 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
190 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
191 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
192 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
195 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
199 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
202 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
203 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
208 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
214 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
215 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
216 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
217 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
218 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
219 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
223 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
224 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
227 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
230 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
246 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
249 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
250 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
251 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
252 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
255 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
259 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
260 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
261 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
262 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
263 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
264 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
265 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
268 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
269 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
275 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
276 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
277 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
278 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
279 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
280 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
281 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
282 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
283 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
284 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
285 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
286 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
287 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
288 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
289 2643221660 Methylibium sp. Root1272 Isolate Unclassified
290 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.62
Nodule 0
Rhizoplane 0.22
Rhizosphere 78.92
Stem 0
Stem Tuber 0
Unclassified 1.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0rr50_73010_c1 3300050513 Bacteria 2622
2 JGI24033J26618_1013010 3300002155 Unclassified 1007
3 JGI25156J39149_1002577 3300002705 Bacteria 6413
4 JGI25154J39366_1000518 3300002738 Bacteria 19464
5 JGI25157J39369_1000743 3300002741 Bacteria 17282
6 rootH1_10052059 3300003316 Bacteria 7994
7 rootH1_10050641 3300003323 Bacteria 5530
8 rootH1_10050678 3300003323 Bacteria 13701
9 Ga0055539_1000140 3300003752 Bacteria 74869
10 Ga0055539_1001323 3300003752 Bacteria 4803
11 Ga0055533_1000045 3300003756 Bacteria 223637
12 Ga0055535_1002371 3300003761 Bacteria 6749
13 Ga0055529_1000148 3300003763 Bacteria 100809
14 Ga0055529_1010900 3300003763 Bacteria 1176
15 Ga0065715_10104788 3300005293 Bacteria 2931
16 Ga0070658_10054707 3300005327 Bacteria 3240
17 Ga0070658_10056054 3300005327 Bacteria 3202
18 Ga0070676_10010008 3300005328 Bacteria 5132
19 Ga0070676_10116342 3300005328 Bacteria 1672
20 Ga0070690_100017574 3300005330 Bacteria 4304
21 Ga0070690_100042630 3300005330 Bacteria 2875
22 Ga0070690_100244814 3300005330 Bacteria 1266
23 Ga0070670_100062592 3300005331 Bacteria 3194
24 Ga0070670_100293284 3300005331 Bacteria 1422
25 Ga0070670_100340841 3300005331 Bacteria 1316
26 Ga0068869_100013610 3300005334 Bacteria 5415
27 Ga0068869_100078771 3300005334 Bacteria 2455
28 Ga0070680_100038414 3300005336 Bacteria 3872
29 Ga0070680_100170046 3300005336 Bacteria 1833
30 Ga0070680_100384041 3300005336 Bacteria 1196
31 Ga0068868_100051935 3300005338 Bacteria 3227
32 Ga0070660_100138703 3300005339 Bacteria 1949
33 Ga0070660_100154391 3300005339 Bacteria 1847
34 Ga0070687_100046936 3300005343 Bacteria 2213
35 Ga0070687_100156970 3300005343 Bacteria 1341
36 Ga0070661_100295412 3300005344 Unclassified 1260
37 Ga0070692_10003525 3300005345 Bacteria 6362
38 Ga0070692_10165049 3300005345 Bacteria 1272
39 Ga0070668_100087502 3300005347 Bacteria 2451
40 Ga0070669_100003316 3300005353 Bacteria 11568
41 Ga0070675_100246700 3300005354 Bacteria 1561
42 Ga0070671_100189176 3300005355 Bacteria 1745
43 Ga0070671_100201286 3300005355 Bacteria 1688
44 Ga0070674_100138998 3300005356 Bacteria 1821
45 Ga0070673_100008834 3300005364 Bacteria 6728
46 Ga0070673_100011910 3300005364 Bacteria 5957
47 Ga0070673_100192493 3300005364 Bacteria 1752
48 Ga0070659_100093718 3300005366 Bacteria 2410
49 Ga0070667_100207387 3300005367 Bacteria 1741
50 Ga0070667_100633377 3300005367 Bacteria 987
51 Ga0070710_10051880 3300005437 Bacteria 2305
52 Ga0070705_100033683 3300005440 Bacteria 2857
53 Ga0070700_100001929 3300005441 Bacteria 10495
54 Ga0070694_100007385 3300005444 Bacteria 6701
55 Ga0070694_100075703 3300005444 Bacteria 2328
56 Ga0070708_100471397 3300005445 Bacteria 1184
57 Ga0070663_100053189 3300005455 Bacteria 2890
58 Ga0070663_100230235 3300005455 Bacteria 1459
59 Ga0070678_100318739 3300005456 Bacteria 1327
60 Ga0070662_100144968 3300005457 Bacteria 1844
61 Ga0070662_100222787 3300005457 Bacteria 1506
62 Ga0070681_10000135 3300005458 Bacteria 56156
63 Ga0068867_100000606 3300005459 Bacteria 23757
64 Ga0068867_100021775 3300005459 Bacteria 4576
65 Ga0068867_100023367 3300005459 Bacteria 4426
66 Ga0068867_100155788 3300005459 Bacteria 1798
67 Ga0068867_100487160 3300005459 Bacteria 1058
68 Ga0068867_100488044 3300005459 Bacteria 1057
69 Ga0070706_100003188 3300005467 Bacteria 16188
70 Ga0070707_100037315 3300005468 Bacteria 4637
71 Ga0070707_100579144 3300005468 Bacteria 1085
72 Ga0070698_100036226 3300005471 Bacteria 5099
73 Ga0070699_100214835 3300005518 Bacteria 1713
74 Ga0070699_100308891 3300005518 Bacteria 1419
75 Ga0070679_100046897 3300005530 Bacteria 4308
76 Ga0070697_100017635 3300005536 Bacteria 5623
77 Ga0068853_100249322 3300005539 Bacteria 1629
78 Ga0070686_100265549 3300005544 Bacteria 1260
79 Ga0070686_100297439 3300005544 Bacteria 1196
80 Ga0070695_100003127 3300005545 Bacteria 9643
81 Ga0070696_100001158 3300005546 Bacteria 17126
82 Ga0070696_100043993 3300005546 Bacteria 3091
83 Ga0070665_100035834 3300005548 Bacteria 4991
84 Ga0070704_100009462 3300005549 Bacteria 5888
85 Ga0070704_100096596 3300005549 Bacteria 2215
86 Ga0068855_100012349 3300005563 Bacteria 10318
87 Ga0068855_100161223 3300005563 Bacteria 2545
88 Ga0070664_100189498 3300005564 Bacteria 1832
89 Ga0070664_100382923 3300005564 Bacteria 1284
90 Ga0068857_100003374 3300005577 Bacteria 13292
91 Ga0068857_100253283 3300005577 Bacteria 1614
92 Ga0068854_100008220 3300005578 Bacteria 6697
93 Ga0068854_100222791 3300005578 Bacteria 1493
94 Ga0068856_100002437 3300005614 Bacteria 19136
95 Ga0068852_100113529 3300005616 Bacteria 2467
96 Ga0068852_100279551 3300005616 Bacteria 1609
97 Ga0068859_100024148 3300005617 Bacteria 6100
98 Ga0068859_100067147 3300005617 Bacteria 3620
99 Ga0068864_100007242 3300005618 Bacteria 9120
100 Ga0068861_100000492 3300005719 Bacteria 22985
101 Ga0068861_100008163 3300005719 Bacteria 7204
102 Ga0068870_10024562 3300005840 Bacteria 2983
103 Ga0068863_100027398 3300005841 Bacteria 5435
104 Ga0068862_100002979 3300005844 Bacteria 14786
105 Ga0075365_10173538 3300006038 Bacteria 1505
106 Ga0075368_10001585 3300006042 Bacteria 7303
107 Ga0075368_10017530 3300006042 Bacteria 2681
108 Ga0075364_10187728 3300006051 Bacteria 1399
109 Ga0070716_100066925 3300006173 Bacteria 2097
110 Ga0075362_10004323 3300006177 Bacteria 5085
111 Ga0075362_10032216 3300006177 Bacteria 2273
112 Ga0075367_10009705 3300006178 Bacteria 5043
113 Ga0075367_10016595 3300006178 Bacteria 4022
114 Ga0075367_10019903 3300006178 Bacteria 3729
115 Ga0075369_10022846 3300006186 Bacteria 2582
116 Ga0075366_10046772 3300006195 Bacteria 2564
117 Ga0075366_10055015 3300006195 Bacteria 2364
118 Ga0075366_10096726 3300006195 Bacteria 1770
119 Ga0075366_10121013 3300006195 Bacteria 1577
120 Ga0075366_10203571 3300006195 Bacteria 1204
121 Ga0097621_100029903 3300006237 Bacteria 4306
122 Ga0097621_100188659 3300006237 Bacteria 1784
123 Ga0097621_100213016 3300006237 Bacteria 1681
124 Ga0075370_10002430 3300006353 Bacteria 8635
125 Ga0075370_10011130 3300006353 Bacteria 4719
126 Ga0075370_10011503 3300006353 Bacteria 4653
127 Ga0075370_10017563 3300006353 Bacteria 3867
128 Ga0075370_10018414 3300006353 Bacteria 3790
129 Ga0068871_100001506 3300006358 Bacteria 15616
130 Ga0075428_100051859 3300006844 Bacteria 4499
131 Ga0075431_100040353 3300006847 Bacteria 4810
132 Ga0075431_100132842 3300006847 Bacteria 2567
133 Ga0075431_100263023 3300006847 Bacteria 1750
134 Ga0075433_10333671 3300006852 Bacteria 1341
135 Ga0075434_100000002 3300006871 Bacteria 135661
136 Ga0068865_100007318 3300006881 Bacteria 6783
137 Ga0075436_100034169 3300006914 Bacteria 3506
138 Ga0097620_100024148 3300006931 Bacteria 6100
139 Ga0097620_100067148 3300006931 Bacteria 3620
140 Ga0075435_100004018 3300007076 Bacteria 10052
141 Ga0105240_10047132 3300009093 Bacteria 5456
142 Ga0105240_10202928 3300009093 Bacteria 2322
143 Ga0111539_10184208 3300009094 Bacteria 2438
144 Ga0105245_10106875 3300009098 Bacteria 2597
145 Ga0105245_10205234 3300009098 Bacteria 1894
146 Ga0105245_10212568 3300009098 Bacteria 1862
147 Ga0105247_10080685 3300009101 Bacteria 2050
148 Ga0114129_10156352 3300009147 Bacteria 3117
149 Ga0114129_10902887 3300009147 Bacteria 1119
150 Ga0105241_10064719 3300009174 Bacteria 2824
151 Ga0105242_10028991 3300009176 Bacteria 4411
152 Ga0105242_10342569 3300009176 Bacteria 1378
153 Ga0105237_10157941 3300009545 Bacteria 2265
154 Ga0105239_10357438 3300010375 Bacteria 1649
155 Ga0157369_10054876 3300013105 Bacteria 4302
156 Ga0163162_10137495 3300013306 Bacteria 2555
157 Ga0157375_10046040 3300013308 Bacteria 4250
158 Ga0157375_10081044 3300013308 Bacteria 3285
159 Ga0157380_10230891 3300014326 Unclassified 1662
160 Ga0157377_10277655 3300014745 Bacteria 1097
161 Ga0157379_10152584 3300014968 Bacteria 2084
162 Ga0157379_10204103 3300014968 Bacteria 1788
163 Ga0182007_10032743 3300015262 Bacteria 1764
164 Ga0213872_10000982 3300021361 Bacteria 19943
165 Ga0209674_100073 3300025226 Bacteria 223689
166 Ga0209563_100061 3300025230 Bacteria 274295
167 Ga0209258_100998 3300025242 Bacteria 13040
168 Ga0209258_101471 3300025242 Bacteria 8165
169 Ga0209646_1000249 3300025246 Bacteria 54511
170 Ga0209026_1000011 3300025250 Bacteria 507291
171 Ga0209677_100120 3300025253 Bacteria 80505
172 Ga0209677_100633 3300025253 Bacteria 18825
173 Ga0209677_103461 3300025253 Bacteria 5110
174 Ga0209148_1008260 3300025254 Bacteria 2101
175 Ga0209759_1000034 3300025256 Bacteria 271209
176 Ga0209759_1000900 3300025256 Bacteria 22212
177 Ga0209759_1003968 3300025256 Bacteria 5680
178 Ga0209455_1000053 3300025272 Bacteria 365949
179 Ga0209455_1000596 3300025272 Bacteria 23241
180 Ga0207642_10082471 3300025899 Bacteria 1565
181 Ga0207685_10061579 3300025905 Bacteria 1488
182 Ga0207645_10014430 3300025907 Bacteria 5287
183 Ga0207643_10085476 3300025908 Unclassified 1832
184 Ga0207705_10028930 3300025909 Bacteria 3951
185 Ga0207705_10069863 3300025909 Bacteria 2544
186 Ga0207654_10040895 3300025911 Bacteria 2615
187 Ga0207707_10003001 3300025912 Bacteria 15006
188 Ga0207695_10005833 3300025913 Bacteria 16193
189 Ga0207671_10044286 3300025914 Bacteria 3291
190 Ga0207662_10159148 3300025918 Bacteria 1442
191 Ga0207657_10077316 3300025919 Bacteria 2805
192 Ga0207657_10142561 3300025919 Bacteria 1957
193 Ga0207649_10266023 3300025920 Unclassified 1241
194 Ga0207646_10057941 3300025922 Bacteria 3461
195 Ga0207681_10003667 3300025923 Bacteria 9545
196 Ga0207694_10008860 3300025924 Bacteria 7590
197 Ga0207650_10050852 3300025925 Bacteria 3066
198 Ga0207650_10225743 3300025925 Bacteria 1509
199 Ga0207659_10043579 3300025926 Bacteria 3152
200 Ga0207687_10060483 3300025927 Bacteria 2672
201 Ga0207687_10062324 3300025927 Bacteria 2637
202 Ga0207644_10189111 3300025931 Bacteria 1618
203 Ga0207690_10084916 3300025932 Bacteria 2220
204 Ga0207706_10004957 3300025933 Bacteria 12440
205 Ga0207706_10250996 3300025933 Bacteria 1545
206 Ga0207686_10210055 3300025934 Bacteria 1399
207 Ga0207669_10013398 3300025937 Bacteria 4069
208 Ga0207704_10004352 3300025938 Bacteria 6474
209 Ga0207704_10157444 3300025938 Bacteria 1612
210 Ga0207665_10064893 3300025939 Bacteria 2482
211 Ga0207691_10112148 3300025940 Bacteria 2424
212 Ga0207689_10011590 3300025942 Bacteria 7552
213 Ga0207689_10017327 3300025942 Bacteria 6097
214 Ga0207689_10017773 3300025942 Bacteria 6009
215 Ga0207679_10216924 3300025945 Bacteria 1608
216 Ga0207679_10336485 3300025945 Bacteria 1312
217 Ga0207667_10004262 3300025949 Bacteria 17553
218 Ga0207667_10206182 3300025949 Bacteria 2016
219 Ga0207667_10374252 3300025949 Bacteria 1451
220 Ga0207651_10114626 3300025960 Bacteria 2030
221 Ga0207651_10385625 3300025960 Bacteria 1188
222 Ga0207712_10001907 3300025961 Bacteria 13705
223 Ga0207668_10007277 3300025972 Bacteria 6571
224 Ga0207640_10004000 3300025981 Bacteria 7964
225 Ga0207640_10256509 3300025981 Bacteria 1360
226 Ga0207658_10178393 3300025986 Bacteria 1756
227 Ga0207639_10716844 3300026041 Bacteria 929
228 Ga0207678_10006113 3300026067 Bacteria 10709
229 Ga0207678_10258950 3300026067 Bacteria 1491
230 Ga0207708_10010615 3300026075 Bacteria 6839
231 Ga0207702_10006491 3300026078 Bacteria 10081
232 Ga0207641_10137768 3300026088 Bacteria 2198
233 Ga0207648_10000362 3300026089 Bacteria 50094
234 Ga0207648_10033577 3300026089 Bacteria 4525
235 Ga0207648_10171447 3300026089 Bacteria 1918
236 Ga0207648_10203747 3300026089 Bacteria 1755
237 Ga0207648_10512882 3300026089 Bacteria 1098
238 Ga0207674_10087457 3300026116 Bacteria 3110
239 Ga0207674_10225642 3300026116 Bacteria 1821
240 Ga0207675_100012092 3300026118 Bacteria 8064
241 Ga0207675_100037995 3300026118 Bacteria 4493
242 Ga0207683_10278963 3300026121 Bacteria 1527
243 Ga0207698_10195544 3300026142 Bacteria 1806
244 Ga0209968_1006989 3300027526 Bacteria 1703
245 Ga0209999_1008228 3300027543 Bacteria 1878
246 Ga0209971_1012837 3300027682 Bacteria 1985
247 Ga0209966_1000138 3300027695 Bacteria 30805
248 Ga0209966_1000929 3300027695 Bacteria 5525
249 Ga0209813_10006913 3300027866 Bacteria 2815
250 Ga0207428_10037946 3300027907 Bacteria 3919
251 Ga0268266_10013661 3300028379 Bacteria 6993
252 Ga0268265_10001605 3300028380 Bacteria 18666
253 Ga0265336_10000556 3300028666 Bacteria 21237
254 Ga0307517_10111454 3300028786 Bacteria 2079
255 Ga0307517_10132524 3300028786 Bacteria 1787
256 Ga0307515_10014894 3300028794 Bacteria 14373
257 Ga0307515_10018130 3300028794 Bacteria 12769
258 Ga0307515_10183789 3300028794 Bacteria 2029
259 Ga0307515_10184468 3300028794 Bacteria 2022
260 Ga0265324_10012293 3300029957 Bacteria 3232
261 Ga0307512_10104116 3300030522 Bacteria 1905
262 Ga0265332_10006016 3300031238 Bacteria 5547
263 Ga0265328_10034578 3300031239 Bacteria 1871
264 Ga0265320_10036589 3300031240 Bacteria 2479
265 Ga0265331_10005817 3300031250 Bacteria 7388
266 Ga0265331_10057453 3300031250 Bacteria 1845
267 Ga0265327_10000136 3300031251 Bacteria 160868
268 Ga0307513_10057211 3300031456 Bacteria 4156
269 Ga0307513_10237409 3300031456 Bacteria 1631
270 Ga0307509_10001647 3300031507 Bacteria 37422
271 Ga0307509_10029240 3300031507 Bacteria 6119
272 Ga0307509_10052681 3300031507 Bacteria 4343
273 Ga0307408_100047939 3300031548 Bacteria 3062
274 Ga0307508_10045147 3300031616 Bacteria 3938
275 Ga0316575_10031265 3300031665 Bacteria 2083
276 Ga0316575_10032811 3300031665 Bacteria 2035
277 Ga0316579_10000229 3300031691 Bacteria 16998
278 Ga0265314_10012555 3300031711 Bacteria 6902
279 Ga0316578_10003363 3300031728 Bacteria 7300
280 Ga0307516_10000155 3300031730 Bacteria 85605
281 Ga0307416_100042374 3300032002 Bacteria 3553
282 Ga0307416_100289954 3300032002 Bacteria 1620
283 Ga0307416_100838780 3300032002 Bacteria 1017
284 Ga0316583_10001141 3300032133 Bacteria 8669
285 Ga0307510_10059773 3300033180 Bacteria 3931
286 Ga0373938_0052679 3300034957 Bacteria 933
287 Ga0373934_0005550 3300035086 Bacteria 4671
288 Ga0373934_0031327 3300035086 Bacteria 2082
289 Ga0373956_0150755 3300035119 Bacteria 1094
290 Ga0373957_0005373 3300035120 Bacteria 3967
291 Ga0373960_0009027 3300035121 Bacteria 2405
292 Ga0373961_0006198 3300035241 Bacteria 2874
293 Ga0316574_0016443 3300035398 Bacteria 4312
294 Ga0373924_0024900 3300035410 Bacteria 2362
295 Ga0373931_0001491 3300035691 Bacteria 10067
296 Ga0373931_0130954 3300035691 Bacteria 1444
297 Ga0373927_0185479 3300035695 Bacteria 1365
298 Ga0373933_0002244 3300035724 Bacteria 11024
299 Ga0373937_0017644 3300036401 Bacteria 6366
300 Ga0373937_0499694 3300036401 Bacteria 1156
301 Ga0436361_0046388 3300039447 Bacteria 28554
302 Ga0451807_1808059 3300041486 Bacteria 1518
303 Ga0439444_0008325 3300042437 Bacteria 1614
304 Ga0451577_0010640 3300042876 Bacteria 8766
305 Ga0451577_0015014 3300042876 Bacteria 7206
306 Ga0451577_0022141 3300042876 Bacteria 5804
307 Ga0451577_0208854 3300042876 Bacteria 1763
308 Ga0451577_0253509 3300042876 Bacteria 1593
309 Ga0451577_0331978 3300042876 Bacteria 1379
310 Ga0466969_0020667 3300044656 Bacteria 3407
311 Ga0453683_0136090 3300044673 Bacteria 1549
312 Ga0453683_0176530 3300044673 Bacteria 1354
313 Ga0466965_0018614 3300044683 Bacteria 3331
314 Ga0466966_0000454 3300044684 Bacteria 26412
315 Ga0466961_0018142 3300044693 Bacteria 4525
316 Ga0466963_0085019 3300044694 Bacteria 2147
317 Ga0466964_0029421 3300044706 Bacteria 2168
318 Ga0453684_0000826 3300044712 Bacteria 104663
319 Ga0453684_0069662 3300044712 Bacteria 4459
320 Ga0453684_0142325 3300044712 Bacteria 2862
321 Ga0453684_0215836 3300044712 Bacteria 2226
322 Ga0466957_0004587 3300044842 Bacteria 7720
323 Ga0466957_0121140 3300044842 Bacteria 1668
324 Ga0466959_0025615 3300045049 Bacteria 4373
325 Ga0451576_0000140 3300045051 Bacteria 183279
326 Ga0451576_0016220 3300045051 Bacteria 8228
327 Ga0451576_0018773 3300045051 Bacteria 7562
328 Ga0451576_0048830 3300045051 Bacteria 4443
329 Ga0451576_0078095 3300045051 Bacteria 3445
330 Ga0451576_0148204 3300045051 Bacteria 2447
331 Ga0466958_0148593 3300045836 Bacteria 1477
332 Ga0495592_0004208 3300046454 Bacteria 10512
333 Ga0495608_0077353 3300046511 Bacteria 2166
334 Ga0495610_0040271 3300046512 Bacteria 2357
335 Ga0495620_0080500 3300046515 Bacteria 1318
336 Ga0495632_0039269 3300046519 Bacteria 2390
337 Ga0495643_0127653 3300046522 Bacteria 1279
338 Ga0495597_0003790 3300046542 Bacteria 8604
339 Ga0495667_0030705 3300046559 Bacteria 3610
340 Ga0495668_0015696 3300046616 Bacteria 4415
341 Ga0495668_0052640 3300046616 Bacteria 2252
342 Ga0495625_0058287 3300046660 Bacteria 2744
343 Ga0495671_0043748 3300046692 Bacteria 2248
344 Ga0495649_0039245 3300046694 Bacteria 2596
345 Ga0495680_0015266 3300047322 Bacteria 6629
346 Ga0495687_000890 3300047443 Bacteria 31459
347 Ga0495687_023652 3300047443 Bacteria 2931
348 Ga0495686_0188817 3300047472 Bacteria 1189
349 Ga0496126_0006677 3300048929 Bacteria 12822
350 Ga0501292_001480 3300049515 Bacteria 2896
351 Ga0501031_0009313 3300049568 Bacteria 6384
352 Ga0501031_0172378 3300049568 Bacteria 1414
353 Ga0501032_0019325 3300049569 Bacteria 4768
354 Ga0501033_0002541 3300049570 Bacteria 15450
355 Ga0501036_0001819 3300049572 Bacteria 16536
356 Ga0501036_0035700 3300049572 Bacteria 4206
357 Ga0501037_0024926 3300049573 Bacteria 4421
358 Ga0501038_0000189 3300049574 Bacteria 53371
359 Ga0501038_0241121 3300049574 Bacteria 1435
360 Ga0501039_0000247 3300049575 Bacteria 39539
361 Ga0501039_0006986 3300049575 Bacteria 8596
362 Ga0501039_0035321 3300049575 Bacteria 3857
363 Ga0501039_0091829 3300049575 Bacteria 2366
364 Ga0501040_0007182 3300049576 Bacteria 7212
365 Ga0501041_0000032 3300049577 Bacteria 44999
366 Ga0501041_0000908 3300049577 Bacteria 16021
367 Ga0501041_0100079 3300049577 Bacteria 1794
368 Ga0501042_0037862 3300049578 Bacteria 3424
369 Ga0501042_0083601 3300049578 Bacteria 2288
370 Ga0501042_0110873 3300049578 Bacteria 1976
371 Ga0501042_0142447 3300049578 Bacteria 1728
372 Ga0501042_0300661 3300049578 Bacteria 1159
373 Ga0501043_0007581 3300049579 Bacteria 8603
374 Ga0501046_0000156 3300049580 Bacteria 70512
375 Ga0501046_0097612 3300049580 Bacteria 2257
376 Ga0501046_0278989 3300049580 Bacteria 1224
377 Ga0501048_0000957 3300049582 Bacteria 21341
378 Ga0501048_0063204 3300049582 Bacteria 2619
379 Ga0501048_0366282 3300049582 Unclassified 1028
380 Ga0501068_0006605 3300049584 Bacteria 6401
381 Ga0501070_0078285 3300049586 Bacteria 2736
382 Ga0501071_0008815 3300049587 Bacteria 6684
383 Ga0501071_0224759 3300049587 Bacteria 1413
384 Ga0501072_0005510 3300049588 Bacteria 9631
385 Ga0501074_0077697 3300049590 Bacteria 2382
386 Ga0501074_0194128 3300049590 Bacteria 1447
387 Ga0501075_0000053 3300049591 Bacteria 49110
388 Ga0501075_0015270 3300049591 Bacteria 5509
389 Ga0501076_0000575 3300049592 Bacteria 23441
390 Ga0501076_0000683 3300049592 Bacteria 21818
391 Ga0501077_0000543 3300049593 Bacteria 22905
392 Ga0501077_0101299 3300049593 Bacteria 1825
393 Ga0501209_000208 3300049656 Bacteria 6868
394 Ga0501079_0000351 3300049741 Bacteria 29422
395 Ga0501079_0410710 3300049741 Bacteria 1062
396 Ga0501080_0007436 3300049742 Bacteria 9889
397 Ga0501080_0016153 3300049742 Bacteria 6891
398 Ga0501080_0149328 3300049742 Bacteria 2161
399 Ga0501080_0439915 3300049742 Bacteria 1170
400 Ga0501081_0000440 3300049743 Bacteria 22990
401 Ga0501081_0018231 3300049743 Bacteria 4660
402 Ga0501083_0028625 3300049744 Bacteria 3839
403 Ga0501083_0087071 3300049744 Bacteria 2066
404 Ga0501035_0019631 3300049822 Bacteria 6211
405 Ga0501035_0030978 3300049822 Bacteria 4871
406 Ga0501035_0040034 3300049822 Bacteria 4237
407 Ga0501044_0001590 3300049823 Bacteria 26597
408 Ga0501044_0110768 3300049823 Bacteria 2754
409 Ga0501045_0015830 3300049824 Bacteria 5349
410 Ga0501045_0043054 3300049824 Bacteria 3287
411 Ga0501045_0153021 3300049824 Bacteria 1716
412 nmdc:mga03683_22656_c1 3300050489 Bacteria 2437
413 nmdc:mga03683_95397_c1 3300050489 Bacteria 1302
414 nmdc:mga00v17_58111_c1 3300050491 Bacteria 2368
415 nmdc:mga0yw44_107646_c1 3300050492 Bacteria 1783
416 nmdc:mga0k408_12173_c1 3300050493 Bacteria 4699
417 nmdc:mga0k408_139395_c1 3300050493 Bacteria 1442
418 nmdc:mga0k408_193375_c1 3300050493 Bacteria 1214
419 nmdc:mga0k408_19633_c1 3300050493 Bacteria 3780
420 nmdc:mga0k408_31767_c1 3300050493 Bacteria 3017
421 nmdc:mga0k408_44865_c1 3300050493 Bacteria 2550
422 nmdc:mga0k408_4953_c1 3300050493 Bacteria 7058
423 nmdc:mga0k408_86725_c1 3300050493 Bacteria 1838
424 nmdc:mga06z11_9592_c1 3300050494 Bacteria 4085
425 nmdc:mga04h51_15514_c1 3300050495 Bacteria 2196
426 nmdc:mga07m45_105210_c1 3300050496 Bacteria 1623
427 nmdc:mga07m45_12903_c1 3300050496 Bacteria 4127
428 nmdc:mga07m45_1608_c1 3300050496 Bacteria 10398
429 nmdc:mga07m45_17600_c1 3300050496 Bacteria 3842
430 nmdc:mga07m45_2148_c1 3300050496 Bacteria 9185
431 nmdc:mga07m45_45347_c1 3300050496 Bacteria 2469
432 nmdc:mga07m45_45631_c1 3300050496 Bacteria 2461
433 nmdc:mga07m45_6047_c2 3300050496 Bacteria 3699
434 nmdc:mga05p37_446382_c1 3300050507 Bacteria 1498
435 nmdc:mga05p37_70588_c1 3300050507 Bacteria 4296
436 nmdc:mga09592_24649_c1 3300050508 Bacteria 4977
437 nmdc:mga09592_312740_c1 3300050508 Bacteria 1361
438 nmdc:mga0qj67_18030_c1 3300050509 Bacteria 5377
439 nmdc:mga0qj67_24181_c1 3300050509 Bacteria 4681
440 nmdc:mga06r32_216984_c1 3300050510 Bacteria 1901
441 nmdc:mga08y16_36460_c1 3300050511 Bacteria 5165
442 nmdc:mga0n895_1811_c1 3300050512 Bacteria 16267
443 nmdc:mga0n895_251761_c1 3300050512 Bacteria 1792
444 nmdc:mga0rr50_1193_c1 3300050513 Bacteria 14104
445 nmdc:mga08x19_30111_c1 3300050514 Bacteria 3408
446 nmdc:mga08x19_762_c1 3300050514 Bacteria 20508
447 nmdc:mga0a205_177025_c1 3300050515 Bacteria 2028
448 nmdc:mga0sz30_18909_c1 3300050516 Bacteria 2762
449 Ga0500635_0000029 3300053080 Bacteria 100914
450 Ga0495619_0078558 3300053085 Bacteria 2219
451 Ga0500651_0125492 3300053093 Bacteria 1555
452 Ga0500594_0028256 3300053118 Bacteria 1458
453 Ga0500658_0002762 3300053134 Bacteria 6750
454 Ga0500559_0000133 3300053136 Bacteria 56972
455 Ga0500568_0009517 3300053139 Bacteria 4607
456 Ga0500590_050792 3300053148 Bacteria 2108
457 Ga0500634_0037028 3300053161 Bacteria 2655
458 Ga0501084_0008574 3300054114 Bacteria 8454
459 Ga0501082_0021131 3300060353 Bacteria 5613
460 Ga0466962_0012247 3300061719 Bacteria 4122
461 Ga0530510_0000115 3300061734 Bacteria 45273
462 Ga0530510_0005523 3300061734 Bacteria 8757
463 2644301112 2643221654 Bacteria 5273570
464 2644338543 2643221660 Bacteria 4208257
465 8055226517 8055225921 Bacteria 3341787
466 nmdc:mga0rr50_73010_c1
467 JGI24033J26618_1013010
468 JGI25156J39149_1002577
469 JGI25154J39366_1000518
470 JGI25157J39369_1000743
471 rootH1_10052059
472 rootH1_10050641
473 rootH1_10050678
474 Ga0055539_1000140
475 Ga0055539_1001323
476 Ga0055533_1000045
477 Ga0055535_1002371
478 Ga0055529_1000148
479 Ga0055529_1010900
480 Ga0065715_10104788
481 Ga0070658_10054707
482 Ga0070658_10056054
483 Ga0070676_10010008
484 Ga0070676_10116342
485 Ga0070690_100017574
486 Ga0070690_100042630
487 Ga0070690_100244814
488 Ga0070670_100062592
489 Ga0070670_100293284
490 Ga0070670_100340841
491 Ga0068869_100013610
492 Ga0068869_100078771
493 Ga0070680_100038414
494 Ga0070680_100170046
495 Ga0070680_100384041
496 Ga0068868_100051935
497 Ga0070660_100138703
498 Ga0070660_100154391
499 Ga0070687_100046936
500 Ga0070687_100156970
501 Ga0070661_100295412
502 Ga0070692_10003525
503 Ga0070692_10165049
504 Ga0070668_100087502
505 Ga0070669_100003316
506 Ga0070675_100246700
507 Ga0070671_100189176
508 Ga0070671_100201286
509 Ga0070674_100138998
510 Ga0070673_100008834
511 Ga0070673_100011910
512 Ga0070673_100192493
513 Ga0070659_100093718
514 Ga0070667_100207387
515 Ga0070667_100633377
516 Ga0070710_10051880
517 Ga0070705_100033683
518 Ga0070700_100001929
519 Ga0070694_100007385
520 Ga0070694_100075703
521 Ga0070708_100471397
522 Ga0070663_100053189
523 Ga0070663_100230235
524 Ga0070678_100318739
525 Ga0070662_100144968
526 Ga0070662_100222787
527 Ga0070681_10000135
528 Ga0068867_100000606
529 Ga0068867_100021775
530 Ga0068867_100023367
531 Ga0068867_100155788
532 Ga0068867_100487160
533 Ga0068867_100488044
534 Ga0070706_100003188
535 Ga0070707_100037315
536 Ga0070707_100579144
537 Ga0070698_100036226
538 Ga0070699_100214835
539 Ga0070699_100308891
540 Ga0070679_100046897
541 Ga0070697_100017635
542 Ga0068853_100249322
543 Ga0070686_100265549
544 Ga0070686_100297439
545 Ga0070695_100003127
546 Ga0070696_100001158
547 Ga0070696_100043993
548 Ga0070665_100035834
549 Ga0070704_100009462
550 Ga0070704_100096596
551 Ga0068855_100012349
552 Ga0068855_100161223
553 Ga0070664_100189498
554 Ga0070664_100382923
555 Ga0068857_100003374
556 Ga0068857_100253283
557 Ga0068854_100008220
558 Ga0068854_100222791
559 Ga0068856_100002437
560 Ga0068852_100113529
561 Ga0068852_100279551
562 Ga0068859_100024148
563 Ga0068859_100067147
564 Ga0068864_100007242
565 Ga0068861_100000492
566 Ga0068861_100008163
567 Ga0068870_10024562
568 Ga0068863_100027398
569 Ga0068862_100002979
570 Ga0075365_10173538
571 Ga0075368_10001585
572 Ga0075368_10017530
573 Ga0075364_10187728
574 Ga0070716_100066925
575 Ga0075362_10004323
576 Ga0075362_10032216
577 Ga0075367_10009705
578 Ga0075367_10016595
579 Ga0075367_10019903
580 Ga0075369_10022846
581 Ga0075366_10046772
582 Ga0075366_10055015
583 Ga0075366_10096726
584 Ga0075366_10121013
585 Ga0075366_10203571
586 Ga0097621_100029903
587 Ga0097621_100188659
588 Ga0097621_100213016
589 Ga0075370_10002430
590 Ga0075370_10011130
591 Ga0075370_10011503
592 Ga0075370_10017563
593 Ga0075370_10018414
594 Ga0068871_100001506
595 Ga0075428_100051859
596 Ga0075431_100040353
597 Ga0075431_100132842
598 Ga0075431_100263023
599 Ga0075433_10333671
600 Ga0075434_100000002
601 Ga0068865_100007318
602 Ga0075436_100034169
603 Ga0097620_100024148
604 Ga0097620_100067148
605 Ga0075435_100004018
606 Ga0105240_10047132
607 Ga0105240_10202928
608 Ga0111539_10184208
609 Ga0105245_10106875
610 Ga0105245_10205234
611 Ga0105245_10212568
612 Ga0105247_10080685
613 Ga0114129_10156352
614 Ga0114129_10902887
615 Ga0105241_10064719
616 Ga0105242_10028991
617 Ga0105242_10342569
618 Ga0105237_10157941
619 Ga0105239_10357438
620 Ga0157369_10054876
621 Ga0163162_10137495
622 Ga0157375_10046040
623 Ga0157375_10081044
624 Ga0157380_10230891
625 Ga0157377_10277655
626 Ga0157379_10152584
627 Ga0157379_10204103
628 Ga0182007_10032743
629 Ga0213872_10000982
630 Ga0209674_100073
631 Ga0209563_100061
632 Ga0209258_100998
633 Ga0209258_101471
634 Ga0209646_1000249
635 Ga0209026_1000011
636 Ga0209677_100120
637 Ga0209677_100633
638 Ga0209677_103461
639 Ga0209148_1008260
640 Ga0209759_1000034
641 Ga0209759_1000900
642 Ga0209759_1003968
643 Ga0209455_1000053
644 Ga0209455_1000596
645 Ga0207642_10082471
646 Ga0207685_10061579
647 Ga0207645_10014430
648 Ga0207643_10085476
649 Ga0207705_10028930
650 Ga0207705_10069863
651 Ga0207654_10040895
652 Ga0207707_10003001
653 Ga0207695_10005833
654 Ga0207671_10044286
655 Ga0207662_10159148
656 Ga0207657_10077316
657 Ga0207657_10142561
658 Ga0207649_10266023
659 Ga0207646_10057941
660 Ga0207681_10003667
661 Ga0207694_10008860
662 Ga0207650_10050852
663 Ga0207650_10225743
664 Ga0207659_10043579
665 Ga0207687_10060483
666 Ga0207687_10062324
667 Ga0207644_10189111
668 Ga0207690_10084916
669 Ga0207706_10004957
670 Ga0207706_10250996
671 Ga0207686_10210055
672 Ga0207669_10013398
673 Ga0207704_10004352
674 Ga0207704_10157444
675 Ga0207665_10064893
676 Ga0207691_10112148
677 Ga0207689_10011590
678 Ga0207689_10017327
679 Ga0207689_10017773
680 Ga0207679_10216924
681 Ga0207679_10336485
682 Ga0207667_10004262
683 Ga0207667_10206182
684 Ga0207667_10374252
685 Ga0207651_10114626
686 Ga0207651_10385625
687 Ga0207712_10001907
688 Ga0207668_10007277
689 Ga0207640_10004000
690 Ga0207640_10256509
691 Ga0207658_10178393
692 Ga0207639_10716844
693 Ga0207678_10006113
694 Ga0207678_10258950
695 Ga0207708_10010615
696 Ga0207702_10006491
697 Ga0207641_10137768
698 Ga0207648_10000362
699 Ga0207648_10033577
700 Ga0207648_10171447
701 Ga0207648_10203747
702 Ga0207648_10512882
703 Ga0207674_10087457
704 Ga0207674_10225642
705 Ga0207675_100012092
706 Ga0207675_100037995
707 Ga0207683_10278963
708 Ga0207698_10195544
709 Ga0209968_1006989
710 Ga0209999_1008228
711 Ga0209971_1012837
712 Ga0209966_1000138
713 Ga0209966_1000929
714 Ga0209813_10006913
715 Ga0207428_10037946
716 Ga0268266_10013661
717 Ga0268265_10001605
718 Ga0265336_10000556
719 Ga0307517_10111454
720 Ga0307517_10132524
721 Ga0307515_10014894
722 Ga0307515_10018130
723 Ga0307515_10183789
724 Ga0307515_10184468
725 Ga0265324_10012293
726 Ga0307512_10104116
727 Ga0265332_10006016
728 Ga0265328_10034578
729 Ga0265320_10036589
730 Ga0265331_10005817
731 Ga0265331_10057453
732 Ga0265327_10000136
733 Ga0307513_10057211
734 Ga0307513_10237409
735 Ga0307509_10001647
736 Ga0307509_10029240
737 Ga0307509_10052681
738 Ga0307408_100047939
739 Ga0307508_10045147
740 Ga0316575_10031265
741 Ga0316575_10032811
742 Ga0316579_10000229
743 Ga0265314_10012555
744 Ga0316578_10003363
745 Ga0307516_10000155
746 Ga0307416_100042374
747 Ga0307416_100289954
748 Ga0307416_100838780
749 Ga0316583_10001141
750 Ga0307510_10059773
751 Ga0373938_0052679
752 Ga0373934_0005550
753 Ga0373934_0031327
754 Ga0373956_0150755
755 Ga0373957_0005373
756 Ga0373960_0009027
757 Ga0373961_0006198
758 Ga0316574_0016443
759 Ga0373924_0024900
760 Ga0373931_0001491
761 Ga0373931_0130954
762 Ga0373927_0185479
763 Ga0373933_0002244
764 Ga0373937_0017644
765 Ga0373937_0499694
766 Ga0436361_0046388
767 Ga0451807_1808059
768 Ga0439444_0008325
769 Ga0451577_0010640
770 Ga0451577_0015014
771 Ga0451577_0022141
772 Ga0451577_0208854
773 Ga0451577_0253509
774 Ga0451577_0331978
775 Ga0466969_0020667
776 Ga0453683_0136090
777 Ga0453683_0176530
778 Ga0466965_0018614
779 Ga0466966_0000454
780 Ga0466961_0018142
781 Ga0466963_0085019
782 Ga0466964_0029421
783 Ga0453684_0000826
784 Ga0453684_0069662
785 Ga0453684_0142325
786 Ga0453684_0215836
787 Ga0466957_0004587
788 Ga0466957_0121140
789 Ga0466959_0025615
790 Ga0451576_0000140
791 Ga0451576_0016220
792 Ga0451576_0018773
793 Ga0451576_0048830
794 Ga0451576_0078095
795 Ga0451576_0148204
796 Ga0466958_0148593
797 Ga0495592_0004208
798 Ga0495608_0077353
799 Ga0495610_0040271
800 Ga0495620_0080500
801 Ga0495632_0039269
802 Ga0495643_0127653
803 Ga0495597_0003790
804 Ga0495667_0030705
805 Ga0495668_0015696
806 Ga0495668_0052640
807 Ga0495625_0058287
808 Ga0495671_0043748
809 Ga0495649_0039245
810 Ga0495680_0015266
811 Ga0495687_000890
812 Ga0495687_023652
813 Ga0495686_0188817
814 Ga0496126_0006677
815 Ga0501292_001480
816 Ga0501031_0009313
817 Ga0501031_0172378
818 Ga0501032_0019325
819 Ga0501033_0002541
820 Ga0501036_0001819
821 Ga0501036_0035700
822 Ga0501037_0024926
823 Ga0501038_0000189
824 Ga0501038_0241121
825 Ga0501039_0000247
826 Ga0501039_0006986
827 Ga0501039_0035321
828 Ga0501039_0091829
829 Ga0501040_0007182
830 Ga0501041_0000032
831 Ga0501041_0000908
832 Ga0501041_0100079
833 Ga0501042_0037862
834 Ga0501042_0083601
835 Ga0501042_0110873
836 Ga0501042_0142447
837 Ga0501042_0300661
838 Ga0501043_0007581
839 Ga0501046_0000156
840 Ga0501046_0097612
841 Ga0501046_0278989
842 Ga0501048_0000957
843 Ga0501048_0063204
844 Ga0501048_0366282
845 Ga0501068_0006605
846 Ga0501070_0078285
847 Ga0501071_0008815
848 Ga0501071_0224759
849 Ga0501072_0005510
850 Ga0501074_0077697
851 Ga0501074_0194128
852 Ga0501075_0000053
853 Ga0501075_0015270
854 Ga0501076_0000575
855 Ga0501076_0000683
856 Ga0501077_0000543
857 Ga0501077_0101299
858 Ga0501209_000208
859 Ga0501079_0000351
860 Ga0501079_0410710
861 Ga0501080_0007436
862 Ga0501080_0016153
863 Ga0501080_0149328
864 Ga0501080_0439915
865 Ga0501081_0000440
866 Ga0501081_0018231
867 Ga0501083_0028625
868 Ga0501083_0087071
869 Ga0501035_0019631
870 Ga0501035_0030978
871 Ga0501035_0040034
872 Ga0501044_0001590
873 Ga0501044_0110768
874 Ga0501045_0015830
875 Ga0501045_0043054
876 Ga0501045_0153021
877 nmdc:mga03683_22656_c1
878 nmdc:mga03683_95397_c1
879 nmdc:mga00v17_58111_c1
880 nmdc:mga0yw44_107646_c1
881 nmdc:mga0k408_12173_c1
882 nmdc:mga0k408_139395_c1
883 nmdc:mga0k408_193375_c1
884 nmdc:mga0k408_19633_c1
885 nmdc:mga0k408_31767_c1
886 nmdc:mga0k408_44865_c1
887 nmdc:mga0k408_4953_c1
888 nmdc:mga0k408_86725_c1
889 nmdc:mga06z11_9592_c1
890 nmdc:mga04h51_15514_c1
891 nmdc:mga07m45_105210_c1
892 nmdc:mga07m45_12903_c1
893 nmdc:mga07m45_1608_c1
894 nmdc:mga07m45_17600_c1
895 nmdc:mga07m45_2148_c1
896 nmdc:mga07m45_45347_c1
897 nmdc:mga07m45_45631_c1
898 nmdc:mga07m45_6047_c2
899 nmdc:mga05p37_446382_c1
900 nmdc:mga05p37_70588_c1
901 nmdc:mga09592_24649_c1
902 nmdc:mga09592_312740_c1
903 nmdc:mga0qj67_18030_c1
904 nmdc:mga0qj67_24181_c1
905 nmdc:mga06r32_216984_c1
906 nmdc:mga08y16_36460_c1
907 nmdc:mga0n895_1811_c1
908 nmdc:mga0n895_251761_c1
909 nmdc:mga0rr50_1193_c1
910 nmdc:mga08x19_30111_c1
911 nmdc:mga08x19_762_c1
912 nmdc:mga0a205_177025_c1
913 nmdc:mga0sz30_18909_c1
914 Ga0500635_0000029
915 Ga0495619_0078558
916 Ga0500651_0125492
917 Ga0500594_0028256
918 Ga0500658_0002762
919 Ga0500559_0000133
920 Ga0500568_0009517
921 Ga0500590_050792
922 Ga0500634_0037028
923 Ga0501084_0008574
924 Ga0501082_0021131
925 Ga0466962_0012247
926 Ga0530510_0000115
927 Ga0530510_0005523
928 2644301112
929 2644338543
930 8055226517

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03279

Lip_A_acyltrans

Bacterial lipid A biosynthesis acyltransferase

14

291

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5knk-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii with catalytic residue substitution (e127a) 0.8142 9 279
5kn7-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii 0.7919 4 279
5f34-assembly1.cif.gz_A crystal structure of membrane associated pata from mycobacterium smegmatis in complex with s-hexadecyl coenzyme a - p21 space group 0.7912 32 270
5knk-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii with catalytic residue substitution (e127a) 0.7787 9 279
5kn7-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii 0.7707 4 279
ID Description Score Start End Superfamily
af_Q54I12_580_724_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.5679 86 211 3.40.50.620
1k30A02 Alpha Beta;3-Layer(aba) Sandwich;Glycerol-3-phosphate (1)-acyltransferase;Glycerol-3-phosphate (1)-acyltransferase 0.5678 84 267 3.40.1130.10
af_P31119_15_138_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.558 93 218 3.40.1010.10
af_Q22949_143_292_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.5569 88 187 3.40.50.620
af_Q4E308_598_739_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.5562 89 209 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A6L6Q2B0-F1-model_v4 Lysophospholipid acyltransferase family protein 0.9722 2 281 GO:0005886
GO:0009247
GO:0016746
AF-A0A1A7BUK6-F1-model_v4 KDO2-lipid IV(A) lauroyltransferase (EC 2.3.1.241) 0.9688 2 280 GO:0005886
GO:0008913
GO:0009247
AF-A0A127QBT5-F1-model_v4 Bacterial lipid A biosynthesis acyltransferase family protein 0.9679 2 280 GO:0005886
GO:0009247
GO:0016746
AF-A0A7W9X0E5-F1-model_v4 KDO2-lipid IV(A) lauroyltransferase (EC 2.3.1.241) 0.9677 15 280 GO:0005886
GO:0008913
GO:0009247
AF-A0A2G8T8C4-F1-model_v4 Lipid A biosynthesis acyltransferase 0.965 2 280 GO:0005886
GO:0009247
GO:0016746

Map