F449635
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 466 | 260 | 932 | 211 |
Family's Representative Sequence
| Representative Sequence | 3300005841|Ga0068863_100000779|Ga0068863_10000077926 |
| Length | 244 |
| Sequence | VFWEVPSGALLTRGPRGATRCRMPQAKLSYSGAVRVKICGITNLDDAAEAVLLGAWAIGLIHYDRSPRAVEAGEAAAICAAFRRKCEVVGVFVNPELEEVAKAVEGAGLTMVQLNGAEGPQFCAEVARRTGVKVIKAIHVASAAEVHGAEAYRTDFHLFDRRGKGLWGGTGQSFDWGLLREHRSEVPAIVAGGLRPDNVAEAIAVTHPFAVDVASGVEAEPGRKDHAAMGAFFEAAGVTSVPAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 43 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 45 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 50 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 111 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 112 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 113 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 114 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 115 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 116 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 117 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 118 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 119 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 120 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 121 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 122 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 123 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 124 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 125 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 126 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 127 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 128 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 129 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 130 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 131 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 133 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 134 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 135 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 136 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 137 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 138 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 140 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 141 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 142 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 143 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 144 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 146 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 147 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 148 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 149 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 150 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 151 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 152 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 153 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 154 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 155 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 156 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 157 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 158 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 159 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 160 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 161 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 162 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 163 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 164 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 165 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 217 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 218 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 219 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 220 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 221 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 222 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 225 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 226 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 227 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 228 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 229 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 230 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 231 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 232 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 233 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 234 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 235 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 236 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 248 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 249 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 250 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 258 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 259 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 260 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.36 |
| Metatranscriptomes | 0.64 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.72 |
| Nodule | 0 |
| Rhizoplane | 11.8 |
| Rhizosphere | 83.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068863_100000779 | 3300005841 | Bacteria | 32033 |
| 2 | JGI24746J21847_1001636 | 3300001977 | Bacteria | 3586 |
| 3 | JGI24740J21852_10000878 | 3300001979 | Bacteria | 13286 |
| 4 | JGI24034J26672_10001534 | 3300002239 | Bacteria | 3068 |
| 5 | JGI24742J22300_10012430 | 3300002244 | Bacteria | 1419 |
| 6 | Ga0070683_100015946 | 3300005329 | Bacteria | 6610 |
| 7 | Ga0070683_100023609 | 3300005329 | Bacteria | 5502 |
| 8 | Ga0070670_100388559 | 3300005331 | Bacteria | 1230 |
| 9 | Ga0070677_10000082 | 3300005333 | Bacteria | 30305 |
| 10 | Ga0070682_100000030 | 3300005337 | Bacteria | 182768 |
| 11 | Ga0070682_100509660 | 3300005337 | Archaea | 934 |
| 12 | Ga0068868_100000033 | 3300005338 | Bacteria | 75402 |
| 13 | Ga0070660_100533468 | 3300005339 | Bacteria | 978 |
| 14 | Ga0070661_100000121 | 3300005344 | Bacteria | 65344 |
| 15 | Ga0070668_100001145 | 3300005347 | Bacteria | 18672 |
| 16 | Ga0070668_100260494 | 3300005347 | Bacteria | 1442 |
| 17 | Ga0070674_100000002 | 3300005356 | Bacteria | 271088 |
| 18 | Ga0070674_100000009 | 3300005356 | Bacteria | 143336 |
| 19 | Ga0070673_100181306 | 3300005364 | Bacteria | 1803 |
| 20 | Ga0070688_100030251 | 3300005365 | Bacteria | 3248 |
| 21 | Ga0070659_100063824 | 3300005366 | Bacteria | 2914 |
| 22 | Ga0070667_100007315 | 3300005367 | Bacteria | 9177 |
| 23 | Ga0070711_100001969 | 3300005439 | Bacteria | 11529 |
| 24 | Ga0070663_100199758 | 3300005455 | Bacteria | 1560 |
| 25 | Ga0070663_100509916 | 3300005455 | Unclassified | 1000 |
| 26 | Ga0070678_100010487 | 3300005456 | Bacteria | 5666 |
| 27 | Ga0070662_100000002 | 3300005457 | Bacteria | 253208 |
| 28 | Ga0070662_100000448 | 3300005457 | Bacteria | 24327 |
| 29 | Ga0070685_10000053 | 3300005466 | Bacteria | 70868 |
| 30 | Ga0070685_10001013 | 3300005466 | Bacteria | 15114 |
| 31 | Ga0070685_10008855 | 3300005466 | Bacteria | 5189 |
| 32 | Ga0070679_100193299 | 3300005530 | Bacteria | 2003 |
| 33 | Ga0070684_100011055 | 3300005535 | Bacteria | 7180 |
| 34 | Ga0070684_100091484 | 3300005535 | Bacteria | 2706 |
| 35 | Ga0070684_100133010 | 3300005535 | Bacteria | 2245 |
| 36 | Ga0070684_100640632 | 3300005535 | Bacteria | 989 |
| 37 | Ga0068853_100016611 | 3300005539 | Bacteria | 6060 |
| 38 | Ga0068853_100080887 | 3300005539 | Bacteria | 2844 |
| 39 | Ga0068853_100227075 | 3300005539 | Bacteria | 1707 |
| 40 | Ga0070672_100000112 | 3300005543 | Bacteria | 41002 |
| 41 | Ga0070686_100000026 | 3300005544 | Bacteria | 126656 |
| 42 | Ga0070686_100178001 | 3300005544 | Bacteria | 1509 |
| 43 | Ga0070665_100062981 | 3300005548 | Bacteria | 3719 |
| 44 | Ga0070665_100574069 | 3300005548 | Bacteria | 1141 |
| 45 | Ga0070664_100011461 | 3300005564 | Bacteria | 7195 |
| 46 | Ga0070664_100015617 | 3300005564 | Bacteria | 6214 |
| 47 | Ga0068857_100132941 | 3300005577 | Bacteria | 2245 |
| 48 | Ga0068854_100000333 | 3300005578 | Bacteria | 30901 |
| 49 | Ga0068854_100006276 | 3300005578 | Bacteria | 7556 |
| 50 | Ga0068856_100218348 | 3300005614 | Bacteria | 1922 |
| 51 | Ga0068856_100580882 | 3300005614 | Bacteria | 1142 |
| 52 | Ga0070702_100391366 | 3300005615 | Bacteria | 991 |
| 53 | Ga0068852_100000002 | 3300005616 | Bacteria | 268221 |
| 54 | Ga0068864_100000015 | 3300005618 | Bacteria | 303368 |
| 55 | Ga0068866_10000003 | 3300005718 | Bacteria | 281675 |
| 56 | Ga0068866_10001449 | 3300005718 | Bacteria | 10144 |
| 57 | Ga0068866_10042954 | 3300005718 | Bacteria | 2253 |
| 58 | Ga0068851_10006786 | 3300005834 | Bacteria | 5240 |
| 59 | Ga0068863_100026859 | 3300005841 | Bacteria | 5491 |
| 60 | Ga0068863_100043624 | 3300005841 | Bacteria | 4257 |
| 61 | Ga0068858_100464322 | 3300005842 | Bacteria | 1221 |
| 62 | Ga0068860_100613870 | 3300005843 | Bacteria | 1094 |
| 63 | Ga0068862_100000747 | 3300005844 | Bacteria | 32578 |
| 64 | Ga0081455_10213895 | 3300005937 | Bacteria | 1434 |
| 65 | Ga0081538_10055558 | 3300005981 | Bacteria | 2329 |
| 66 | Ga0081540_1000123 | 3300005983 | Bacteria | 81914 |
| 67 | Ga0081539_10001566 | 3300005985 | Bacteria | 37942 |
| 68 | Ga0070715_10000001 | 3300006163 | Bacteria | 693690 |
| 69 | Ga0097621_100205313 | 3300006237 | Bacteria | 1712 |
| 70 | Ga0068871_100056518 | 3300006358 | Bacteria | 3190 |
| 71 | Ga0075433_10001805 | 3300006852 | Bacteria | 16060 |
| 72 | Ga0105251_10095909 | 3300009011 | Bacteria | 1359 |
| 73 | Ga0105245_10000201 | 3300009098 | Bacteria | 57152 |
| 74 | Ga0105245_10001198 | 3300009098 | Bacteria | 23459 |
| 75 | Ga0105245_10007008 | 3300009098 | Bacteria | 9888 |
| 76 | Ga0105247_10000206 | 3300009101 | Bacteria | 57601 |
| 77 | Ga0105247_10174953 | 3300009101 | Bacteria | 1429 |
| 78 | Ga0105243_10003464 | 3300009148 | Bacteria | 12741 |
| 79 | Ga0105243_10335100 | 3300009148 | Bacteria | 1384 |
| 80 | Ga0105242_10000062 | 3300009176 | Bacteria | 74936 |
| 81 | Ga0105242_10000595 | 3300009176 | Bacteria | 28423 |
| 82 | Ga0105242_10095993 | 3300009176 | Bacteria | 2503 |
| 83 | Ga0105242_10104426 | 3300009176 | Bacteria | 2405 |
| 84 | Ga0105238_10000003 | 3300009551 | Bacteria | 422077 |
| 85 | Ga0105238_10000009 | 3300009551 | Bacteria | 288729 |
| 86 | Ga0105249_10013668 | 3300009553 | Bacteria | 7168 |
| 87 | Ga0105249_10790744 | 3300009553 | Bacteria | 1012 |
| 88 | Ga0105239_10390620 | 3300010375 | Bacteria | 1574 |
| 89 | Ga0157371_10006328 | 3300013102 | Bacteria | 9796 |
| 90 | Ga0157370_10104152 | 3300013104 | Bacteria | 2656 |
| 91 | Ga0157370_10155227 | 3300013104 | Bacteria | 2129 |
| 92 | Ga0157369_10000014 | 3300013105 | Bacteria | 266411 |
| 93 | Ga0157374_10022241 | 3300013296 | Bacteria | 5655 |
| 94 | Ga0157374_10041105 | 3300013296 | Bacteria | 4259 |
| 95 | Ga0157378_10278659 | 3300013297 | Bacteria | 1611 |
| 96 | Ga0157372_10000210 | 3300013307 | Bacteria | 65290 |
| 97 | Ga0157372_10425336 | 3300013307 | Bacteria | 1548 |
| 98 | Ga0157375_10000584 | 3300013308 | Bacteria | 32509 |
| 99 | Ga0157375_10000809 | 3300013308 | Bacteria | 27418 |
| 100 | Ga0157375_10558987 | 3300013308 | Bacteria | 1305 |
| 101 | Ga0163163_10370475 | 3300014325 | Bacteria | 1489 |
| 102 | Ga0163163_10636211 | 3300014325 | Unclassified | 1130 |
| 103 | Ga0163163_10736863 | 3300014325 | Bacteria | 1049 |
| 104 | Ga0157380_10000376 | 3300014326 | Bacteria | 26882 |
| 105 | Ga0157380_10241363 | 3300014326 | Bacteria | 1629 |
| 106 | Ga0157379_10777497 | 3300014968 | Unclassified | 903 |
| 107 | Ga0157376_10351564 | 3300014969 | Bacteria | 1411 |
| 108 | Ga0163161_10000022 | 3300017792 | Bacteria | 207890 |
| 109 | Ga0207656_10001461 | 3300025321 | Bacteria | 7829 |
| 110 | Ga0207653_10091110 | 3300025885 | Bacteria | 1068 |
| 111 | Ga0207682_10000018 | 3300025893 | Bacteria | 66215 |
| 112 | Ga0207642_10000002 | 3300025899 | Bacteria | 658166 |
| 113 | Ga0207642_10000353 | 3300025899 | Bacteria | 13789 |
| 114 | Ga0207642_10145670 | 3300025899 | Bacteria | 1254 |
| 115 | Ga0207710_10002663 | 3300025900 | Bacteria | 8226 |
| 116 | Ga0207685_10000005 | 3300025905 | Bacteria | 289944 |
| 117 | Ga0207663_10005529 | 3300025916 | Bacteria | 6373 |
| 118 | Ga0207649_10000003 | 3300025920 | Bacteria | 388908 |
| 119 | Ga0207652_10004713 | 3300025921 | Bacteria | 11056 |
| 120 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 121 | Ga0207694_10000077 | 3300025924 | Bacteria | 112188 |
| 122 | Ga0207650_10452809 | 3300025925 | Bacteria | 1068 |
| 123 | Ga0207687_10000020 | 3300025927 | Bacteria | 228407 |
| 124 | Ga0207687_10000484 | 3300025927 | Bacteria | 26903 |
| 125 | Ga0207687_10000851 | 3300025927 | Bacteria | 20636 |
| 126 | Ga0207700_10000003 | 3300025928 | Bacteria | 500797 |
| 127 | Ga0207664_10021209 | 3300025929 | Bacteria | 4826 |
| 128 | Ga0207690_10002915 | 3300025932 | Bacteria | 10309 |
| 129 | Ga0207706_10000001 | 3300025933 | Bacteria | 423014 |
| 130 | Ga0207706_10000259 | 3300025933 | Bacteria | 57912 |
| 131 | Ga0207686_10000231 | 3300025934 | Bacteria | 42432 |
| 132 | Ga0207686_10000426 | 3300025934 | Bacteria | 28776 |
| 133 | Ga0207686_10065470 | 3300025934 | Bacteria | 2318 |
| 134 | Ga0207709_10009509 | 3300025935 | Bacteria | 5348 |
| 135 | Ga0207669_10000001 | 3300025937 | Bacteria | 377747 |
| 136 | Ga0207669_10000003 | 3300025937 | Bacteria | 252239 |
| 137 | Ga0207704_10193499 | 3300025938 | Bacteria | 1481 |
| 138 | Ga0207691_10000002 | 3300025940 | Bacteria | 189785 |
| 139 | Ga0207661_10010612 | 3300025944 | Bacteria | 6638 |
| 140 | Ga0207661_10015092 | 3300025944 | Bacteria | 5676 |
| 141 | Ga0207679_10002319 | 3300025945 | Bacteria | 11707 |
| 142 | Ga0207679_10024717 | 3300025945 | Bacteria | 4122 |
| 143 | Ga0207651_10004579 | 3300025960 | Bacteria | 7000 |
| 144 | Ga0207712_10000019 | 3300025961 | Bacteria | 317060 |
| 145 | Ga0207712_10006981 | 3300025961 | Bacteria | 7121 |
| 146 | Ga0207668_10001356 | 3300025972 | Bacteria | 14490 |
| 147 | Ga0207668_10079580 | 3300025972 | Bacteria | 2371 |
| 148 | Ga0207640_10000110 | 3300025981 | Bacteria | 61907 |
| 149 | Ga0207640_10006888 | 3300025981 | Bacteria | 6250 |
| 150 | Ga0207658_10002445 | 3300025986 | Bacteria | 13591 |
| 151 | Ga0207677_10000343 | 3300026023 | Bacteria | 33031 |
| 152 | Ga0207677_10001134 | 3300026023 | Bacteria | 14537 |
| 153 | Ga0207703_10083001 | 3300026035 | Bacteria | 2676 |
| 154 | Ga0207639_10037676 | 3300026041 | Bacteria | 3592 |
| 155 | Ga0207639_10159956 | 3300026041 | Bacteria | 1897 |
| 156 | Ga0207708_10228676 | 3300026075 | Bacteria | 1493 |
| 157 | Ga0207702_10007849 | 3300026078 | Bacteria | 9052 |
| 158 | Ga0207702_10079020 | 3300026078 | Bacteria | 2850 |
| 159 | Ga0207702_10330965 | 3300026078 | Bacteria | 1453 |
| 160 | Ga0207641_10002588 | 3300026088 | Bacteria | 16628 |
| 161 | Ga0207641_10121250 | 3300026088 | Bacteria | 2334 |
| 162 | Ga0207676_10000018 | 3300026095 | Bacteria | 306375 |
| 163 | Ga0207683_10015536 | 3300026121 | Bacteria | 6482 |
| 164 | Ga0207698_10000004 | 3300026142 | Bacteria | 313614 |
| 165 | Ga0268266_10077960 | 3300028379 | Bacteria | 2882 |
| 166 | Ga0268266_10674039 | 3300028379 | Bacteria | 996 |
| 167 | Ga0268265_10005097 | 3300028380 | Bacteria | 9009 |
| 168 | Ga0268264_10000969 | 3300028381 | Bacteria | 29417 |
| 169 | Ga0268264_10088341 | 3300028381 | Bacteria | 2667 |
| 170 | Ga0268264_10209292 | 3300028381 | Bacteria | 1789 |
| 171 | Ga0265337_1000955 | 3300028556 | Bacteria | 15128 |
| 172 | Ga0265326_10000041 | 3300028558 | Bacteria | 83872 |
| 173 | Ga0265326_10058107 | 3300028558 | Bacteria | 1094 |
| 174 | Ga0265319_1000014 | 3300028563 | Bacteria | 177623 |
| 175 | Ga0265322_10000004 | 3300028654 | Bacteria | 275155 |
| 176 | Ga0265322_10108706 | 3300028654 | Archaea | 789 |
| 177 | Ga0265336_10005432 | 3300028666 | Bacteria | 4697 |
| 178 | Ga0265336_10010927 | 3300028666 | Bacteria | 3097 |
| 179 | Ga0265338_10000185 | 3300028800 | Bacteria | 116333 |
| 180 | Ga0265324_10000266 | 3300029957 | Bacteria | 38549 |
| 181 | Ga0265324_10070782 | 3300029957 | Bacteria | 1188 |
| 182 | Ga0265320_10000029 | 3300031240 | Bacteria | 159627 |
| 183 | Ga0265325_10046561 | 3300031241 | Bacteria | 2249 |
| 184 | Ga0265339_10050660 | 3300031249 | Bacteria | 2270 |
| 185 | Ga0265331_10086030 | 3300031250 | Bacteria | 1456 |
| 186 | Ga0265327_10000015 | 3300031251 | Bacteria | 496677 |
| 187 | Ga0316575_10000465 | 3300031665 | Bacteria | 11619 |
| 188 | Ga0316579_10003259 | 3300031691 | Bacteria | 6296 |
| 189 | Ga0265314_10000119 | 3300031711 | Bacteria | 122334 |
| 190 | Ga0265342_10107643 | 3300031712 | Bacteria | 1581 |
| 191 | Ga0316576_10000087 | 3300031727 | Bacteria | 32443 |
| 192 | Ga0316578_10001892 | 3300031728 | Bacteria | 8842 |
| 193 | Ga0316578_10226880 | 3300031728 | Bacteria | 1122 |
| 194 | Ga0316577_10003838 | 3300031733 | Bacteria | 7658 |
| 195 | Ga0307413_10270643 | 3300031824 | Bacteria | 1272 |
| 196 | Ga0307406_10551906 | 3300031901 | Bacteria | 943 |
| 197 | Ga0307412_10042158 | 3300031911 | Bacteria | 2963 |
| 198 | Ga0307409_100130266 | 3300031995 | Bacteria | 2148 |
| 199 | Ga0307416_100821552 | 3300032002 | Bacteria | 1026 |
| 200 | Ga0307416_101149297 | 3300032002 | Unclassified | 882 |
| 201 | Ga0307415_100000870 | 3300032126 | Bacteria | 13803 |
| 202 | Ga0316583_10094405 | 3300032133 | Bacteria | 1043 |
| 203 | Ga0316585_10001029 | 3300032137 | Bacteria | 7216 |
| 204 | Ga0316580_10000107 | 3300032139 | Bacteria | 15287 |
| 205 | Ga0316593_10000394 | 3300032168 | Bacteria | 7810 |
| 206 | Ga0316587_1035698 | 3300033529 | Bacteria | 889 |
| 207 | Ga0316596_1000411 | 3300033541 | Bacteria | 7126 |
| 208 | Ga0373923_0130240 | 3300035111 | Bacteria | 1130 |
| 209 | Ga0316574_0005091 | 3300035398 | Bacteria | 6983 |
| 210 | Ga0373933_0607698 | 3300035724 | Unclassified | 718 |
| 211 | Ga0373937_0027522 | 3300036401 | Bacteria | 5141 |
| 212 | Ga0373937_0290440 | 3300036401 | Bacteria | 1545 |
| 213 | Ga0373937_0373905 | 3300036401 | Bacteria | 1351 |
| 214 | Ga0316582_0004765 | 3300036647 | Bacteria | 6911 |
| 215 | Ga0316584_0019141 | 3300036712 | Bacteria | 4946 |
| 216 | Ga0395899_0009678 | 3300037312 | Bacteria | 7397 |
| 217 | Ga0395899_0068219 | 3300037312 | Bacteria | 2608 |
| 218 | Ga0395900_0112368 | 3300037418 | Bacteria | 2797 |
| 219 | Ga0395898_0003507 | 3300037466 | Bacteria | 17499 |
| 220 | Ga0395905_0099276 | 3300037471 | Bacteria | 2734 |
| 221 | Ga0395905_0115596 | 3300037471 | Bacteria | 2521 |
| 222 | Ga0395901_0013568 | 3300038443 | Bacteria | 8287 |
| 223 | Ga0395901_0024125 | 3300038443 | Bacteria | 6239 |
| 224 | Ga0436360_0961099 | 3300039438 | Bacteria | 876 |
| 225 | Ga0451800_1144989 | 3300041459 | Bacteria | 1050 |
| 226 | Ga0451807_2015988 | 3300041486 | Bacteria | 1473 |
| 227 | Ga0451807_2557324 | 3300041486 | Bacteria | 1069 |
| 228 | Ga0451833_0382037 | 3300041491 | Bacteria | 2273 |
| 229 | Ga0466969_0150181 | 3300044656 | Bacteria | 1074 |
| 230 | Ga0466965_0335144 | 3300044683 | Bacteria | 826 |
| 231 | Ga0466966_0083081 | 3300044684 | Unclassified | 1993 |
| 232 | Ga0466961_0046177 | 3300044693 | Bacteria | 2786 |
| 233 | Ga0466961_0118660 | 3300044693 | Unclassified | 1662 |
| 234 | Ga0466963_0000127 | 3300044694 | Bacteria | 28865 |
| 235 | Ga0466963_0057809 | 3300044694 | Bacteria | 2584 |
| 236 | Ga0466957_0003429 | 3300044842 | Bacteria | 8705 |
| 237 | Ga0466957_0113475 | 3300044842 | Bacteria | 1721 |
| 238 | Ga0466959_0444900 | 3300045049 | Bacteria | 879 |
| 239 | Ga0466958_0021104 | 3300045836 | Bacteria | 3802 |
| 240 | Ga0466958_0068710 | 3300045836 | Bacteria | 2166 |
| 241 | Ga0466958_0078670 | 3300045836 | Unclassified | 2027 |
| 242 | Ga0466967_0000006 | 3300045976 | Bacteria | 144065 |
| 243 | Ga0466967_0110030 | 3300045976 | Bacteria | 2530 |
| 244 | Ga0495592_0005546 | 3300046454 | Bacteria | 9332 |
| 245 | Ga0495592_0125425 | 3300046454 | Bacteria | 1802 |
| 246 | Ga0495603_0000033 | 3300046455 | Bacteria | 57940 |
| 247 | Ga0495603_0001486 | 3300046455 | Bacteria | 13638 |
| 248 | Ga0495603_0088382 | 3300046455 | Bacteria | 1813 |
| 249 | Ga0495629_0003072 | 3300046459 | Bacteria | 12684 |
| 250 | Ga0495629_0041194 | 3300046459 | Bacteria | 3250 |
| 251 | Ga0495629_0095306 | 3300046459 | Bacteria | 2076 |
| 252 | Ga0495629_0143000 | 3300046459 | Bacteria | 1664 |
| 253 | Ga0495629_0409881 | 3300046459 | Bacteria | 920 |
| 254 | Ga0495641_0000014 | 3300046461 | Bacteria | 140908 |
| 255 | Ga0495641_0176552 | 3300046461 | Bacteria | 956 |
| 256 | Ga0495651_0054708 | 3300046462 | Bacteria | 3068 |
| 257 | Ga0495651_0127312 | 3300046462 | Bacteria | 1864 |
| 258 | Ga0495651_0171606 | 3300046462 | Bacteria | 1544 |
| 259 | Ga0495653_0039868 | 3300046463 | Bacteria | 3676 |
| 260 | Ga0495653_0069035 | 3300046463 | Bacteria | 2649 |
| 261 | Ga0495653_0183381 | 3300046463 | Bacteria | 1434 |
| 262 | Ga0495582_0000009 | 3300046473 | Bacteria | 123633 |
| 263 | Ga0495662_0000698 | 3300046476 | Bacteria | 15931 |
| 264 | Ga0495662_0018648 | 3300046476 | Bacteria | 3358 |
| 265 | Ga0495662_0104392 | 3300046476 | Bacteria | 1387 |
| 266 | Ga0495594_0000006 | 3300046499 | Bacteria | 167901 |
| 267 | Ga0495606_0000463 | 3300046507 | Bacteria | 66752 |
| 268 | Ga0495608_0000035 | 3300046511 | Bacteria | 133011 |
| 269 | Ga0495608_0003187 | 3300046511 | Bacteria | 11744 |
| 270 | Ga0495608_0115478 | 3300046511 | Bacteria | 1723 |
| 271 | Ga0495608_0125113 | 3300046511 | Bacteria | 1647 |
| 272 | Ga0495608_0412770 | 3300046511 | Bacteria | 825 |
| 273 | Ga0495618_0000070 | 3300046514 | Bacteria | 72312 |
| 274 | Ga0495618_0129331 | 3300046514 | Bacteria | 1616 |
| 275 | Ga0495620_0002920 | 3300046515 | Bacteria | 9818 |
| 276 | Ga0495628_0001620 | 3300046516 | Bacteria | 20621 |
| 277 | Ga0495628_0059689 | 3300046516 | Bacteria | 2994 |
| 278 | Ga0495628_0327391 | 3300046516 | Bacteria | 1130 |
| 279 | Ga0495630_0000362 | 3300046517 | Bacteria | 35952 |
| 280 | Ga0495630_0069317 | 3300046517 | Bacteria | 2653 |
| 281 | Ga0495630_0131936 | 3300046517 | Bacteria | 1897 |
| 282 | Ga0495630_0255355 | 3300046517 | Bacteria | 1339 |
| 283 | Ga0495643_0000692 | 3300046522 | Bacteria | 38937 |
| 284 | Ga0495652_0000010 | 3300046529 | Bacteria | 261584 |
| 285 | Ga0495652_0103187 | 3300046529 | Bacteria | 2309 |
| 286 | Ga0495652_0376965 | 3300046529 | Bacteria | 1010 |
| 287 | Ga0495640_0098475 | 3300046533 | Bacteria | 1922 |
| 288 | Ga0495640_0100282 | 3300046533 | Bacteria | 1902 |
| 289 | Ga0495586_0439969 | 3300046535 | Unclassified | 751 |
| 290 | Ga0495586_0483345 | 3300046535 | Unclassified | 714 |
| 291 | Ga0495587_0001789 | 3300046536 | Bacteria | 14353 |
| 292 | Ga0495587_0085772 | 3300046536 | Bacteria | 1823 |
| 293 | Ga0495587_0097278 | 3300046536 | Bacteria | 1697 |
| 294 | Ga0495587_0303004 | 3300046536 | Bacteria | 893 |
| 295 | Ga0495621_0004240 | 3300046539 | Bacteria | 4011 |
| 296 | Ga0495645_0010315 | 3300046543 | Bacteria | 6549 |
| 297 | Ga0495645_0337540 | 3300046543 | Bacteria | 974 |
| 298 | Ga0495622_0000132 | 3300046557 | Bacteria | 63863 |
| 299 | Ga0495667_0000258 | 3300046559 | Bacteria | 34340 |
| 300 | Ga0495667_0229977 | 3300046559 | Bacteria | 1182 |
| 301 | Ga0495667_0365247 | 3300046559 | Bacteria | 911 |
| 302 | Ga0495656_0001129 | 3300046615 | Bacteria | 8678 |
| 303 | Ga0495668_0047700 | 3300046616 | Bacteria | 2378 |
| 304 | Ga0495634_0000216 | 3300046642 | Bacteria | 53765 |
| 305 | Ga0495634_0004828 | 3300046642 | Bacteria | 10464 |
| 306 | Ga0495634_0100139 | 3300046642 | Bacteria | 1873 |
| 307 | Ga0495634_0354449 | 3300046642 | Bacteria | 878 |
| 308 | Ga0495635_0000057 | 3300046663 | Bacteria | 67714 |
| 309 | Ga0495588_0000229 | 3300046674 | Bacteria | 50351 |
| 310 | Ga0495657_0000026 | 3300046675 | Bacteria | 133011 |
| 311 | Ga0495657_0007638 | 3300046675 | Bacteria | 8330 |
| 312 | Ga0495657_0055122 | 3300046675 | Bacteria | 2653 |
| 313 | Ga0495599_0020843 | 3300046678 | Bacteria | 4085 |
| 314 | Ga0495599_0065495 | 3300046678 | Bacteria | 2270 |
| 315 | Ga0495599_0131563 | 3300046678 | Bacteria | 1554 |
| 316 | Ga0495646_0247519 | 3300046680 | Archaea | 956 |
| 317 | Ga0495647_0000023 | 3300046681 | Bacteria | 67025 |
| 318 | Ga0495647_0009332 | 3300046681 | Bacteria | 3321 |
| 319 | Ga0495647_0031055 | 3300046681 | Bacteria | 1985 |
| 320 | Ga0495658_0000002 | 3300046683 | Bacteria | 309651 |
| 321 | Ga0495658_0106634 | 3300046683 | Bacteria | 1680 |
| 322 | Ga0495669_0000282 | 3300046684 | Bacteria | 29109 |
| 323 | Ga0495613_0000032 | 3300046689 | Bacteria | 139806 |
| 324 | Ga0495613_0002007 | 3300046689 | Bacteria | 15449 |
| 325 | Ga0495613_0052954 | 3300046689 | Bacteria | 2988 |
| 326 | Ga0495613_0132337 | 3300046689 | Bacteria | 1786 |
| 327 | Ga0495624_0000071 | 3300046690 | Bacteria | 65995 |
| 328 | Ga0495624_0001926 | 3300046690 | Bacteria | 15801 |
| 329 | Ga0495649_0003071 | 3300046694 | Bacteria | 11425 |
| 330 | Ga0495600_0006556 | 3300046809 | Bacteria | 7086 |
| 331 | Ga0495600_0021861 | 3300046809 | Bacteria | 4102 |
| 332 | Ga0495600_0378377 | 3300046809 | Bacteria | 883 |
| 333 | Ga0495604_0000100 | 3300047317 | Bacteria | 72995 |
| 334 | Ga0495604_0000305 | 3300047317 | Bacteria | 44020 |
| 335 | Ga0495674_0000010 | 3300047319 | Bacteria | 285794 |
| 336 | Ga0495672_0135762 | 3300047320 | Bacteria | 1290 |
| 337 | Ga0495676_0009565 | 3300047321 | Bacteria | 8822 |
| 338 | Ga0495676_0112630 | 3300047321 | Bacteria | 1993 |
| 339 | Ga0495676_0132599 | 3300047321 | Bacteria | 1796 |
| 340 | Ga0495680_0000312 | 3300047322 | Bacteria | 54495 |
| 341 | Ga0495680_0003440 | 3300047322 | Bacteria | 15615 |
| 342 | Ga0495680_0034290 | 3300047322 | Bacteria | 4101 |
| 343 | Ga0495680_0112420 | 3300047322 | Bacteria | 2017 |
| 344 | Ga0495675_0000015 | 3300047444 | Bacteria | 133004 |
| 345 | Ga0495675_0061786 | 3300047444 | Bacteria | 2373 |
| 346 | Ga0495684_0050501 | 3300047471 | Bacteria | 3175 |
| 347 | Ga0495684_0066579 | 3300047471 | Bacteria | 2739 |
| 348 | Ga0495686_0458170 | 3300047472 | Bacteria | 676 |
| 349 | Ga0495593_0274093 | 3300047673 | Bacteria | 844 |
| 350 | Ga0495602_0000227 | 3300048088 | Bacteria | 52680 |
| 351 | Ga0495602_0001969 | 3300048088 | Bacteria | 20606 |
| 352 | Ga0495602_0015468 | 3300048088 | Bacteria | 7699 |
| 353 | Ga0496100_0000001 | 3300048903 | Bacteria | 530179 |
| 354 | Ga0496100_0000010 | 3300048903 | Bacteria | 205204 |
| 355 | Ga0496101_0000004 | 3300048904 | Bacteria | 331599 |
| 356 | Ga0496101_0000025 | 3300048904 | Bacteria | 205204 |
| 357 | Ga0496102_0002490 | 3300048905 | Bacteria | 15727 |
| 358 | Ga0496102_0297212 | 3300048905 | Bacteria | 1522 |
| 359 | Ga0496102_0367512 | 3300048905 | Bacteria | 1354 |
| 360 | Ga0496103_0000057 | 3300048906 | Bacteria | 142223 |
| 361 | Ga0496103_0300063 | 3300048906 | Bacteria | 1033 |
| 362 | Ga0496104_0000015 | 3300048907 | Bacteria | 374530 |
| 363 | Ga0496104_0000024 | 3300048907 | Bacteria | 229913 |
| 364 | Ga0496104_0000213 | 3300048907 | Bacteria | 51219 |
| 365 | Ga0496104_0094409 | 3300048907 | Bacteria | 2862 |
| 366 | Ga0496105_0000004 | 3300048908 | Bacteria | 475798 |
| 367 | Ga0496105_0000013 | 3300048908 | Bacteria | 229894 |
| 368 | Ga0496105_0000059 | 3300048908 | Bacteria | 86884 |
| 369 | Ga0496106_0000012 | 3300048909 | Bacteria | 205158 |
| 370 | Ga0496106_0000091 | 3300048909 | Bacteria | 71361 |
| 371 | Ga0496106_0000356 | 3300048909 | Bacteria | 32385 |
| 372 | Ga0496106_0164476 | 3300048909 | Bacteria | 1756 |
| 373 | Ga0496107_0000002 | 3300048910 | Bacteria | 320871 |
| 374 | Ga0496107_0000010 | 3300048910 | Bacteria | 205188 |
| 375 | Ga0496108_0000005 | 3300048911 | Bacteria | 535059 |
| 376 | Ga0496108_0000006 | 3300048911 | Bacteria | 469473 |
| 377 | Ga0496108_0000232 | 3300048911 | Bacteria | 49846 |
| 378 | Ga0496108_0013086 | 3300048911 | Bacteria | 6762 |
| 379 | Ga0496108_0192077 | 3300048911 | Bacteria | 1770 |
| 380 | Ga0496109_0000002 | 3300048912 | Bacteria | 443393 |
| 381 | Ga0496109_0000004 | 3300048912 | Bacteria | 404818 |
| 382 | Ga0496109_0000044 | 3300048912 | Bacteria | 133779 |
| 383 | Ga0496109_0111941 | 3300048912 | Bacteria | 2538 |
| 384 | Ga0496109_0126031 | 3300048912 | Bacteria | 2388 |
| 385 | Ga0496109_0145771 | 3300048912 | Bacteria | 2215 |
| 386 | Ga0496109_0430622 | 3300048912 | Bacteria | 1246 |
| 387 | Ga0496110_0028377 | 3300048913 | Bacteria | 4807 |
| 388 | Ga0496110_0064915 | 3300048913 | Bacteria | 3227 |
| 389 | Ga0496110_0115091 | 3300048913 | Bacteria | 2420 |
| 390 | Ga0496110_0195035 | 3300048913 | Bacteria | 1839 |
| 391 | Ga0496110_0281734 | 3300048913 | Bacteria | 1514 |
| 392 | Ga0496112_0000006 | 3300048915 | Bacteria | 365227 |
| 393 | Ga0496112_0018954 | 3300048915 | Bacteria | 6486 |
| 394 | Ga0496112_0866937 | 3300048915 | Bacteria | 826 |
| 395 | Ga0496113_0000434 | 3300048916 | Bacteria | 20290 |
| 396 | Ga0496113_0007952 | 3300048916 | Bacteria | 6867 |
| 397 | Ga0496113_0027941 | 3300048916 | Bacteria | 4051 |
| 398 | Ga0496113_0227155 | 3300048916 | Bacteria | 1488 |
| 399 | Ga0496114_0000056 | 3300048917 | Bacteria | 95692 |
| 400 | Ga0496114_0022975 | 3300048917 | Bacteria | 5084 |
| 401 | Ga0496115_0000016 | 3300048918 | Bacteria | 187067 |
| 402 | Ga0496115_0000031 | 3300048918 | Bacteria | 138258 |
| 403 | Ga0496115_0012760 | 3300048918 | Bacteria | 6334 |
| 404 | Ga0496115_0206100 | 3300048918 | Bacteria | 1624 |
| 405 | Ga0496116_0000257 | 3300048919 | Bacteria | 93214 |
| 406 | Ga0496117_0002686 | 3300048920 | Bacteria | 21983 |
| 407 | Ga0496118_0002280 | 3300048921 | Bacteria | 26182 |
| 408 | Ga0496118_0066682 | 3300048921 | Bacteria | 2626 |
| 409 | Ga0496118_0137101 | 3300048921 | Bacteria | 1559 |
| 410 | Ga0496119_0012123 | 3300048922 | Bacteria | 7038 |
| 411 | Ga0496120_0007583 | 3300048923 | Bacteria | 8047 |
| 412 | Ga0496120_0119749 | 3300048923 | Bacteria | 1363 |
| 413 | Ga0496121_0191752 | 3300048924 | Bacteria | 1464 |
| 414 | Ga0496125_0123426 | 3300048928 | Bacteria | 1841 |
| 415 | Ga0496125_0279716 | 3300048928 | Bacteria | 1034 |
| 416 | Ga0501036_0368884 | 3300049572 | Bacteria | 1198 |
| 417 | Ga0501042_0116397 | 3300049578 | Bacteria | 1924 |
| 418 | Ga0501068_0121508 | 3300049584 | Bacteria | 1629 |
| 419 | Ga0501070_0143322 | 3300049586 | Bacteria | 1972 |
| 420 | Ga0501070_0398666 | 3300049586 | Unclassified | 1113 |
| 421 | Ga0501072_0147756 | 3300049588 | Bacteria | 1874 |
| 422 | Ga0501075_0004268 | 3300049591 | Bacteria | 9657 |
| 423 | Ga0501075_0457578 | 3300049591 | Bacteria | 973 |
| 424 | Ga0501076_0178682 | 3300049592 | Bacteria | 1730 |
| 425 | Ga0501079_0080601 | 3300049741 | Bacteria | 2517 |
| 426 | Ga0501080_0147815 | 3300049742 | Bacteria | 2173 |
| 427 | Ga0501081_0264576 | 3300049743 | Bacteria | 1257 |
| 428 | Ga0501083_0070821 | 3300049744 | Bacteria | 2318 |
| 429 | nmdc:mga03n38_149936_c1 | 3300050490 | Bacteria | 1172 |
| 430 | nmdc:mga0yw44_206055_c1 | 3300050492 | Bacteria | 1300 |
| 431 | nmdc:mga06z11_377514_c1 | 3300050494 | Bacteria | 851 |
| 432 | nmdc:mga06z11_98485_c1 | 3300050494 | Bacteria | 1600 |
| 433 | nmdc:mga05p37_1004224_c1 | 3300050507 | Archaea | 886 |
| 434 | nmdc:mga0a205_386_c1 | 3300050515 | Bacteria | 33461 |
| 435 | nmdc:mga0a205_94_c1 | 3300050515 | Bacteria | 50261 |
| 436 | Ga0495601_0000057 | 3300053077 | Bacteria | 61510 |
| 437 | Ga0495601_0004750 | 3300053077 | Bacteria | 7876 |
| 438 | Ga0495601_0018786 | 3300053077 | Bacteria | 4209 |
| 439 | Ga0495601_0037609 | 3300053077 | Bacteria | 3026 |
| 440 | Ga0495601_0083057 | 3300053077 | Bacteria | 2057 |
| 441 | Ga0495601_0090403 | 3300053077 | Bacteria | 1969 |
| 442 | Ga0495612_0000031 | 3300053078 | Bacteria | 80955 |
| 443 | Ga0495612_0001793 | 3300053078 | Bacteria | 8799 |
| 444 | Ga0495612_0006253 | 3300053078 | Bacteria | 4906 |
| 445 | Ga0495612_0158883 | 3300053078 | Bacteria | 986 |
| 446 | Ga0495655_0000005 | 3300053083 | Bacteria | 257472 |
| 447 | Ga0495595_0000017 | 3300053084 | Bacteria | 133011 |
| 448 | Ga0495595_0000130 | 3300053084 | Bacteria | 31250 |
| 449 | Ga0495595_0157975 | 3300053084 | Bacteria | 1118 |
| 450 | Ga0495595_0191021 | 3300053084 | Bacteria | 1018 |
| 451 | Ga0495619_0000010 | 3300053085 | Bacteria | 302390 |
| 452 | Ga0495619_0000082 | 3300053085 | Bacteria | 71788 |
| 453 | Ga0495619_0000146 | 3300053085 | Bacteria | 52136 |
| 454 | Ga0495619_0001050 | 3300053085 | Bacteria | 18097 |
| 455 | Ga0495619_0002897 | 3300053085 | Bacteria | 11142 |
| 456 | Ga0495619_0003619 | 3300053085 | Bacteria | 9953 |
| 457 | Ga0495619_0008902 | 3300053085 | Bacteria | 6340 |
| 458 | Ga0495619_0086345 | 3300053085 | Bacteria | 2120 |
| 459 | Ga0495619_0089148 | 3300053085 | Bacteria | 2087 |
| 460 | Ga0495619_0274377 | 3300053085 | Bacteria | 1168 |
| 461 | Ga0495619_0281361 | 3300053085 | Bacteria | 1153 |
| 462 | Ga0500566_0000943 | 3300053094 | Bacteria | 16679 |
| 463 | Ga0500614_011688 | 3300053123 | Bacteria | 1905 |
| 464 | Ga0500628_000001 | 3300053129 | Bacteria | 564074 |
| 465 | Ga0500628_001405 | 3300053129 | Bacteria | 4125 |
| 466 | Ga0501084_0945833 | 3300054114 | Bacteria | 724 |
| 467 | Ga0068863_100000779 | |||
| 468 | JGI24746J21847_1001636 | |||
| 469 | JGI24740J21852_10000878 | |||
| 470 | JGI24034J26672_10001534 | |||
| 471 | JGI24742J22300_10012430 | |||
| 472 | Ga0070683_100015946 | |||
| 473 | Ga0070683_100023609 | |||
| 474 | Ga0070670_100388559 | |||
| 475 | Ga0070677_10000082 | |||
| 476 | Ga0070682_100000030 | |||
| 477 | Ga0070682_100509660 | |||
| 478 | Ga0068868_100000033 | |||
| 479 | Ga0070660_100533468 | |||
| 480 | Ga0070661_100000121 | |||
| 481 | Ga0070668_100001145 | |||
| 482 | Ga0070668_100260494 | |||
| 483 | Ga0070674_100000002 | |||
| 484 | Ga0070674_100000009 | |||
| 485 | Ga0070673_100181306 | |||
| 486 | Ga0070688_100030251 | |||
| 487 | Ga0070659_100063824 | |||
| 488 | Ga0070667_100007315 | |||
| 489 | Ga0070711_100001969 | |||
| 490 | Ga0070663_100199758 | |||
| 491 | Ga0070663_100509916 | |||
| 492 | Ga0070678_100010487 | |||
| 493 | Ga0070662_100000002 | |||
| 494 | Ga0070662_100000448 | |||
| 495 | Ga0070685_10000053 | |||
| 496 | Ga0070685_10001013 | |||
| 497 | Ga0070685_10008855 | |||
| 498 | Ga0070679_100193299 | |||
| 499 | Ga0070684_100011055 | |||
| 500 | Ga0070684_100091484 | |||
| 501 | Ga0070684_100133010 | |||
| 502 | Ga0070684_100640632 | |||
| 503 | Ga0068853_100016611 | |||
| 504 | Ga0068853_100080887 | |||
| 505 | Ga0068853_100227075 | |||
| 506 | Ga0070672_100000112 | |||
| 507 | Ga0070686_100000026 | |||
| 508 | Ga0070686_100178001 | |||
| 509 | Ga0070665_100062981 | |||
| 510 | Ga0070665_100574069 | |||
| 511 | Ga0070664_100011461 | |||
| 512 | Ga0070664_100015617 | |||
| 513 | Ga0068857_100132941 | |||
| 514 | Ga0068854_100000333 | |||
| 515 | Ga0068854_100006276 | |||
| 516 | Ga0068856_100218348 | |||
| 517 | Ga0068856_100580882 | |||
| 518 | Ga0070702_100391366 | |||
| 519 | Ga0068852_100000002 | |||
| 520 | Ga0068864_100000015 | |||
| 521 | Ga0068866_10000003 | |||
| 522 | Ga0068866_10001449 | |||
| 523 | Ga0068866_10042954 | |||
| 524 | Ga0068851_10006786 | |||
| 525 | Ga0068863_100026859 | |||
| 526 | Ga0068863_100043624 | |||
| 527 | Ga0068858_100464322 | |||
| 528 | Ga0068860_100613870 | |||
| 529 | Ga0068862_100000747 | |||
| 530 | Ga0081455_10213895 | |||
| 531 | Ga0081538_10055558 | |||
| 532 | Ga0081540_1000123 | |||
| 533 | Ga0081539_10001566 | |||
| 534 | Ga0070715_10000001 | |||
| 535 | Ga0097621_100205313 | |||
| 536 | Ga0068871_100056518 | |||
| 537 | Ga0075433_10001805 | |||
| 538 | Ga0105251_10095909 | |||
| 539 | Ga0105245_10000201 | |||
| 540 | Ga0105245_10001198 | |||
| 541 | Ga0105245_10007008 | |||
| 542 | Ga0105247_10000206 | |||
| 543 | Ga0105247_10174953 | |||
| 544 | Ga0105243_10003464 | |||
| 545 | Ga0105243_10335100 | |||
| 546 | Ga0105242_10000062 | |||
| 547 | Ga0105242_10000595 | |||
| 548 | Ga0105242_10095993 | |||
| 549 | Ga0105242_10104426 | |||
| 550 | Ga0105238_10000003 | |||
| 551 | Ga0105238_10000009 | |||
| 552 | Ga0105249_10013668 | |||
| 553 | Ga0105249_10790744 | |||
| 554 | Ga0105239_10390620 | |||
| 555 | Ga0157371_10006328 | |||
| 556 | Ga0157370_10104152 | |||
| 557 | Ga0157370_10155227 | |||
| 558 | Ga0157369_10000014 | |||
| 559 | Ga0157374_10022241 | |||
| 560 | Ga0157374_10041105 | |||
| 561 | Ga0157378_10278659 | |||
| 562 | Ga0157372_10000210 | |||
| 563 | Ga0157372_10425336 | |||
| 564 | Ga0157375_10000584 | |||
| 565 | Ga0157375_10000809 | |||
| 566 | Ga0157375_10558987 | |||
| 567 | Ga0163163_10370475 | |||
| 568 | Ga0163163_10636211 | |||
| 569 | Ga0163163_10736863 | |||
| 570 | Ga0157380_10000376 | |||
| 571 | Ga0157380_10241363 | |||
| 572 | Ga0157379_10777497 | |||
| 573 | Ga0157376_10351564 | |||
| 574 | Ga0163161_10000022 | |||
| 575 | Ga0207656_10001461 | |||
| 576 | Ga0207653_10091110 | |||
| 577 | Ga0207682_10000018 | |||
| 578 | Ga0207642_10000002 | |||
| 579 | Ga0207642_10000353 | |||
| 580 | Ga0207642_10145670 | |||
| 581 | Ga0207710_10002663 | |||
| 582 | Ga0207685_10000005 | |||
| 583 | Ga0207663_10005529 | |||
| 584 | Ga0207649_10000003 | |||
| 585 | Ga0207652_10004713 | |||
| 586 | Ga0207694_10000004 | |||
| 587 | Ga0207694_10000077 | |||
| 588 | Ga0207650_10452809 | |||
| 589 | Ga0207687_10000020 | |||
| 590 | Ga0207687_10000484 | |||
| 591 | Ga0207687_10000851 | |||
| 592 | Ga0207700_10000003 | |||
| 593 | Ga0207664_10021209 | |||
| 594 | Ga0207690_10002915 | |||
| 595 | Ga0207706_10000001 | |||
| 596 | Ga0207706_10000259 | |||
| 597 | Ga0207686_10000231 | |||
| 598 | Ga0207686_10000426 | |||
| 599 | Ga0207686_10065470 | |||
| 600 | Ga0207709_10009509 | |||
| 601 | Ga0207669_10000001 | |||
| 602 | Ga0207669_10000003 | |||
| 603 | Ga0207704_10193499 | |||
| 604 | Ga0207691_10000002 | |||
| 605 | Ga0207661_10010612 | |||
| 606 | Ga0207661_10015092 | |||
| 607 | Ga0207679_10002319 | |||
| 608 | Ga0207679_10024717 | |||
| 609 | Ga0207651_10004579 | |||
| 610 | Ga0207712_10000019 | |||
| 611 | Ga0207712_10006981 | |||
| 612 | Ga0207668_10001356 | |||
| 613 | Ga0207668_10079580 | |||
| 614 | Ga0207640_10000110 | |||
| 615 | Ga0207640_10006888 | |||
| 616 | Ga0207658_10002445 | |||
| 617 | Ga0207677_10000343 | |||
| 618 | Ga0207677_10001134 | |||
| 619 | Ga0207703_10083001 | |||
| 620 | Ga0207639_10037676 | |||
| 621 | Ga0207639_10159956 | |||
| 622 | Ga0207708_10228676 | |||
| 623 | Ga0207702_10007849 | |||
| 624 | Ga0207702_10079020 | |||
| 625 | Ga0207702_10330965 | |||
| 626 | Ga0207641_10002588 | |||
| 627 | Ga0207641_10121250 | |||
| 628 | Ga0207676_10000018 | |||
| 629 | Ga0207683_10015536 | |||
| 630 | Ga0207698_10000004 | |||
| 631 | Ga0268266_10077960 | |||
| 632 | Ga0268266_10674039 | |||
| 633 | Ga0268265_10005097 | |||
| 634 | Ga0268264_10000969 | |||
| 635 | Ga0268264_10088341 | |||
| 636 | Ga0268264_10209292 | |||
| 637 | Ga0265337_1000955 | |||
| 638 | Ga0265326_10000041 | |||
| 639 | Ga0265326_10058107 | |||
| 640 | Ga0265319_1000014 | |||
| 641 | Ga0265322_10000004 | |||
| 642 | Ga0265322_10108706 | |||
| 643 | Ga0265336_10005432 | |||
| 644 | Ga0265336_10010927 | |||
| 645 | Ga0265338_10000185 | |||
| 646 | Ga0265324_10000266 | |||
| 647 | Ga0265324_10070782 | |||
| 648 | Ga0265320_10000029 | |||
| 649 | Ga0265325_10046561 | |||
| 650 | Ga0265339_10050660 | |||
| 651 | Ga0265331_10086030 | |||
| 652 | Ga0265327_10000015 | |||
| 653 | Ga0316575_10000465 | |||
| 654 | Ga0316579_10003259 | |||
| 655 | Ga0265314_10000119 | |||
| 656 | Ga0265342_10107643 | |||
| 657 | Ga0316576_10000087 | |||
| 658 | Ga0316578_10001892 | |||
| 659 | Ga0316578_10226880 | |||
| 660 | Ga0316577_10003838 | |||
| 661 | Ga0307413_10270643 | |||
| 662 | Ga0307406_10551906 | |||
| 663 | Ga0307412_10042158 | |||
| 664 | Ga0307409_100130266 | |||
| 665 | Ga0307416_100821552 | |||
| 666 | Ga0307416_101149297 | |||
| 667 | Ga0307415_100000870 | |||
| 668 | Ga0316583_10094405 | |||
| 669 | Ga0316585_10001029 | |||
| 670 | Ga0316580_10000107 | |||
| 671 | Ga0316593_10000394 | |||
| 672 | Ga0316587_1035698 | |||
| 673 | Ga0316596_1000411 | |||
| 674 | Ga0373923_0130240 | |||
| 675 | Ga0316574_0005091 | |||
| 676 | Ga0373933_0607698 | |||
| 677 | Ga0373937_0027522 | |||
| 678 | Ga0373937_0290440 | |||
| 679 | Ga0373937_0373905 | |||
| 680 | Ga0316582_0004765 | |||
| 681 | Ga0316584_0019141 | |||
| 682 | Ga0395899_0009678 | |||
| 683 | Ga0395899_0068219 | |||
| 684 | Ga0395900_0112368 | |||
| 685 | Ga0395898_0003507 | |||
| 686 | Ga0395905_0099276 | |||
| 687 | Ga0395905_0115596 | |||
| 688 | Ga0395901_0013568 | |||
| 689 | Ga0395901_0024125 | |||
| 690 | Ga0436360_0961099 | |||
| 691 | Ga0451800_1144989 | |||
| 692 | Ga0451807_2015988 | |||
| 693 | Ga0451807_2557324 | |||
| 694 | Ga0451833_0382037 | |||
| 695 | Ga0466969_0150181 | |||
| 696 | Ga0466965_0335144 | |||
| 697 | Ga0466966_0083081 | |||
| 698 | Ga0466961_0046177 | |||
| 699 | Ga0466961_0118660 | |||
| 700 | Ga0466963_0000127 | |||
| 701 | Ga0466963_0057809 | |||
| 702 | Ga0466957_0003429 | |||
| 703 | Ga0466957_0113475 | |||
| 704 | Ga0466959_0444900 | |||
| 705 | Ga0466958_0021104 | |||
| 706 | Ga0466958_0068710 | |||
| 707 | Ga0466958_0078670 | |||
| 708 | Ga0466967_0000006 | |||
| 709 | Ga0466967_0110030 | |||
| 710 | Ga0495592_0005546 | |||
| 711 | Ga0495592_0125425 | |||
| 712 | Ga0495603_0000033 | |||
| 713 | Ga0495603_0001486 | |||
| 714 | Ga0495603_0088382 | |||
| 715 | Ga0495629_0003072 | |||
| 716 | Ga0495629_0041194 | |||
| 717 | Ga0495629_0095306 | |||
| 718 | Ga0495629_0143000 | |||
| 719 | Ga0495629_0409881 | |||
| 720 | Ga0495641_0000014 | |||
| 721 | Ga0495641_0176552 | |||
| 722 | Ga0495651_0054708 | |||
| 723 | Ga0495651_0127312 | |||
| 724 | Ga0495651_0171606 | |||
| 725 | Ga0495653_0039868 | |||
| 726 | Ga0495653_0069035 | |||
| 727 | Ga0495653_0183381 | |||
| 728 | Ga0495582_0000009 | |||
| 729 | Ga0495662_0000698 | |||
| 730 | Ga0495662_0018648 | |||
| 731 | Ga0495662_0104392 | |||
| 732 | Ga0495594_0000006 | |||
| 733 | Ga0495606_0000463 | |||
| 734 | Ga0495608_0000035 | |||
| 735 | Ga0495608_0003187 | |||
| 736 | Ga0495608_0115478 | |||
| 737 | Ga0495608_0125113 | |||
| 738 | Ga0495608_0412770 | |||
| 739 | Ga0495618_0000070 | |||
| 740 | Ga0495618_0129331 | |||
| 741 | Ga0495620_0002920 | |||
| 742 | Ga0495628_0001620 | |||
| 743 | Ga0495628_0059689 | |||
| 744 | Ga0495628_0327391 | |||
| 745 | Ga0495630_0000362 | |||
| 746 | Ga0495630_0069317 | |||
| 747 | Ga0495630_0131936 | |||
| 748 | Ga0495630_0255355 | |||
| 749 | Ga0495643_0000692 | |||
| 750 | Ga0495652_0000010 | |||
| 751 | Ga0495652_0103187 | |||
| 752 | Ga0495652_0376965 | |||
| 753 | Ga0495640_0098475 | |||
| 754 | Ga0495640_0100282 | |||
| 755 | Ga0495586_0439969 | |||
| 756 | Ga0495586_0483345 | |||
| 757 | Ga0495587_0001789 | |||
| 758 | Ga0495587_0085772 | |||
| 759 | Ga0495587_0097278 | |||
| 760 | Ga0495587_0303004 | |||
| 761 | Ga0495621_0004240 | |||
| 762 | Ga0495645_0010315 | |||
| 763 | Ga0495645_0337540 | |||
| 764 | Ga0495622_0000132 | |||
| 765 | Ga0495667_0000258 | |||
| 766 | Ga0495667_0229977 | |||
| 767 | Ga0495667_0365247 | |||
| 768 | Ga0495656_0001129 | |||
| 769 | Ga0495668_0047700 | |||
| 770 | Ga0495634_0000216 | |||
| 771 | Ga0495634_0004828 | |||
| 772 | Ga0495634_0100139 | |||
| 773 | Ga0495634_0354449 | |||
| 774 | Ga0495635_0000057 | |||
| 775 | Ga0495588_0000229 | |||
| 776 | Ga0495657_0000026 | |||
| 777 | Ga0495657_0007638 | |||
| 778 | Ga0495657_0055122 | |||
| 779 | Ga0495599_0020843 | |||
| 780 | Ga0495599_0065495 | |||
| 781 | Ga0495599_0131563 | |||
| 782 | Ga0495646_0247519 | |||
| 783 | Ga0495647_0000023 | |||
| 784 | Ga0495647_0009332 | |||
| 785 | Ga0495647_0031055 | |||
| 786 | Ga0495658_0000002 | |||
| 787 | Ga0495658_0106634 | |||
| 788 | Ga0495669_0000282 | |||
| 789 | Ga0495613_0000032 | |||
| 790 | Ga0495613_0002007 | |||
| 791 | Ga0495613_0052954 | |||
| 792 | Ga0495613_0132337 | |||
| 793 | Ga0495624_0000071 | |||
| 794 | Ga0495624_0001926 | |||
| 795 | Ga0495649_0003071 | |||
| 796 | Ga0495600_0006556 | |||
| 797 | Ga0495600_0021861 | |||
| 798 | Ga0495600_0378377 | |||
| 799 | Ga0495604_0000100 | |||
| 800 | Ga0495604_0000305 | |||
| 801 | Ga0495674_0000010 | |||
| 802 | Ga0495672_0135762 | |||
| 803 | Ga0495676_0009565 | |||
| 804 | Ga0495676_0112630 | |||
| 805 | Ga0495676_0132599 | |||
| 806 | Ga0495680_0000312 | |||
| 807 | Ga0495680_0003440 | |||
| 808 | Ga0495680_0034290 | |||
| 809 | Ga0495680_0112420 | |||
| 810 | Ga0495675_0000015 | |||
| 811 | Ga0495675_0061786 | |||
| 812 | Ga0495684_0050501 | |||
| 813 | Ga0495684_0066579 | |||
| 814 | Ga0495686_0458170 | |||
| 815 | Ga0495593_0274093 | |||
| 816 | Ga0495602_0000227 | |||
| 817 | Ga0495602_0001969 | |||
| 818 | Ga0495602_0015468 | |||
| 819 | Ga0496100_0000001 | |||
| 820 | Ga0496100_0000010 | |||
| 821 | Ga0496101_0000004 | |||
| 822 | Ga0496101_0000025 | |||
| 823 | Ga0496102_0002490 | |||
| 824 | Ga0496102_0297212 | |||
| 825 | Ga0496102_0367512 | |||
| 826 | Ga0496103_0000057 | |||
| 827 | Ga0496103_0300063 | |||
| 828 | Ga0496104_0000015 | |||
| 829 | Ga0496104_0000024 | |||
| 830 | Ga0496104_0000213 | |||
| 831 | Ga0496104_0094409 | |||
| 832 | Ga0496105_0000004 | |||
| 833 | Ga0496105_0000013 | |||
| 834 | Ga0496105_0000059 | |||
| 835 | Ga0496106_0000012 | |||
| 836 | Ga0496106_0000091 | |||
| 837 | Ga0496106_0000356 | |||
| 838 | Ga0496106_0164476 | |||
| 839 | Ga0496107_0000002 | |||
| 840 | Ga0496107_0000010 | |||
| 841 | Ga0496108_0000005 | |||
| 842 | Ga0496108_0000006 | |||
| 843 | Ga0496108_0000232 | |||
| 844 | Ga0496108_0013086 | |||
| 845 | Ga0496108_0192077 | |||
| 846 | Ga0496109_0000002 | |||
| 847 | Ga0496109_0000004 | |||
| 848 | Ga0496109_0000044 | |||
| 849 | Ga0496109_0111941 | |||
| 850 | Ga0496109_0126031 | |||
| 851 | Ga0496109_0145771 | |||
| 852 | Ga0496109_0430622 | |||
| 853 | Ga0496110_0028377 | |||
| 854 | Ga0496110_0064915 | |||
| 855 | Ga0496110_0115091 | |||
| 856 | Ga0496110_0195035 | |||
| 857 | Ga0496110_0281734 | |||
| 858 | Ga0496112_0000006 | |||
| 859 | Ga0496112_0018954 | |||
| 860 | Ga0496112_0866937 | |||
| 861 | Ga0496113_0000434 | |||
| 862 | Ga0496113_0007952 | |||
| 863 | Ga0496113_0027941 | |||
| 864 | Ga0496113_0227155 | |||
| 865 | Ga0496114_0000056 | |||
| 866 | Ga0496114_0022975 | |||
| 867 | Ga0496115_0000016 | |||
| 868 | Ga0496115_0000031 | |||
| 869 | Ga0496115_0012760 | |||
| 870 | Ga0496115_0206100 | |||
| 871 | Ga0496116_0000257 | |||
| 872 | Ga0496117_0002686 | |||
| 873 | Ga0496118_0002280 | |||
| 874 | Ga0496118_0066682 | |||
| 875 | Ga0496118_0137101 | |||
| 876 | Ga0496119_0012123 | |||
| 877 | Ga0496120_0007583 | |||
| 878 | Ga0496120_0119749 | |||
| 879 | Ga0496121_0191752 | |||
| 880 | Ga0496125_0123426 | |||
| 881 | Ga0496125_0279716 | |||
| 882 | Ga0501036_0368884 | |||
| 883 | Ga0501042_0116397 | |||
| 884 | Ga0501068_0121508 | |||
| 885 | Ga0501070_0143322 | |||
| 886 | Ga0501070_0398666 | |||
| 887 | Ga0501072_0147756 | |||
| 888 | Ga0501075_0004268 | |||
| 889 | Ga0501075_0457578 | |||
| 890 | Ga0501076_0178682 | |||
| 891 | Ga0501079_0080601 | |||
| 892 | Ga0501080_0147815 | |||
| 893 | Ga0501081_0264576 | |||
| 894 | Ga0501083_0070821 | |||
| 895 | nmdc:mga03n38_149936_c1 | |||
| 896 | nmdc:mga0yw44_206055_c1 | |||
| 897 | nmdc:mga06z11_377514_c1 | |||
| 898 | nmdc:mga06z11_98485_c1 | |||
| 899 | nmdc:mga05p37_1004224_c1 | |||
| 900 | nmdc:mga0a205_386_c1 | |||
| 901 | nmdc:mga0a205_94_c1 | |||
| 902 | Ga0495601_0000057 | |||
| 903 | Ga0495601_0004750 | |||
| 904 | Ga0495601_0018786 | |||
| 905 | Ga0495601_0037609 | |||
| 906 | Ga0495601_0083057 | |||
| 907 | Ga0495601_0090403 | |||
| 908 | Ga0495612_0000031 | |||
| 909 | Ga0495612_0001793 | |||
| 910 | Ga0495612_0006253 | |||
| 911 | Ga0495612_0158883 | |||
| 912 | Ga0495655_0000005 | |||
| 913 | Ga0495595_0000017 | |||
| 914 | Ga0495595_0000130 | |||
| 915 | Ga0495595_0157975 | |||
| 916 | Ga0495595_0191021 | |||
| 917 | Ga0495619_0000010 | |||
| 918 | Ga0495619_0000082 | |||
| 919 | Ga0495619_0000146 | |||
| 920 | Ga0495619_0001050 | |||
| 921 | Ga0495619_0002897 | |||
| 922 | Ga0495619_0003619 | |||
| 923 | Ga0495619_0008902 | |||
| 924 | Ga0495619_0086345 | |||
| 925 | Ga0495619_0089148 | |||
| 926 | Ga0495619_0274377 | |||
| 927 | Ga0495619_0281361 | |||
| 928 | Ga0500566_0000943 | |||
| 929 | Ga0500614_011688 | |||
| 930 | Ga0500628_000001 | |||
| 931 | Ga0500628_001405 | |||
| 932 | Ga0501084_0945833 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1lbm-assembly1.cif.gz_A | crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) | 0.9443 | 1 | 205 |
| 1dl3-assembly2.cif.gz_B | crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima | 0.9417 | 1 | 205 |
| 1dl3-assembly1.cif.gz_A | crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima | 0.9371 | 1 | 205 |
| 1lbm-assembly1.cif.gz_A | crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) | 0.9301 | 1 | 205 |
| 1nsj-assembly1.cif.gz_A-2 | crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima | 0.9281 | 1 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1dl3A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9371 | 1 | 205 | 3.20.20.70 |
| af_P00909_260_447_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.927 | 6 | 200 | 3.20.20.70 |
| 1dl3A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9228 | 1 | 205 | 3.20.20.70 |
| af_P00909_260_447_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9176 | 6 | 200 | 3.20.20.70 |
| 1v5xB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9167 | 1 | 205 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537YV11-F1-model_v4 | N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) | 0.9982 | 1 | 206 |
GO:0000162
GO:0004640 GO:0006568 |
| AF-A0A7J9YSZ1-F1-model_v4 | N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) | 0.9927 | 1 | 206 |
GO:0000162
GO:0004640 GO:0006568 |
| AF-A0A7V9HRX4-F1-model_v4 | N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) | 0.9917 | 1 | 206 |
GO:0000162
GO:0004640 GO:0006568 |
| AF-A0A7W0Z8Z4-F1-model_v4 | N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) | 0.9863 | 1 | 207 |
GO:0000162
GO:0004640 GO:0006568 |
| AF-A0A7V9F097-F1-model_v4 | N-(5'-phosphoribosyl)anthranilate isomerase (EC 5.3.1.24) | 0.9841 | 1 | 207 |
GO:0000162
GO:0004640 GO:0006568 |