F449635

General Info

Members Datasets Scaffolds Average Seq Length
466 260 932 211

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100000779|Ga0068863_10000077926
Length 244
Sequence VFWEVPSGALLTRGPRGATRCRMPQAKLSYSGAVRVKICGITNLDDAAEAVLLGAWAIGLIHYDRSPRAVEAGEAAAICAAFRRKCEVVGVFVNPELEEVAKAVEGAGLTMVQLNGAEGPQFCAEVARRTGVKVIKAIHVASAAEVHGAEAYRTDFHLFDRRGKGLWGGTGQSFDWGLLREHRSEVPAIVAGGLRPDNVAEAIAVTHPFAVDVASGVEAEPGRKDHAAMGAFFEAAGVTSVPAP

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
111 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
112 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
113 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
114 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
117 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
123 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
127 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
128 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
136 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
137 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
138 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
146 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
154 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
155 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
156 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
176 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
177 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
196 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
197 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
202 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
207 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
208 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
230 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
231 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
232 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
233 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
248 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
249 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
254 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
255 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
258 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
259 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0.64
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.72
Nodule 0
Rhizoplane 11.8
Rhizosphere 83.91
Stem 0
Stem Tuber 0
Unclassified 2.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_100000779 3300005841 Bacteria 32033
2 JGI24746J21847_1001636 3300001977 Bacteria 3586
3 JGI24740J21852_10000878 3300001979 Bacteria 13286
4 JGI24034J26672_10001534 3300002239 Bacteria 3068
5 JGI24742J22300_10012430 3300002244 Bacteria 1419
6 Ga0070683_100015946 3300005329 Bacteria 6610
7 Ga0070683_100023609 3300005329 Bacteria 5502
8 Ga0070670_100388559 3300005331 Bacteria 1230
9 Ga0070677_10000082 3300005333 Bacteria 30305
10 Ga0070682_100000030 3300005337 Bacteria 182768
11 Ga0070682_100509660 3300005337 Archaea 934
12 Ga0068868_100000033 3300005338 Bacteria 75402
13 Ga0070660_100533468 3300005339 Bacteria 978
14 Ga0070661_100000121 3300005344 Bacteria 65344
15 Ga0070668_100001145 3300005347 Bacteria 18672
16 Ga0070668_100260494 3300005347 Bacteria 1442
17 Ga0070674_100000002 3300005356 Bacteria 271088
18 Ga0070674_100000009 3300005356 Bacteria 143336
19 Ga0070673_100181306 3300005364 Bacteria 1803
20 Ga0070688_100030251 3300005365 Bacteria 3248
21 Ga0070659_100063824 3300005366 Bacteria 2914
22 Ga0070667_100007315 3300005367 Bacteria 9177
23 Ga0070711_100001969 3300005439 Bacteria 11529
24 Ga0070663_100199758 3300005455 Bacteria 1560
25 Ga0070663_100509916 3300005455 Unclassified 1000
26 Ga0070678_100010487 3300005456 Bacteria 5666
27 Ga0070662_100000002 3300005457 Bacteria 253208
28 Ga0070662_100000448 3300005457 Bacteria 24327
29 Ga0070685_10000053 3300005466 Bacteria 70868
30 Ga0070685_10001013 3300005466 Bacteria 15114
31 Ga0070685_10008855 3300005466 Bacteria 5189
32 Ga0070679_100193299 3300005530 Bacteria 2003
33 Ga0070684_100011055 3300005535 Bacteria 7180
34 Ga0070684_100091484 3300005535 Bacteria 2706
35 Ga0070684_100133010 3300005535 Bacteria 2245
36 Ga0070684_100640632 3300005535 Bacteria 989
37 Ga0068853_100016611 3300005539 Bacteria 6060
38 Ga0068853_100080887 3300005539 Bacteria 2844
39 Ga0068853_100227075 3300005539 Bacteria 1707
40 Ga0070672_100000112 3300005543 Bacteria 41002
41 Ga0070686_100000026 3300005544 Bacteria 126656
42 Ga0070686_100178001 3300005544 Bacteria 1509
43 Ga0070665_100062981 3300005548 Bacteria 3719
44 Ga0070665_100574069 3300005548 Bacteria 1141
45 Ga0070664_100011461 3300005564 Bacteria 7195
46 Ga0070664_100015617 3300005564 Bacteria 6214
47 Ga0068857_100132941 3300005577 Bacteria 2245
48 Ga0068854_100000333 3300005578 Bacteria 30901
49 Ga0068854_100006276 3300005578 Bacteria 7556
50 Ga0068856_100218348 3300005614 Bacteria 1922
51 Ga0068856_100580882 3300005614 Bacteria 1142
52 Ga0070702_100391366 3300005615 Bacteria 991
53 Ga0068852_100000002 3300005616 Bacteria 268221
54 Ga0068864_100000015 3300005618 Bacteria 303368
55 Ga0068866_10000003 3300005718 Bacteria 281675
56 Ga0068866_10001449 3300005718 Bacteria 10144
57 Ga0068866_10042954 3300005718 Bacteria 2253
58 Ga0068851_10006786 3300005834 Bacteria 5240
59 Ga0068863_100026859 3300005841 Bacteria 5491
60 Ga0068863_100043624 3300005841 Bacteria 4257
61 Ga0068858_100464322 3300005842 Bacteria 1221
62 Ga0068860_100613870 3300005843 Bacteria 1094
63 Ga0068862_100000747 3300005844 Bacteria 32578
64 Ga0081455_10213895 3300005937 Bacteria 1434
65 Ga0081538_10055558 3300005981 Bacteria 2329
66 Ga0081540_1000123 3300005983 Bacteria 81914
67 Ga0081539_10001566 3300005985 Bacteria 37942
68 Ga0070715_10000001 3300006163 Bacteria 693690
69 Ga0097621_100205313 3300006237 Bacteria 1712
70 Ga0068871_100056518 3300006358 Bacteria 3190
71 Ga0075433_10001805 3300006852 Bacteria 16060
72 Ga0105251_10095909 3300009011 Bacteria 1359
73 Ga0105245_10000201 3300009098 Bacteria 57152
74 Ga0105245_10001198 3300009098 Bacteria 23459
75 Ga0105245_10007008 3300009098 Bacteria 9888
76 Ga0105247_10000206 3300009101 Bacteria 57601
77 Ga0105247_10174953 3300009101 Bacteria 1429
78 Ga0105243_10003464 3300009148 Bacteria 12741
79 Ga0105243_10335100 3300009148 Bacteria 1384
80 Ga0105242_10000062 3300009176 Bacteria 74936
81 Ga0105242_10000595 3300009176 Bacteria 28423
82 Ga0105242_10095993 3300009176 Bacteria 2503
83 Ga0105242_10104426 3300009176 Bacteria 2405
84 Ga0105238_10000003 3300009551 Bacteria 422077
85 Ga0105238_10000009 3300009551 Bacteria 288729
86 Ga0105249_10013668 3300009553 Bacteria 7168
87 Ga0105249_10790744 3300009553 Bacteria 1012
88 Ga0105239_10390620 3300010375 Bacteria 1574
89 Ga0157371_10006328 3300013102 Bacteria 9796
90 Ga0157370_10104152 3300013104 Bacteria 2656
91 Ga0157370_10155227 3300013104 Bacteria 2129
92 Ga0157369_10000014 3300013105 Bacteria 266411
93 Ga0157374_10022241 3300013296 Bacteria 5655
94 Ga0157374_10041105 3300013296 Bacteria 4259
95 Ga0157378_10278659 3300013297 Bacteria 1611
96 Ga0157372_10000210 3300013307 Bacteria 65290
97 Ga0157372_10425336 3300013307 Bacteria 1548
98 Ga0157375_10000584 3300013308 Bacteria 32509
99 Ga0157375_10000809 3300013308 Bacteria 27418
100 Ga0157375_10558987 3300013308 Bacteria 1305
101 Ga0163163_10370475 3300014325 Bacteria 1489
102 Ga0163163_10636211 3300014325 Unclassified 1130
103 Ga0163163_10736863 3300014325 Bacteria 1049
104 Ga0157380_10000376 3300014326 Bacteria 26882
105 Ga0157380_10241363 3300014326 Bacteria 1629
106 Ga0157379_10777497 3300014968 Unclassified 903
107 Ga0157376_10351564 3300014969 Bacteria 1411
108 Ga0163161_10000022 3300017792 Bacteria 207890
109 Ga0207656_10001461 3300025321 Bacteria 7829
110 Ga0207653_10091110 3300025885 Bacteria 1068
111 Ga0207682_10000018 3300025893 Bacteria 66215
112 Ga0207642_10000002 3300025899 Bacteria 658166
113 Ga0207642_10000353 3300025899 Bacteria 13789
114 Ga0207642_10145670 3300025899 Bacteria 1254
115 Ga0207710_10002663 3300025900 Bacteria 8226
116 Ga0207685_10000005 3300025905 Bacteria 289944
117 Ga0207663_10005529 3300025916 Bacteria 6373
118 Ga0207649_10000003 3300025920 Bacteria 388908
119 Ga0207652_10004713 3300025921 Bacteria 11056
120 Ga0207694_10000004 3300025924 Bacteria 967075
121 Ga0207694_10000077 3300025924 Bacteria 112188
122 Ga0207650_10452809 3300025925 Bacteria 1068
123 Ga0207687_10000020 3300025927 Bacteria 228407
124 Ga0207687_10000484 3300025927 Bacteria 26903
125 Ga0207687_10000851 3300025927 Bacteria 20636
126 Ga0207700_10000003 3300025928 Bacteria 500797
127 Ga0207664_10021209 3300025929 Bacteria 4826
128 Ga0207690_10002915 3300025932 Bacteria 10309
129 Ga0207706_10000001 3300025933 Bacteria 423014
130 Ga0207706_10000259 3300025933 Bacteria 57912
131 Ga0207686_10000231 3300025934 Bacteria 42432
132 Ga0207686_10000426 3300025934 Bacteria 28776
133 Ga0207686_10065470 3300025934 Bacteria 2318
134 Ga0207709_10009509 3300025935 Bacteria 5348
135 Ga0207669_10000001 3300025937 Bacteria 377747
136 Ga0207669_10000003 3300025937 Bacteria 252239
137 Ga0207704_10193499 3300025938 Bacteria 1481
138 Ga0207691_10000002 3300025940 Bacteria 189785
139 Ga0207661_10010612 3300025944 Bacteria 6638
140 Ga0207661_10015092 3300025944 Bacteria 5676
141 Ga0207679_10002319 3300025945 Bacteria 11707
142 Ga0207679_10024717 3300025945 Bacteria 4122
143 Ga0207651_10004579 3300025960 Bacteria 7000
144 Ga0207712_10000019 3300025961 Bacteria 317060
145 Ga0207712_10006981 3300025961 Bacteria 7121
146 Ga0207668_10001356 3300025972 Bacteria 14490
147 Ga0207668_10079580 3300025972 Bacteria 2371
148 Ga0207640_10000110 3300025981 Bacteria 61907
149 Ga0207640_10006888 3300025981 Bacteria 6250
150 Ga0207658_10002445 3300025986 Bacteria 13591
151 Ga0207677_10000343 3300026023 Bacteria 33031
152 Ga0207677_10001134 3300026023 Bacteria 14537
153 Ga0207703_10083001 3300026035 Bacteria 2676
154 Ga0207639_10037676 3300026041 Bacteria 3592
155 Ga0207639_10159956 3300026041 Bacteria 1897
156 Ga0207708_10228676 3300026075 Bacteria 1493
157 Ga0207702_10007849 3300026078 Bacteria 9052
158 Ga0207702_10079020 3300026078 Bacteria 2850
159 Ga0207702_10330965 3300026078 Bacteria 1453
160 Ga0207641_10002588 3300026088 Bacteria 16628
161 Ga0207641_10121250 3300026088 Bacteria 2334
162 Ga0207676_10000018 3300026095 Bacteria 306375
163 Ga0207683_10015536 3300026121 Bacteria 6482
164 Ga0207698_10000004 3300026142 Bacteria 313614
165 Ga0268266_10077960 3300028379 Bacteria 2882
166 Ga0268266_10674039 3300028379 Bacteria 996
167 Ga0268265_10005097 3300028380 Bacteria 9009
168 Ga0268264_10000969 3300028381 Bacteria 29417
169 Ga0268264_10088341 3300028381 Bacteria 2667
170 Ga0268264_10209292 3300028381 Bacteria 1789
171 Ga0265337_1000955 3300028556 Bacteria 15128
172 Ga0265326_10000041 3300028558 Bacteria 83872
173 Ga0265326_10058107 3300028558 Bacteria 1094
174 Ga0265319_1000014 3300028563 Bacteria 177623
175 Ga0265322_10000004 3300028654 Bacteria 275155
176 Ga0265322_10108706 3300028654 Archaea 789
177 Ga0265336_10005432 3300028666 Bacteria 4697
178 Ga0265336_10010927 3300028666 Bacteria 3097
179 Ga0265338_10000185 3300028800 Bacteria 116333
180 Ga0265324_10000266 3300029957 Bacteria 38549
181 Ga0265324_10070782 3300029957 Bacteria 1188
182 Ga0265320_10000029 3300031240 Bacteria 159627
183 Ga0265325_10046561 3300031241 Bacteria 2249
184 Ga0265339_10050660 3300031249 Bacteria 2270
185 Ga0265331_10086030 3300031250 Bacteria 1456
186 Ga0265327_10000015 3300031251 Bacteria 496677
187 Ga0316575_10000465 3300031665 Bacteria 11619
188 Ga0316579_10003259 3300031691 Bacteria 6296
189 Ga0265314_10000119 3300031711 Bacteria 122334
190 Ga0265342_10107643 3300031712 Bacteria 1581
191 Ga0316576_10000087 3300031727 Bacteria 32443
192 Ga0316578_10001892 3300031728 Bacteria 8842
193 Ga0316578_10226880 3300031728 Bacteria 1122
194 Ga0316577_10003838 3300031733 Bacteria 7658
195 Ga0307413_10270643 3300031824 Bacteria 1272
196 Ga0307406_10551906 3300031901 Bacteria 943
197 Ga0307412_10042158 3300031911 Bacteria 2963
198 Ga0307409_100130266 3300031995 Bacteria 2148
199 Ga0307416_100821552 3300032002 Bacteria 1026
200 Ga0307416_101149297 3300032002 Unclassified 882
201 Ga0307415_100000870 3300032126 Bacteria 13803
202 Ga0316583_10094405 3300032133 Bacteria 1043
203 Ga0316585_10001029 3300032137 Bacteria 7216
204 Ga0316580_10000107 3300032139 Bacteria 15287
205 Ga0316593_10000394 3300032168 Bacteria 7810
206 Ga0316587_1035698 3300033529 Bacteria 889
207 Ga0316596_1000411 3300033541 Bacteria 7126
208 Ga0373923_0130240 3300035111 Bacteria 1130
209 Ga0316574_0005091 3300035398 Bacteria 6983
210 Ga0373933_0607698 3300035724 Unclassified 718
211 Ga0373937_0027522 3300036401 Bacteria 5141
212 Ga0373937_0290440 3300036401 Bacteria 1545
213 Ga0373937_0373905 3300036401 Bacteria 1351
214 Ga0316582_0004765 3300036647 Bacteria 6911
215 Ga0316584_0019141 3300036712 Bacteria 4946
216 Ga0395899_0009678 3300037312 Bacteria 7397
217 Ga0395899_0068219 3300037312 Bacteria 2608
218 Ga0395900_0112368 3300037418 Bacteria 2797
219 Ga0395898_0003507 3300037466 Bacteria 17499
220 Ga0395905_0099276 3300037471 Bacteria 2734
221 Ga0395905_0115596 3300037471 Bacteria 2521
222 Ga0395901_0013568 3300038443 Bacteria 8287
223 Ga0395901_0024125 3300038443 Bacteria 6239
224 Ga0436360_0961099 3300039438 Bacteria 876
225 Ga0451800_1144989 3300041459 Bacteria 1050
226 Ga0451807_2015988 3300041486 Bacteria 1473
227 Ga0451807_2557324 3300041486 Bacteria 1069
228 Ga0451833_0382037 3300041491 Bacteria 2273
229 Ga0466969_0150181 3300044656 Bacteria 1074
230 Ga0466965_0335144 3300044683 Bacteria 826
231 Ga0466966_0083081 3300044684 Unclassified 1993
232 Ga0466961_0046177 3300044693 Bacteria 2786
233 Ga0466961_0118660 3300044693 Unclassified 1662
234 Ga0466963_0000127 3300044694 Bacteria 28865
235 Ga0466963_0057809 3300044694 Bacteria 2584
236 Ga0466957_0003429 3300044842 Bacteria 8705
237 Ga0466957_0113475 3300044842 Bacteria 1721
238 Ga0466959_0444900 3300045049 Bacteria 879
239 Ga0466958_0021104 3300045836 Bacteria 3802
240 Ga0466958_0068710 3300045836 Bacteria 2166
241 Ga0466958_0078670 3300045836 Unclassified 2027
242 Ga0466967_0000006 3300045976 Bacteria 144065
243 Ga0466967_0110030 3300045976 Bacteria 2530
244 Ga0495592_0005546 3300046454 Bacteria 9332
245 Ga0495592_0125425 3300046454 Bacteria 1802
246 Ga0495603_0000033 3300046455 Bacteria 57940
247 Ga0495603_0001486 3300046455 Bacteria 13638
248 Ga0495603_0088382 3300046455 Bacteria 1813
249 Ga0495629_0003072 3300046459 Bacteria 12684
250 Ga0495629_0041194 3300046459 Bacteria 3250
251 Ga0495629_0095306 3300046459 Bacteria 2076
252 Ga0495629_0143000 3300046459 Bacteria 1664
253 Ga0495629_0409881 3300046459 Bacteria 920
254 Ga0495641_0000014 3300046461 Bacteria 140908
255 Ga0495641_0176552 3300046461 Bacteria 956
256 Ga0495651_0054708 3300046462 Bacteria 3068
257 Ga0495651_0127312 3300046462 Bacteria 1864
258 Ga0495651_0171606 3300046462 Bacteria 1544
259 Ga0495653_0039868 3300046463 Bacteria 3676
260 Ga0495653_0069035 3300046463 Bacteria 2649
261 Ga0495653_0183381 3300046463 Bacteria 1434
262 Ga0495582_0000009 3300046473 Bacteria 123633
263 Ga0495662_0000698 3300046476 Bacteria 15931
264 Ga0495662_0018648 3300046476 Bacteria 3358
265 Ga0495662_0104392 3300046476 Bacteria 1387
266 Ga0495594_0000006 3300046499 Bacteria 167901
267 Ga0495606_0000463 3300046507 Bacteria 66752
268 Ga0495608_0000035 3300046511 Bacteria 133011
269 Ga0495608_0003187 3300046511 Bacteria 11744
270 Ga0495608_0115478 3300046511 Bacteria 1723
271 Ga0495608_0125113 3300046511 Bacteria 1647
272 Ga0495608_0412770 3300046511 Bacteria 825
273 Ga0495618_0000070 3300046514 Bacteria 72312
274 Ga0495618_0129331 3300046514 Bacteria 1616
275 Ga0495620_0002920 3300046515 Bacteria 9818
276 Ga0495628_0001620 3300046516 Bacteria 20621
277 Ga0495628_0059689 3300046516 Bacteria 2994
278 Ga0495628_0327391 3300046516 Bacteria 1130
279 Ga0495630_0000362 3300046517 Bacteria 35952
280 Ga0495630_0069317 3300046517 Bacteria 2653
281 Ga0495630_0131936 3300046517 Bacteria 1897
282 Ga0495630_0255355 3300046517 Bacteria 1339
283 Ga0495643_0000692 3300046522 Bacteria 38937
284 Ga0495652_0000010 3300046529 Bacteria 261584
285 Ga0495652_0103187 3300046529 Bacteria 2309
286 Ga0495652_0376965 3300046529 Bacteria 1010
287 Ga0495640_0098475 3300046533 Bacteria 1922
288 Ga0495640_0100282 3300046533 Bacteria 1902
289 Ga0495586_0439969 3300046535 Unclassified 751
290 Ga0495586_0483345 3300046535 Unclassified 714
291 Ga0495587_0001789 3300046536 Bacteria 14353
292 Ga0495587_0085772 3300046536 Bacteria 1823
293 Ga0495587_0097278 3300046536 Bacteria 1697
294 Ga0495587_0303004 3300046536 Bacteria 893
295 Ga0495621_0004240 3300046539 Bacteria 4011
296 Ga0495645_0010315 3300046543 Bacteria 6549
297 Ga0495645_0337540 3300046543 Bacteria 974
298 Ga0495622_0000132 3300046557 Bacteria 63863
299 Ga0495667_0000258 3300046559 Bacteria 34340
300 Ga0495667_0229977 3300046559 Bacteria 1182
301 Ga0495667_0365247 3300046559 Bacteria 911
302 Ga0495656_0001129 3300046615 Bacteria 8678
303 Ga0495668_0047700 3300046616 Bacteria 2378
304 Ga0495634_0000216 3300046642 Bacteria 53765
305 Ga0495634_0004828 3300046642 Bacteria 10464
306 Ga0495634_0100139 3300046642 Bacteria 1873
307 Ga0495634_0354449 3300046642 Bacteria 878
308 Ga0495635_0000057 3300046663 Bacteria 67714
309 Ga0495588_0000229 3300046674 Bacteria 50351
310 Ga0495657_0000026 3300046675 Bacteria 133011
311 Ga0495657_0007638 3300046675 Bacteria 8330
312 Ga0495657_0055122 3300046675 Bacteria 2653
313 Ga0495599_0020843 3300046678 Bacteria 4085
314 Ga0495599_0065495 3300046678 Bacteria 2270
315 Ga0495599_0131563 3300046678 Bacteria 1554
316 Ga0495646_0247519 3300046680 Archaea 956
317 Ga0495647_0000023 3300046681 Bacteria 67025
318 Ga0495647_0009332 3300046681 Bacteria 3321
319 Ga0495647_0031055 3300046681 Bacteria 1985
320 Ga0495658_0000002 3300046683 Bacteria 309651
321 Ga0495658_0106634 3300046683 Bacteria 1680
322 Ga0495669_0000282 3300046684 Bacteria 29109
323 Ga0495613_0000032 3300046689 Bacteria 139806
324 Ga0495613_0002007 3300046689 Bacteria 15449
325 Ga0495613_0052954 3300046689 Bacteria 2988
326 Ga0495613_0132337 3300046689 Bacteria 1786
327 Ga0495624_0000071 3300046690 Bacteria 65995
328 Ga0495624_0001926 3300046690 Bacteria 15801
329 Ga0495649_0003071 3300046694 Bacteria 11425
330 Ga0495600_0006556 3300046809 Bacteria 7086
331 Ga0495600_0021861 3300046809 Bacteria 4102
332 Ga0495600_0378377 3300046809 Bacteria 883
333 Ga0495604_0000100 3300047317 Bacteria 72995
334 Ga0495604_0000305 3300047317 Bacteria 44020
335 Ga0495674_0000010 3300047319 Bacteria 285794
336 Ga0495672_0135762 3300047320 Bacteria 1290
337 Ga0495676_0009565 3300047321 Bacteria 8822
338 Ga0495676_0112630 3300047321 Bacteria 1993
339 Ga0495676_0132599 3300047321 Bacteria 1796
340 Ga0495680_0000312 3300047322 Bacteria 54495
341 Ga0495680_0003440 3300047322 Bacteria 15615
342 Ga0495680_0034290 3300047322 Bacteria 4101
343 Ga0495680_0112420 3300047322 Bacteria 2017
344 Ga0495675_0000015 3300047444 Bacteria 133004
345 Ga0495675_0061786 3300047444 Bacteria 2373
346 Ga0495684_0050501 3300047471 Bacteria 3175
347 Ga0495684_0066579 3300047471 Bacteria 2739
348 Ga0495686_0458170 3300047472 Bacteria 676
349 Ga0495593_0274093 3300047673 Bacteria 844
350 Ga0495602_0000227 3300048088 Bacteria 52680
351 Ga0495602_0001969 3300048088 Bacteria 20606
352 Ga0495602_0015468 3300048088 Bacteria 7699
353 Ga0496100_0000001 3300048903 Bacteria 530179
354 Ga0496100_0000010 3300048903 Bacteria 205204
355 Ga0496101_0000004 3300048904 Bacteria 331599
356 Ga0496101_0000025 3300048904 Bacteria 205204
357 Ga0496102_0002490 3300048905 Bacteria 15727
358 Ga0496102_0297212 3300048905 Bacteria 1522
359 Ga0496102_0367512 3300048905 Bacteria 1354
360 Ga0496103_0000057 3300048906 Bacteria 142223
361 Ga0496103_0300063 3300048906 Bacteria 1033
362 Ga0496104_0000015 3300048907 Bacteria 374530
363 Ga0496104_0000024 3300048907 Bacteria 229913
364 Ga0496104_0000213 3300048907 Bacteria 51219
365 Ga0496104_0094409 3300048907 Bacteria 2862
366 Ga0496105_0000004 3300048908 Bacteria 475798
367 Ga0496105_0000013 3300048908 Bacteria 229894
368 Ga0496105_0000059 3300048908 Bacteria 86884
369 Ga0496106_0000012 3300048909 Bacteria 205158
370 Ga0496106_0000091 3300048909 Bacteria 71361
371 Ga0496106_0000356 3300048909 Bacteria 32385
372 Ga0496106_0164476 3300048909 Bacteria 1756
373 Ga0496107_0000002 3300048910 Bacteria 320871
374 Ga0496107_0000010 3300048910 Bacteria 205188
375 Ga0496108_0000005 3300048911 Bacteria 535059
376 Ga0496108_0000006 3300048911 Bacteria 469473
377 Ga0496108_0000232 3300048911 Bacteria 49846
378 Ga0496108_0013086 3300048911 Bacteria 6762
379 Ga0496108_0192077 3300048911 Bacteria 1770
380 Ga0496109_0000002 3300048912 Bacteria 443393
381 Ga0496109_0000004 3300048912 Bacteria 404818
382 Ga0496109_0000044 3300048912 Bacteria 133779
383 Ga0496109_0111941 3300048912 Bacteria 2538
384 Ga0496109_0126031 3300048912 Bacteria 2388
385 Ga0496109_0145771 3300048912 Bacteria 2215
386 Ga0496109_0430622 3300048912 Bacteria 1246
387 Ga0496110_0028377 3300048913 Bacteria 4807
388 Ga0496110_0064915 3300048913 Bacteria 3227
389 Ga0496110_0115091 3300048913 Bacteria 2420
390 Ga0496110_0195035 3300048913 Bacteria 1839
391 Ga0496110_0281734 3300048913 Bacteria 1514
392 Ga0496112_0000006 3300048915 Bacteria 365227
393 Ga0496112_0018954 3300048915 Bacteria 6486
394 Ga0496112_0866937 3300048915 Bacteria 826
395 Ga0496113_0000434 3300048916 Bacteria 20290
396 Ga0496113_0007952 3300048916 Bacteria 6867
397 Ga0496113_0027941 3300048916 Bacteria 4051
398 Ga0496113_0227155 3300048916 Bacteria 1488
399 Ga0496114_0000056 3300048917 Bacteria 95692
400 Ga0496114_0022975 3300048917 Bacteria 5084
401 Ga0496115_0000016 3300048918 Bacteria 187067
402 Ga0496115_0000031 3300048918 Bacteria 138258
403 Ga0496115_0012760 3300048918 Bacteria 6334
404 Ga0496115_0206100 3300048918 Bacteria 1624
405 Ga0496116_0000257 3300048919 Bacteria 93214
406 Ga0496117_0002686 3300048920 Bacteria 21983
407 Ga0496118_0002280 3300048921 Bacteria 26182
408 Ga0496118_0066682 3300048921 Bacteria 2626
409 Ga0496118_0137101 3300048921 Bacteria 1559
410 Ga0496119_0012123 3300048922 Bacteria 7038
411 Ga0496120_0007583 3300048923 Bacteria 8047
412 Ga0496120_0119749 3300048923 Bacteria 1363
413 Ga0496121_0191752 3300048924 Bacteria 1464
414 Ga0496125_0123426 3300048928 Bacteria 1841
415 Ga0496125_0279716 3300048928 Bacteria 1034
416 Ga0501036_0368884 3300049572 Bacteria 1198
417 Ga0501042_0116397 3300049578 Bacteria 1924
418 Ga0501068_0121508 3300049584 Bacteria 1629
419 Ga0501070_0143322 3300049586 Bacteria 1972
420 Ga0501070_0398666 3300049586 Unclassified 1113
421 Ga0501072_0147756 3300049588 Bacteria 1874
422 Ga0501075_0004268 3300049591 Bacteria 9657
423 Ga0501075_0457578 3300049591 Bacteria 973
424 Ga0501076_0178682 3300049592 Bacteria 1730
425 Ga0501079_0080601 3300049741 Bacteria 2517
426 Ga0501080_0147815 3300049742 Bacteria 2173
427 Ga0501081_0264576 3300049743 Bacteria 1257
428 Ga0501083_0070821 3300049744 Bacteria 2318
429 nmdc:mga03n38_149936_c1 3300050490 Bacteria 1172
430 nmdc:mga0yw44_206055_c1 3300050492 Bacteria 1300
431 nmdc:mga06z11_377514_c1 3300050494 Bacteria 851
432 nmdc:mga06z11_98485_c1 3300050494 Bacteria 1600
433 nmdc:mga05p37_1004224_c1 3300050507 Archaea 886
434 nmdc:mga0a205_386_c1 3300050515 Bacteria 33461
435 nmdc:mga0a205_94_c1 3300050515 Bacteria 50261
436 Ga0495601_0000057 3300053077 Bacteria 61510
437 Ga0495601_0004750 3300053077 Bacteria 7876
438 Ga0495601_0018786 3300053077 Bacteria 4209
439 Ga0495601_0037609 3300053077 Bacteria 3026
440 Ga0495601_0083057 3300053077 Bacteria 2057
441 Ga0495601_0090403 3300053077 Bacteria 1969
442 Ga0495612_0000031 3300053078 Bacteria 80955
443 Ga0495612_0001793 3300053078 Bacteria 8799
444 Ga0495612_0006253 3300053078 Bacteria 4906
445 Ga0495612_0158883 3300053078 Bacteria 986
446 Ga0495655_0000005 3300053083 Bacteria 257472
447 Ga0495595_0000017 3300053084 Bacteria 133011
448 Ga0495595_0000130 3300053084 Bacteria 31250
449 Ga0495595_0157975 3300053084 Bacteria 1118
450 Ga0495595_0191021 3300053084 Bacteria 1018
451 Ga0495619_0000010 3300053085 Bacteria 302390
452 Ga0495619_0000082 3300053085 Bacteria 71788
453 Ga0495619_0000146 3300053085 Bacteria 52136
454 Ga0495619_0001050 3300053085 Bacteria 18097
455 Ga0495619_0002897 3300053085 Bacteria 11142
456 Ga0495619_0003619 3300053085 Bacteria 9953
457 Ga0495619_0008902 3300053085 Bacteria 6340
458 Ga0495619_0086345 3300053085 Bacteria 2120
459 Ga0495619_0089148 3300053085 Bacteria 2087
460 Ga0495619_0274377 3300053085 Bacteria 1168
461 Ga0495619_0281361 3300053085 Bacteria 1153
462 Ga0500566_0000943 3300053094 Bacteria 16679
463 Ga0500614_011688 3300053123 Bacteria 1905
464 Ga0500628_000001 3300053129 Bacteria 564074
465 Ga0500628_001405 3300053129 Bacteria 4125
466 Ga0501084_0945833 3300054114 Bacteria 724
467 Ga0068863_100000779
468 JGI24746J21847_1001636
469 JGI24740J21852_10000878
470 JGI24034J26672_10001534
471 JGI24742J22300_10012430
472 Ga0070683_100015946
473 Ga0070683_100023609
474 Ga0070670_100388559
475 Ga0070677_10000082
476 Ga0070682_100000030
477 Ga0070682_100509660
478 Ga0068868_100000033
479 Ga0070660_100533468
480 Ga0070661_100000121
481 Ga0070668_100001145
482 Ga0070668_100260494
483 Ga0070674_100000002
484 Ga0070674_100000009
485 Ga0070673_100181306
486 Ga0070688_100030251
487 Ga0070659_100063824
488 Ga0070667_100007315
489 Ga0070711_100001969
490 Ga0070663_100199758
491 Ga0070663_100509916
492 Ga0070678_100010487
493 Ga0070662_100000002
494 Ga0070662_100000448
495 Ga0070685_10000053
496 Ga0070685_10001013
497 Ga0070685_10008855
498 Ga0070679_100193299
499 Ga0070684_100011055
500 Ga0070684_100091484
501 Ga0070684_100133010
502 Ga0070684_100640632
503 Ga0068853_100016611
504 Ga0068853_100080887
505 Ga0068853_100227075
506 Ga0070672_100000112
507 Ga0070686_100000026
508 Ga0070686_100178001
509 Ga0070665_100062981
510 Ga0070665_100574069
511 Ga0070664_100011461
512 Ga0070664_100015617
513 Ga0068857_100132941
514 Ga0068854_100000333
515 Ga0068854_100006276
516 Ga0068856_100218348
517 Ga0068856_100580882
518 Ga0070702_100391366
519 Ga0068852_100000002
520 Ga0068864_100000015
521 Ga0068866_10000003
522 Ga0068866_10001449
523 Ga0068866_10042954
524 Ga0068851_10006786
525 Ga0068863_100026859
526 Ga0068863_100043624
527 Ga0068858_100464322
528 Ga0068860_100613870
529 Ga0068862_100000747
530 Ga0081455_10213895
531 Ga0081538_10055558
532 Ga0081540_1000123
533 Ga0081539_10001566
534 Ga0070715_10000001
535 Ga0097621_100205313
536 Ga0068871_100056518
537 Ga0075433_10001805
538 Ga0105251_10095909
539 Ga0105245_10000201
540 Ga0105245_10001198
541 Ga0105245_10007008
542 Ga0105247_10000206
543 Ga0105247_10174953
544 Ga0105243_10003464
545 Ga0105243_10335100
546 Ga0105242_10000062
547 Ga0105242_10000595
548 Ga0105242_10095993
549 Ga0105242_10104426
550 Ga0105238_10000003
551 Ga0105238_10000009
552 Ga0105249_10013668
553 Ga0105249_10790744
554 Ga0105239_10390620
555 Ga0157371_10006328
556 Ga0157370_10104152
557 Ga0157370_10155227
558 Ga0157369_10000014
559 Ga0157374_10022241
560 Ga0157374_10041105
561 Ga0157378_10278659
562 Ga0157372_10000210
563 Ga0157372_10425336
564 Ga0157375_10000584
565 Ga0157375_10000809
566 Ga0157375_10558987
567 Ga0163163_10370475
568 Ga0163163_10636211
569 Ga0163163_10736863
570 Ga0157380_10000376
571 Ga0157380_10241363
572 Ga0157379_10777497
573 Ga0157376_10351564
574 Ga0163161_10000022
575 Ga0207656_10001461
576 Ga0207653_10091110
577 Ga0207682_10000018
578 Ga0207642_10000002
579 Ga0207642_10000353
580 Ga0207642_10145670
581 Ga0207710_10002663
582 Ga0207685_10000005
583 Ga0207663_10005529
584 Ga0207649_10000003
585 Ga0207652_10004713
586 Ga0207694_10000004
587 Ga0207694_10000077
588 Ga0207650_10452809
589 Ga0207687_10000020
590 Ga0207687_10000484
591 Ga0207687_10000851
592 Ga0207700_10000003
593 Ga0207664_10021209
594 Ga0207690_10002915
595 Ga0207706_10000001
596 Ga0207706_10000259
597 Ga0207686_10000231
598 Ga0207686_10000426
599 Ga0207686_10065470
600 Ga0207709_10009509
601 Ga0207669_10000001
602 Ga0207669_10000003
603 Ga0207704_10193499
604 Ga0207691_10000002
605 Ga0207661_10010612
606 Ga0207661_10015092
607 Ga0207679_10002319
608 Ga0207679_10024717
609 Ga0207651_10004579
610 Ga0207712_10000019
611 Ga0207712_10006981
612 Ga0207668_10001356
613 Ga0207668_10079580
614 Ga0207640_10000110
615 Ga0207640_10006888
616 Ga0207658_10002445
617 Ga0207677_10000343
618 Ga0207677_10001134
619 Ga0207703_10083001
620 Ga0207639_10037676
621 Ga0207639_10159956
622 Ga0207708_10228676
623 Ga0207702_10007849
624 Ga0207702_10079020
625 Ga0207702_10330965
626 Ga0207641_10002588
627 Ga0207641_10121250
628 Ga0207676_10000018
629 Ga0207683_10015536
630 Ga0207698_10000004
631 Ga0268266_10077960
632 Ga0268266_10674039
633 Ga0268265_10005097
634 Ga0268264_10000969
635 Ga0268264_10088341
636 Ga0268264_10209292
637 Ga0265337_1000955
638 Ga0265326_10000041
639 Ga0265326_10058107
640 Ga0265319_1000014
641 Ga0265322_10000004
642 Ga0265322_10108706
643 Ga0265336_10005432
644 Ga0265336_10010927
645 Ga0265338_10000185
646 Ga0265324_10000266
647 Ga0265324_10070782
648 Ga0265320_10000029
649 Ga0265325_10046561
650 Ga0265339_10050660
651 Ga0265331_10086030
652 Ga0265327_10000015
653 Ga0316575_10000465
654 Ga0316579_10003259
655 Ga0265314_10000119
656 Ga0265342_10107643
657 Ga0316576_10000087
658 Ga0316578_10001892
659 Ga0316578_10226880
660 Ga0316577_10003838
661 Ga0307413_10270643
662 Ga0307406_10551906
663 Ga0307412_10042158
664 Ga0307409_100130266
665 Ga0307416_100821552
666 Ga0307416_101149297
667 Ga0307415_100000870
668 Ga0316583_10094405
669 Ga0316585_10001029
670 Ga0316580_10000107
671 Ga0316593_10000394
672 Ga0316587_1035698
673 Ga0316596_1000411
674 Ga0373923_0130240
675 Ga0316574_0005091
676 Ga0373933_0607698
677 Ga0373937_0027522
678 Ga0373937_0290440
679 Ga0373937_0373905
680 Ga0316582_0004765
681 Ga0316584_0019141
682 Ga0395899_0009678
683 Ga0395899_0068219
684 Ga0395900_0112368
685 Ga0395898_0003507
686 Ga0395905_0099276
687 Ga0395905_0115596
688 Ga0395901_0013568
689 Ga0395901_0024125
690 Ga0436360_0961099
691 Ga0451800_1144989
692 Ga0451807_2015988
693 Ga0451807_2557324
694 Ga0451833_0382037
695 Ga0466969_0150181
696 Ga0466965_0335144
697 Ga0466966_0083081
698 Ga0466961_0046177
699 Ga0466961_0118660
700 Ga0466963_0000127
701 Ga0466963_0057809
702 Ga0466957_0003429
703 Ga0466957_0113475
704 Ga0466959_0444900
705 Ga0466958_0021104
706 Ga0466958_0068710
707 Ga0466958_0078670
708 Ga0466967_0000006
709 Ga0466967_0110030
710 Ga0495592_0005546
711 Ga0495592_0125425
712 Ga0495603_0000033
713 Ga0495603_0001486
714 Ga0495603_0088382
715 Ga0495629_0003072
716 Ga0495629_0041194
717 Ga0495629_0095306
718 Ga0495629_0143000
719 Ga0495629_0409881
720 Ga0495641_0000014
721 Ga0495641_0176552
722 Ga0495651_0054708
723 Ga0495651_0127312
724 Ga0495651_0171606
725 Ga0495653_0039868
726 Ga0495653_0069035
727 Ga0495653_0183381
728 Ga0495582_0000009
729 Ga0495662_0000698
730 Ga0495662_0018648
731 Ga0495662_0104392
732 Ga0495594_0000006
733 Ga0495606_0000463
734 Ga0495608_0000035
735 Ga0495608_0003187
736 Ga0495608_0115478
737 Ga0495608_0125113
738 Ga0495608_0412770
739 Ga0495618_0000070
740 Ga0495618_0129331
741 Ga0495620_0002920
742 Ga0495628_0001620
743 Ga0495628_0059689
744 Ga0495628_0327391
745 Ga0495630_0000362
746 Ga0495630_0069317
747 Ga0495630_0131936
748 Ga0495630_0255355
749 Ga0495643_0000692
750 Ga0495652_0000010
751 Ga0495652_0103187
752 Ga0495652_0376965
753 Ga0495640_0098475
754 Ga0495640_0100282
755 Ga0495586_0439969
756 Ga0495586_0483345
757 Ga0495587_0001789
758 Ga0495587_0085772
759 Ga0495587_0097278
760 Ga0495587_0303004
761 Ga0495621_0004240
762 Ga0495645_0010315
763 Ga0495645_0337540
764 Ga0495622_0000132
765 Ga0495667_0000258
766 Ga0495667_0229977
767 Ga0495667_0365247
768 Ga0495656_0001129
769 Ga0495668_0047700
770 Ga0495634_0000216
771 Ga0495634_0004828
772 Ga0495634_0100139
773 Ga0495634_0354449
774 Ga0495635_0000057
775 Ga0495588_0000229
776 Ga0495657_0000026
777 Ga0495657_0007638
778 Ga0495657_0055122
779 Ga0495599_0020843
780 Ga0495599_0065495
781 Ga0495599_0131563
782 Ga0495646_0247519
783 Ga0495647_0000023
784 Ga0495647_0009332
785 Ga0495647_0031055
786 Ga0495658_0000002
787 Ga0495658_0106634
788 Ga0495669_0000282
789 Ga0495613_0000032
790 Ga0495613_0002007
791 Ga0495613_0052954
792 Ga0495613_0132337
793 Ga0495624_0000071
794 Ga0495624_0001926
795 Ga0495649_0003071
796 Ga0495600_0006556
797 Ga0495600_0021861
798 Ga0495600_0378377
799 Ga0495604_0000100
800 Ga0495604_0000305
801 Ga0495674_0000010
802 Ga0495672_0135762
803 Ga0495676_0009565
804 Ga0495676_0112630
805 Ga0495676_0132599
806 Ga0495680_0000312
807 Ga0495680_0003440
808 Ga0495680_0034290
809 Ga0495680_0112420
810 Ga0495675_0000015
811 Ga0495675_0061786
812 Ga0495684_0050501
813 Ga0495684_0066579
814 Ga0495686_0458170
815 Ga0495593_0274093
816 Ga0495602_0000227
817 Ga0495602_0001969
818 Ga0495602_0015468
819 Ga0496100_0000001
820 Ga0496100_0000010
821 Ga0496101_0000004
822 Ga0496101_0000025
823 Ga0496102_0002490
824 Ga0496102_0297212
825 Ga0496102_0367512
826 Ga0496103_0000057
827 Ga0496103_0300063
828 Ga0496104_0000015
829 Ga0496104_0000024
830 Ga0496104_0000213
831 Ga0496104_0094409
832 Ga0496105_0000004
833 Ga0496105_0000013
834 Ga0496105_0000059
835 Ga0496106_0000012
836 Ga0496106_0000091
837 Ga0496106_0000356
838 Ga0496106_0164476
839 Ga0496107_0000002
840 Ga0496107_0000010
841 Ga0496108_0000005
842 Ga0496108_0000006
843 Ga0496108_0000232
844 Ga0496108_0013086
845 Ga0496108_0192077
846 Ga0496109_0000002
847 Ga0496109_0000004
848 Ga0496109_0000044
849 Ga0496109_0111941
850 Ga0496109_0126031
851 Ga0496109_0145771
852 Ga0496109_0430622
853 Ga0496110_0028377
854 Ga0496110_0064915
855 Ga0496110_0115091
856 Ga0496110_0195035
857 Ga0496110_0281734
858 Ga0496112_0000006
859 Ga0496112_0018954
860 Ga0496112_0866937
861 Ga0496113_0000434
862 Ga0496113_0007952
863 Ga0496113_0027941
864 Ga0496113_0227155
865 Ga0496114_0000056
866 Ga0496114_0022975
867 Ga0496115_0000016
868 Ga0496115_0000031
869 Ga0496115_0012760
870 Ga0496115_0206100
871 Ga0496116_0000257
872 Ga0496117_0002686
873 Ga0496118_0002280
874 Ga0496118_0066682
875 Ga0496118_0137101
876 Ga0496119_0012123
877 Ga0496120_0007583
878 Ga0496120_0119749
879 Ga0496121_0191752
880 Ga0496125_0123426
881 Ga0496125_0279716
882 Ga0501036_0368884
883 Ga0501042_0116397
884 Ga0501068_0121508
885 Ga0501070_0143322
886 Ga0501070_0398666
887 Ga0501072_0147756
888 Ga0501075_0004268
889 Ga0501075_0457578
890 Ga0501076_0178682
891 Ga0501079_0080601
892 Ga0501080_0147815
893 Ga0501081_0264576
894 Ga0501083_0070821
895 nmdc:mga03n38_149936_c1
896 nmdc:mga0yw44_206055_c1
897 nmdc:mga06z11_377514_c1
898 nmdc:mga06z11_98485_c1
899 nmdc:mga05p37_1004224_c1
900 nmdc:mga0a205_386_c1
901 nmdc:mga0a205_94_c1
902 Ga0495601_0000057
903 Ga0495601_0004750
904 Ga0495601_0018786
905 Ga0495601_0037609
906 Ga0495601_0083057
907 Ga0495601_0090403
908 Ga0495612_0000031
909 Ga0495612_0001793
910 Ga0495612_0006253
911 Ga0495612_0158883
912 Ga0495655_0000005
913 Ga0495595_0000017
914 Ga0495595_0000130
915 Ga0495595_0157975
916 Ga0495595_0191021
917 Ga0495619_0000010
918 Ga0495619_0000082
919 Ga0495619_0000146
920 Ga0495619_0001050
921 Ga0495619_0002897
922 Ga0495619_0003619
923 Ga0495619_0008902
924 Ga0495619_0086345
925 Ga0495619_0089148
926 Ga0495619_0274377
927 Ga0495619_0281361
928 Ga0500566_0000943
929 Ga0500614_011688
930 Ga0500628_000001
931 Ga0500628_001405
932 Ga0501084_0945833

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00697

PRAI

N-(5'phosphoribosyl)anthranilate (PRA) isomerase

36

235

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lbm-assembly1.cif.gz_A crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) 0.9443 1 205
1dl3-assembly2.cif.gz_B crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.9417 1 205
1dl3-assembly1.cif.gz_A crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.9371 1 205
1lbm-assembly1.cif.gz_A crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) 0.9301 1 205
1nsj-assembly1.cif.gz_A-2 crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima 0.9281 1 205
ID Description Score Start End Superfamily
1dl3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9371 1 205 3.20.20.70
af_P00909_260_447_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.927 6 200 3.20.20.70
1dl3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9228 1 205 3.20.20.70
af_P00909_260_447_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9176 6 200 3.20.20.70
1v5xB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9167 1 205 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A537YV11-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9982 1 206 GO:0000162
GO:0004640
GO:0006568
AF-A0A7J9YSZ1-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9927 1 206 GO:0000162
GO:0004640
GO:0006568
AF-A0A7V9HRX4-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9917 1 206 GO:0000162
GO:0004640
GO:0006568
AF-A0A7W0Z8Z4-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9863 1 207 GO:0000162
GO:0004640
GO:0006568
AF-A0A7V9F097-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (EC 5.3.1.24) 0.9841 1 207 GO:0000162
GO:0004640
GO:0006568

Map