F449663

General Info

Members Datasets Scaffolds Average Seq Length
466 282 932 298

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10012380|Ga0157372_1001238012
Length 332
Sequence MIANCLAACIANPPTGFYSLDIAKNKEIAVRIGIDLGGTKTEVIALGDSGEQLFRHRLPTPRDDYQQTIETIATLVEMAEKETGQRGTVGMGIPGSLSPYTGVVKNANSTWLNGQPFDKDLSKRLGREVRLANDANCLAVSEAIDGAAAGAQTVFAVIIGTGCGAGIAFNGHAHSGGNGTAGEWGHNPLPWMDEDELRYREEVPCYCGKQGCIETFISGTGFARDFHRLSGQPLKGNEIIRLVDEQDAVAELALSRYELRLAKSLAHVVNILDPDVIVLGGGMSNVDRLYKTVPQLIKNWVFGGECETPIRKAVHGDSSGVRGAAWLWPLER

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
34 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
35 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
56 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
57 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
58 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
59 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
63 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
87 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
99 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
100 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
101 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
102 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
103 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
104 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
105 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
106 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
110 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
113 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
114 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
115 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
116 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
117 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
118 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
119 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
120 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
123 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
124 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
125 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
126 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
127 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
128 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
137 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
138 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
139 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
140 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
143 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
144 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
145 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
148 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
159 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
170 2506520008 Serratia plymuthica AS12 Isolate Unclassified
171 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
172 2547132181 Kosakonia sacchari SP1 Isolate Stem
173 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
174 2561511199 Enterobacter sp. R4-368 Isolate Nodule
175 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
176 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
177 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
178 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
179 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
180 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
181 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
182 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
183 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
184 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
185 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
186 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
187 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
188 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
189 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
190 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
191 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
192 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
193 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
194 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
195 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
196 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
197 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
198 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
199 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
200 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
201 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
202 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
203 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
204 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
205 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
206 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
207 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
208 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
209 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
210 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
211 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
212 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
213 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
214 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
215 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
216 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
217 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
218 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
219 2636415599 Klebsiella variicola DX120E Isolate Unclassified
220 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
221 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
222 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
223 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
224 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
225 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
226 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
227 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
228 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
229 2751185917 Enterobacter sp. HK169 Isolate Unclassified
230 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
231 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
232 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
233 2775507074 Klebsiella sp. D5A Isolate Unclassified
234 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
235 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
236 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
237 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
238 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
239 2821118458 Enterobacter asburiae 609 Isolate Unclassified
240 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
241 2847085930 Erwinia persicina B64 Isolate Bulb
242 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
243 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
244 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
245 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
246 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
247 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
248 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
249 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
250 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
251 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
252 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
253 2932406140 Serratia sp. 2723 Isolate Rhizosphere
254 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
255 2937539931 Pantoea sp. LS15 Isolate Unclassified
256 2937967321 Serratia sp. YC16 Isolate Unclassified
257 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
258 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
259 2939577877 Serratia sp. 509 Isolate Rhizosphere
260 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
261 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
262 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
263 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
264 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
265 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
266 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
267 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
268 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
269 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
270 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
271 640753048 Serratia proteamaculans 568 Isolate Endosphere
272 8004592986 Serratia sp. S119 Isolate Unclassified
273 8018221730 Enterobacter sp. CM29 Isolate Unclassified
274 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
275 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
276 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
277 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
278 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
279 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
280 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
281 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
282 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.54
Metatranscriptomes 0
Isolates 24.46

Biome Distribution

Category Percentage (%)
Aerial Root 0.43
Bulb 0.21
Endosphere 1.72
Nodule 4.72
Rhizoplane 12.23
Rhizosphere 58.58
Stem 0.21
Stem Tuber 0.21
Unclassified 1.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10012380 3300013307 Bacteria 9091
2 JGI25162J39368_1001294 3300002737 Bacteria 14138
3 JGI25152J39213_1000504 3300002773 Bacteria 21760
4 rootH2_10067781 3300003320 Bacteria 29392
5 Ga0058692_1024138 3300003856 Bacteria 1224
6 Ga0058692_1027150 3300003856 Bacteria 1118
7 Ga0065704_10002155 3300005289 Bacteria 7390
8 Ga0065704_10072533 3300005289 Bacteria 8351
9 Ga0065704_10077141 3300005289 Bacteria 4839
10 Ga0065712_10067763 3300005290 Bacteria 47611
11 Ga0070658_10002863 3300005327 Bacteria 14329
12 Ga0070658_10007304 3300005327 Bacteria 8923
13 Ga0070670_100045945 3300005331 Bacteria 3755
14 Ga0068869_100106867 3300005334 Bacteria 2124
15 Ga0070660_100218506 3300005339 Bacteria 1549
16 Ga0070661_100261212 3300005344 Bacteria 1339
17 Ga0070675_100004952 3300005354 Bacteria 10161
18 Ga0070675_100033916 3300005354 Bacteria 4140
19 Ga0070713_100000385 3300005436 Bacteria 28235
20 Ga0070707_100023744 3300005468 Bacteria 5800
21 Ga0070698_100130477 3300005471 Bacteria 2469
22 Ga0070679_100057650 3300005530 Bacteria 3871
23 Ga0070665_100001966 3300005548 Bacteria 23115
24 Ga0068857_100001205 3300005577 Bacteria 20159
25 Ga0068857_100261302 3300005577 Bacteria 1589
26 Ga0068859_100328816 3300005617 Unclassified 1623
27 Ga0068863_100070135 3300005841 Bacteria 3314
28 Ga0068858_100032486 3300005842 Bacteria 4846
29 Ga0068860_100063111 3300005843 Bacteria 3520
30 Ga0068862_100162134 3300005844 Unclassified 1997
31 Ga0068862_100256772 3300005844 Bacteria 1594
32 Ga0075364_10107915 3300006051 Bacteria 1856
33 Ga0075431_100000337 3300006847 Bacteria 36950
34 Ga0075433_10014495 3300006852 Bacteria 6442
35 Ga0075433_10017621 3300006852 Bacteria 5923
36 Ga0075434_100019704 3300006871 Bacteria 6530
37 Ga0075429_100017595 3300006880 Bacteria 6180
38 Ga0075429_100095627 3300006880 Bacteria 2591
39 Ga0097620_100328836 3300006931 Unclassified 1623
40 Ga0079104_1000166 3300006946 Bacteria 94027
41 Ga0079104_1000174 3300006946 Bacteria 91722
42 Ga0079104_1000192 3300006946 Bacteria 85695
43 Ga0079104_1000578 3300006946 Bacteria 36991
44 Ga0079104_1001233 3300006946 Bacteria 17982
45 Ga0079104_1004622 3300006946 Bacteria 5799
46 Ga0079104_1004766 3300006946 Bacteria 5661
47 Ga0079104_1029048 3300006946 Bacteria 1397
48 Ga0075435_100053804 3300007076 Bacteria 3247
49 Ga0075435_100083623 3300007076 Unclassified 2624
50 Ga0105251_10000073 3300009011 Bacteria 97270
51 Ga0105251_10000254 3300009011 Bacteria 53726
52 Ga0105251_10000582 3300009011 Bacteria 33639
53 Ga0105251_10000945 3300009011 Bacteria 25937
54 Ga0105251_10001093 3300009011 Bacteria 23581
55 Ga0105251_10002540 3300009011 Bacteria 14199
56 Ga0105251_10002927 3300009011 Bacteria 12806
57 Ga0105244_10000041 3300009036 Bacteria 155525
58 Ga0105244_10000105 3300009036 Bacteria 86528
59 Ga0105244_10000315 3300009036 Bacteria 46626
60 Ga0105244_10000393 3300009036 Bacteria 40595
61 Ga0105244_10001332 3300009036 Bacteria 20137
62 Ga0105244_10008026 3300009036 Bacteria 6640
63 Ga0105244_10008717 3300009036 Bacteria 6311
64 Ga0105244_10014896 3300009036 Bacteria 4477
65 Ga0105250_10000052 3300009092 Bacteria 116382
66 Ga0105250_10000150 3300009092 Bacteria 61428
67 Ga0105250_10001806 3300009092 Bacteria 11210
68 Ga0105250_10001924 3300009092 Bacteria 10773
69 Ga0105240_10233930 3300009093 Bacteria 2134
70 Ga0111539_10007018 3300009094 Bacteria 14451
71 Ga0111539_10007070 3300009094 Bacteria 14390
72 Ga0105247_10000191 3300009101 Bacteria 60259
73 Ga0114129_10198228 3300009147 Bacteria 2721
74 Ga0105243_10008113 3300009148 Bacteria 8059
75 Ga0105241_10000004 3300009174 Bacteria 803007
76 Ga0105248_10116986 3300009177 Bacteria 3006
77 Ga0105237_10020561 3300009545 Bacteria 6802
78 Ga0105237_10130987 3300009545 Bacteria 2502
79 Ga0105238_10243555 3300009551 Bacteria 1776
80 Ga0105249_10063309 3300009553 Bacteria 3398
81 Ga0105239_10095578 3300010375 Bacteria 3283
82 Ga0157373_10014395 3300013100 Bacteria 5798
83 Ga0157371_10001405 3300013102 Bacteria 25086
84 Ga0157371_10181645 3300013102 Bacteria 1504
85 Ga0157370_10002956 3300013104 Bacteria 20228
86 Ga0157370_10644254 3300013104 Bacteria 969
87 Ga0157369_10025595 3300013105 Bacteria 6548
88 Ga0157372_10110465 3300013307 Bacteria 3149
89 Ga0157372_10413971 3300013307 Bacteria 1571
90 Ga0157375_10043734 3300013308 Bacteria 4346
91 Ga0182008_10003637 3300014497 Bacteria 9204
92 Ga0157377_10014009 3300014745 Bacteria 4072
93 Ga0157379_10002070 3300014968 Bacteria 16658
94 Ga0182006_1000020 3300015261 Bacteria 285318
95 Ga0183366_1001 3300015679 Bacteria 2743932
96 Ga0183370_1001 3300015680 Bacteria 2743932
97 Ga0183369_1001 3300015685 Bacteria 2743932
98 Ga0183368_1001 3300015687 Bacteria 2743932
99 Ga0163161_10000004 3300017792 Bacteria 333149
100 Ga0163161_10105637 3300017792 Bacteria 2101
101 Ga0213876_10000025 3300021384 Bacteria 236747
102 Ga0209129_1000015 3300025258 Bacteria 487967
103 Ga0207696_1000003 3300025711 Bacteria 860639
104 Ga0207696_1000007 3300025711 Bacteria 578417
105 Ga0207696_1000033 3300025711 Bacteria 360689
106 Ga0207696_1000420 3300025711 Bacteria 39046
107 Ga0207696_1001427 3300025711 Bacteria 13014
108 Ga0207696_1004377 3300025711 Bacteria 6103
109 Ga0207655_1000001 3300025728 Bacteria 1866413
110 Ga0207655_1000011 3300025728 Bacteria 643321
111 Ga0207655_1000087 3300025728 Bacteria 205876
112 Ga0207655_1000121 3300025728 Bacteria 155535
113 Ga0207655_1000226 3300025728 Bacteria 94688
114 Ga0207655_1000404 3300025728 Bacteria 59563
115 Ga0207655_1003806 3300025728 Bacteria 11012
116 Ga0207655_1005258 3300025728 Bacteria 8877
117 Ga0207655_1008424 3300025728 Bacteria 6544
118 Ga0207655_1012604 3300025728 Bacteria 4927
119 Ga0207713_1000005 3300025735 Bacteria 649958
120 Ga0207713_1000038 3300025735 Bacteria 247609
121 Ga0207713_1000065 3300025735 Bacteria 196128
122 Ga0207713_1000108 3300025735 Bacteria 137268
123 Ga0207713_1000155 3300025735 Bacteria 102677
124 Ga0207713_1001646 3300025735 Bacteria 17385
125 Ga0207713_1003616 3300025735 Bacteria 10414
126 Ga0207713_1006190 3300025735 Bacteria 7338
127 Ga0207710_10000016 3300025900 Bacteria 388568
128 Ga0207688_10161114 3300025901 Unclassified 1330
129 Ga0207680_10012051 3300025903 Bacteria 4393
130 Ga0207654_10000006 3300025911 Bacteria 815027
131 Ga0207654_10237666 3300025911 Bacteria 1216
132 Ga0207671_10018012 3300025914 Bacteria 5431
133 Ga0207657_10028108 3300025919 Bacteria 5138
134 Ga0207652_10038954 3300025921 Bacteria 4032
135 Ga0207646_10022560 3300025922 Bacteria 5797
136 Ga0207694_10172761 3300025924 Bacteria 1750
137 Ga0207659_10020135 3300025926 Bacteria 4404
138 Ga0207659_10024594 3300025926 Bacteria 4038
139 Ga0207700_10000031 3300025928 Bacteria 130086
140 Ga0207709_10004933 3300025935 Bacteria 7637
141 Ga0207691_10382275 3300025940 Bacteria 1202
142 Ga0207711_10016847 3300025941 Bacteria 6068
143 Ga0207667_10066530 3300025949 Bacteria 3756
144 Ga0207667_10178835 3300025949 Bacteria 2179
145 Ga0207712_10016559 3300025961 Bacteria 4777
146 Ga0207658_10055294 3300025986 Bacteria 2941
147 Ga0207658_10079321 3300025986 Bacteria 2511
148 Ga0207703_10015669 3300026035 Bacteria 5912
149 Ga0207641_10023728 3300026088 Bacteria 5054
150 Ga0207674_10000067 3300026116 Bacteria 107803
151 Ga0207674_10084902 3300026116 Bacteria 3163
152 Ga0209281_1000001 3300027111 Bacteria 1933496
153 Ga0209281_1000008 3300027111 Bacteria 867470
154 Ga0209281_1000021 3300027111 Bacteria 541033
155 Ga0209281_1000075 3300027111 Bacteria 267114
156 Ga0209281_1000093 3300027111 Bacteria 240724
157 Ga0209281_1000232 3300027111 Bacteria 117627
158 Ga0209281_1000254 3300027111 Bacteria 105570
159 Ga0209281_1000480 3300027111 Bacteria 55767
160 Ga0209281_1000492 3300027111 Bacteria 53875
161 Ga0209281_1000907 3300027111 Bacteria 24756
162 Ga0209281_1001298 3300027111 Bacteria 15965
163 Ga0209281_1010341 3300027111 Bacteria 2141
164 Ga0209371_1000001 3300027312 Bacteria 2771503
165 Ga0209371_1000026 3300027312 Bacteria 449205
166 Ga0209371_1000104 3300027312 Bacteria 148080
167 Ga0209371_1001037 3300027312 Bacteria 21018
168 Ga0209371_1001081 3300027312 Bacteria 20361
169 Ga0209371_1001301 3300027312 Bacteria 17502
170 Ga0209371_1001890 3300027312 Bacteria 12844
171 Ga0209371_1002344 3300027312 Bacteria 10768
172 Ga0209371_1006582 3300027312 Bacteria 4266
173 Ga0207428_10071014 3300027907 Unclassified 2735
174 Ga0207428_10281272 3300027907 Bacteria 1235
175 Ga0268266_10000165 3300028379 Bacteria 122830
176 Ga0268266_10000531 3300028379 Bacteria 53279
177 Ga0268264_10063432 3300028381 Bacteria 3106
178 Ga0268256_1000001 3300030500 Bacteria 2771065
179 Ga0268256_1000003 3300030500 Bacteria 1289401
180 Ga0268256_1000017 3300030500 Bacteria 600718
181 Ga0268256_1000746 3300030500 Bacteria 23822
182 Ga0268256_1000822 3300030500 Bacteria 22192
183 Ga0268256_1001360 3300030500 Bacteria 14876
184 Ga0268256_1002923 3300030500 Bacteria 8160
185 Ga0268256_1006585 3300030500 Bacteria 4288
186 Ga0268256_1033004 3300030500 Bacteria 1227
187 Ga0265316_10137983 3300031344 Bacteria 1834
188 Ga0316579_10067366 3300031691 Bacteria 1692
189 Ga0307410_10147092 3300031852 Bacteria 1750
190 Ga0316574_0133240 3300035398 Bacteria 1599
191 Ga0373937_0347475 3300036401 Bacteria 1405
192 Ga0436365_1279401 3300039437 Bacteria 294819
193 Ga0439438_000020 3300041405 Bacteria 111381
194 Ga0439438_000284 3300041405 Bacteria 22767
195 Ga0439447_000561 3300041407 Bacteria 13808
196 Ga0451853_0338586 3300041512 Bacteria 3993
197 Ga0439432_001067 3300042006 Bacteria 10427
198 Ga0439432_006169 3300042006 Bacteria 4293
199 Ga0439452_000003 3300042010 Bacteria 942815
200 Ga0439452_000038 3300042010 Bacteria 149746
201 Ga0439452_000040 3300042010 Bacteria 143490
202 Ga0439452_000362 3300042010 Bacteria 27827
203 Ga0439452_001669 3300042010 Bacteria 8744
204 Ga0450902_001901 3300042137 Bacteria 2902
205 Ga0439464_0008918 3300042439 Bacteria 2631
206 Ga0451577_0000137 3300042876 Bacteria 163955
207 Ga0466981_0000011 3300044669 Bacteria 132904
208 Ga0453684_0000014 3300044712 Bacteria 993311
209 Ga0453684_0054530 3300044712 Bacteria 5207
210 Ga0451576_0319090 3300045051 Bacteria 1626
211 Ga0495627_000136 3300046453 Bacteria 87662
212 Ga0495591_000265 3300046458 Bacteria 49660
213 Ga0495591_001083 3300046458 Bacteria 18143
214 Ga0495591_008109 3300046458 Bacteria 4343
215 Ga0495638_0007922 3300046460 Bacteria 7578
216 Ga0495650_0000033 3300046471 Bacteria 412188
217 Ga0495650_0000205 3300046471 Bacteria 128197
218 Ga0495607_0022953 3300046501 Bacteria 3911
219 Ga0495606_0000296 3300046507 Bacteria 85795
220 Ga0495616_0212932 3300046513 Bacteria 844
221 Ga0495620_0003155 3300046515 Bacteria 9456
222 Ga0495644_0029716 3300046523 Bacteria 2064
223 Ga0495648_0023845 3300046524 Bacteria 4179
224 Ga0495654_0000020 3300046530 Bacteria 284814
225 Ga0495654_0000386 3300046530 Bacteria 38102
226 Ga0495654_0024272 3300046530 Bacteria 3135
227 Ga0495654_0025861 3300046530 Bacteria 3022
228 Ga0495597_0000053 3300046542 Bacteria 95455
229 Ga0495625_0008056 3300046660 Bacteria 9037
230 Ga0495588_0005827 3300046674 Bacteria 5512
231 Ga0495649_0001250 3300046694 Bacteria 19570
232 Ga0495649_0006867 3300046694 Bacteria 7046
233 Ga0495649_0013724 3300046694 Bacteria 4666
234 Ga0495589_0000006 3300046794 Bacteria 303635
235 Ga0495589_0003680 3300046794 Bacteria 8281
236 Ga0495660_0000011 3300046810 Bacteria 361397
237 Ga0495672_0000004 3300047320 Bacteria 631810
238 Ga0495672_0000027 3300047320 Bacteria 325651
239 Ga0495679_000080 3300047446 Bacteria 90450
240 Ga0495679_001546 3300047446 Bacteria 12991
241 Ga0495679_055275 3300047446 Bacteria 1179
242 Ga0495673_0000023 3300047469 Bacteria 539904
243 Ga0495673_0000513 3300047469 Bacteria 40915
244 Ga0495686_0006144 3300047472 Bacteria 9290
245 Ga0496100_0017856 3300048903 Bacteria 4197
246 Ga0496101_0088432 3300048904 Bacteria 2301
247 Ga0496103_0073716 3300048906 Bacteria 2139
248 Ga0496104_0000459 3300048907 Bacteria 35096
249 Ga0496104_0393773 3300048907 Bacteria 1297
250 Ga0496105_0010642 3300048908 Bacteria 7237
251 Ga0496105_0039231 3300048908 Bacteria 3903
252 Ga0496113_0020048 3300048916 Bacteria 4693
253 Ga0496116_0000031 3300048919 Bacteria 420043
254 Ga0496116_0000170 3300048919 Bacteria 131308
255 Ga0496116_0004763 3300048919 Bacteria 12802
256 Ga0496116_0006792 3300048919 Bacteria 10294
257 Ga0496116_0124745 3300048919 Bacteria 1481
258 Ga0496117_0000517 3300048920 Bacteria 63669
259 Ga0496117_0001239 3300048920 Bacteria 38198
260 Ga0496117_0001926 3300048920 Bacteria 27685
261 Ga0496117_0003323 3300048920 Bacteria 18785
262 Ga0496117_0018075 3300048920 Bacteria 5860
263 Ga0496117_0050640 3300048920 Bacteria 2943
264 Ga0496118_0000428 3300048921 Bacteria 69913
265 Ga0496118_0002879 3300048921 Bacteria 22438
266 Ga0496118_0015886 3300048921 Bacteria 6938
267 Ga0496118_0024858 3300048921 Bacteria 5156
268 Ga0496118_0145974 3300048921 Bacteria 1489
269 Ga0496119_0000062 3300048922 Bacteria 171150
270 Ga0496119_0000078 3300048922 Bacteria 140556
271 Ga0496119_0000280 3300048922 Bacteria 71494
272 Ga0496119_0001515 3300048922 Bacteria 27758
273 Ga0496119_0004726 3300048922 Bacteria 13384
274 Ga0496119_0015003 3300048922 Bacteria 6008
275 Ga0496119_0026063 3300048922 Bacteria 4063
276 Ga0496119_0131213 3300048922 Bacteria 1365
277 Ga0496119_0166196 3300048922 Bacteria 1168
278 Ga0496119_0174204 3300048922 Bacteria 1133
279 Ga0496120_0000009 3300048923 Bacteria 386727
280 Ga0496120_0000228 3300048923 Bacteria 96403
281 Ga0496120_0000255 3300048923 Bacteria 89200
282 Ga0496120_0000265 3300048923 Bacteria 87441
283 Ga0496120_0000460 3300048923 Bacteria 64148
284 Ga0496120_0003079 3300048923 Bacteria 15719
285 Ga0496120_0011577 3300048923 Bacteria 6058
286 Ga0496120_0021820 3300048923 Bacteria 4038
287 Ga0496120_0022517 3300048923 Bacteria 3961
288 Ga0496120_0038629 3300048923 Bacteria 2823
289 Ga0496121_0002308 3300048924 Bacteria 29566
290 Ga0496121_0020898 3300048924 Bacteria 6446
291 Ga0496121_0111423 3300048924 Bacteria 2086
292 Ga0496121_0181639 3300048924 Unclassified 1518
293 Ga0496122_0000145 3300048925 Bacteria 165864
294 Ga0496122_0000947 3300048925 Bacteria 52629
295 Ga0496122_0001097 3300048925 Bacteria 46853
296 Ga0496122_0003898 3300048925 Bacteria 19114
297 Ga0496122_0013052 3300048925 Bacteria 8182
298 Ga0496122_0114689 3300048925 Bacteria 1757
299 Ga0496122_0185362 3300048925 Bacteria 1235
300 Ga0496123_0000171 3300048926 Bacteria 130780
301 Ga0496123_0000281 3300048926 Bacteria 100416
302 Ga0496123_0001333 3300048926 Bacteria 34880
303 Ga0496123_0002196 3300048926 Bacteria 24830
304 Ga0496123_0015399 3300048926 Bacteria 6273
305 Ga0496123_0035640 3300048926 Bacteria 3541
306 Ga0496123_0113000 3300048926 Bacteria 1547
307 Ga0496123_0150522 3300048926 Bacteria 1256
308 Ga0496124_0000122 3300048927 Bacteria 161741
309 Ga0496124_0000217 3300048927 Bacteria 112197
310 Ga0496124_0000465 3300048927 Bacteria 70109
311 Ga0496124_0001237 3300048927 Bacteria 39228
312 Ga0496124_0026357 3300048927 Bacteria 5242
313 Ga0496124_0031879 3300048927 Bacteria 4661
314 Ga0496124_0037293 3300048927 Bacteria 4229
315 Ga0496125_0000413 3300048928 Bacteria 79797
316 Ga0496125_0001559 3300048928 Bacteria 32689
317 Ga0496125_0011587 3300048928 Bacteria 8808
318 Ga0496125_0011939 3300048928 Bacteria 8653
319 Ga0496125_0157668 3300048928 Bacteria 1547
320 Ga0496126_0041517 3300048929 Bacteria 4256
321 Ga0496126_0041603 3300048929 Bacteria 4250
322 Ga0496126_0102729 3300048929 Bacteria 2498
323 Ga0496126_0184789 3300048929 Bacteria 1768
324 Ga0496126_0335787 3300048929 Bacteria 1239
325 Ga0496126_0405062 3300048929 Bacteria 1105
326 Ga0495678_000422 3300049459 Bacteria 42659
327 Ga0495682_0000004 3300049460 Bacteria 378337
328 Ga0501036_0096084 3300049572 Bacteria 2505
329 Ga0501038_0017403 3300049574 Bacteria 6497
330 Ga0501040_0036787 3300049576 Bacteria 3324
331 Ga0501042_0004793 3300049578 Bacteria 8641
332 Ga0501074_0027145 3300049590 Bacteria 4151
333 Ga0501075_0008310 3300049591 Bacteria 7237
334 Ga0501076_0024876 3300049592 Bacteria 4631
335 Ga0501081_0016022 3300049743 Bacteria 4950
336 Ga0501045_0125713 3300049824 Bacteria 1905
337 nmdc:mga00v17_37449_c1 3300050491 Bacteria 2897
338 nmdc:mga0k408_220418_c1 3300050493 Bacteria 1132
339 nmdc:mga09592_112824_c1 3300050508 Bacteria 2332
340 nmdc:mga09592_190299_c1 3300050508 Bacteria 1776
341 nmdc:mga0qj67_21647_c1 3300050509 Bacteria 4932
342 nmdc:mga06r32_107243_c1 3300050510 Bacteria 2745
343 nmdc:mga08y16_112955_c1 3300050511 Unclassified 2828
344 nmdc:mga08y16_16217_c1 3300050511 Bacteria 7833
345 nmdc:mga08y16_52175_c1 3300050511 Bacteria 4279
346 nmdc:mga0n895_21927_c1 3300050512 Bacteria 5982
347 nmdc:mga0rr50_101203_c1 3300050513 Unclassified 2265
348 nmdc:mga0rr50_72863_c1 3300050513 Bacteria 2624
349 nmdc:mga0a205_30583_c1 3300050515 Bacteria 5156
350 nmdc:mga0a205_43292_c1 3300050515 Bacteria 4342
351 Ga0500621_000001 3300053126 Bacteria 1049698
352 Ga0501084_0023541 3300054114 Bacteria 5138
353 2506577003 2506520007 Bacteria 5442880
354 2506582141 2506520008 Bacteria 5443009
355 2508850975 2508501071 Bacteria 5454741
356 2547697560 2547132181 Bacteria 4945084
357 2555259502 2554235234 Bacteria 5762085
358 2562466206 2561511199 Bacteria 5155034
359 2599412083 2599185169 Bacteria 5441380
360 2601525261 2600255254 Bacteria 5281859
361 2601530448 2600255255 Bacteria 5282785
362 2601531657 2600255256 Bacteria 5597742
363 2601537029 2600255257 Bacteria 5597196
364 2601616948 2600255280 Bacteria 5292309
365 2601621705 2600255281 Bacteria 5288753
366 2601644883 2600255287 Bacteria 5210468
367 2601650571 2600255288 Bacteria 5282738
368 2601655029 2600255289 Bacteria 5281907
369 2601660304 2600255290 Bacteria 5282218
370 2601665147 2600255291 Bacteria 5217298
371 2601697762 2600255298 Bacteria 5215185
372 2601703150 2600255299 Bacteria 5218662
373 2601708151 2600255300 Bacteria 5287774
374 2601713244 2600255301 Bacteria 5280532
375 2601718588 2600255302 Bacteria 5288235
376 2601723311 2600255303 Bacteria 5219315
377 2601728179 2600255304 Bacteria 5283973
378 2601733536 2600255305 Bacteria 5282329
379 2601738163 2600255306 Bacteria 5281613
380 2601742286 2600255307 Bacteria 5439064
381 2601753500 2600255309 Bacteria 5431045
382 2601755375 2600255310 Bacteria 5600903
383 2601760742 2600255311 Bacteria 5598766
384 2602020113 2600255392 Bacteria 5437392
385 2603639214 2602042046 Bacteria 5483348
386 2603643653 2602042047 Bacteria 4697674
387 2603661943 2602042052 Bacteria 5215873
388 2603666841 2602042053 Bacteria 5214361
389 2603700236 2602042066 Bacteria 4423871
390 2603704226 2602042067 Bacteria 4863713
391 2603840649 2602042103 Bacteria 5284714
392 2603845689 2602042104 Bacteria 5281639
393 2603850762 2602042105 Bacteria 5282303
394 2603855866 2602042106 Bacteria 5282744
395 2603866390 2602042109 Bacteria 5152801
396 2603873447 2602042110 Bacteria 5283285
397 2603877503 2602042111 Bacteria 5212080
398 2606050591 2603880178 Bacteria 5283018
399 2606071273 2603880184 Bacteria 5217896
400 2606148275 2603880202 Bacteria 5284684
401 2606178516 2603880211 Bacteria 5284226
402 2609912554 2609459761 Bacteria 5513740
403 2637226831 2636415599 Bacteria 5718434
404 2656279374 2654587920 Bacteria 5475511
405 2671102135 2667528172 Bacteria 5170840
406 2671585279 2671180115 Bacteria 5353919
407 2676407017 2675903046 Bacteria 5451247
408 2681995987 2681812866 Bacteria 4552357
409 2682009006 2681812869 Bacteria 5014465
410 2689443405 2687453601 Bacteria 5546041
411 2712470614 2711768156 Bacteria 4471618
412 2715498742 2713897090 Bacteria 3353799
413 2753854835 2751185917 Bacteria 4551186
414 2765587700 2765235842 Bacteria 4799256
415 2772437532 2772190666 Bacteria 5117644
416 2775541900 2775506706 Bacteria 4873073
417 2777022555 2775507074 Bacteria 5532402
418 2792313626 2791355010 Bacteria 4864581
419 2793406626 2791355275 Bacteria 4429597
420 2807179769 2806310673 Bacteria 4801221
421 2813730258 2811995292 Bacteria 5303342
422 2814697848 2814123068 Bacteria 5687681
423 2821118615 2821118458 Bacteria 4714306
424 2823377184 2823373977 Bacteria 4779415
425 2847088814 2847085930 Bacteria 5070450
426 2852103465 2852103415 Bacteria 5193810
427 2855021100 2855020534 Bacteria 3204685
428 2869552815 2869551831 Bacteria 5474685
429 2884090148 2884086401 Bacteria 5005459
430 2888367551 2888366609 Bacteria 5155009
431 2891672998 2891670763 Bacteria 4967099
432 2904515098 2904513164 Bacteria 5476410
433 2908671344 2908669403 Bacteria 5740494
434 2919109942 2919108558 Bacteria 5897419
435 2923638250 2923634449 Bacteria 4753480
436 2927835313 2927833300 Bacteria 4923934
437 2932407475 2932406140 Bacteria 5134491
438 2935629630 2935625433 Bacteria 5042964
439 2937542809 2937539931 Bacteria 4639830
440 2937972065 2937967321 Bacteria 5094075
441 2939570801 2939568625 Bacteria 4542555
442 2939574970 2939573065 Bacteria 4926053
443 2939579385 2939577877 Bacteria 5132791
444 2939610858 2939607340 Bacteria 4719256
445 2939622498 2939617950 Bacteria 4820956
446 2939644907 2939642701 Bacteria 4475280
447 2945879416 2945874760 Bacteria 5527237
448 2969083815 2969079654 Bacteria 5439582
449 2971825284 2971820967 Bacteria 5823634
450 2974313369 2974310843 Bacteria 4947816
451 2974437267 2974435778 Bacteria 4876478
452 2984560919 2984559226 Bacteria 5683096
453 2984598993 2984595703 Bacteria 5682994
454 3000380228 3000376612 Bacteria 4705565
455 640936555 640753048 Bacteria 5495657
456 8004594234 8004592986 Bacteria 5122074
457 8018224037 8018221730 Bacteria 4616064
458 8018406590 8018405270 Bacteria 4978981
459 8019508702 8019504834 Bacteria 4819156
460 8054848792 8054844752 Bacteria 4450330
461 8054849356 8054849141 Bacteria 5232694
462 8055090153 8055087960 Bacteria 4784273
463 8055096407 8055092621 Bacteria 4873875
464 8055101419 8055097453 Bacteria 4865496
465 8055697127 8055693939 Bacteria 4772047
466 8057306347 8057304971 Bacteria 4649742
467 Ga0157372_10012380
468 JGI25162J39368_1001294
469 JGI25152J39213_1000504
470 rootH2_10067781
471 Ga0058692_1024138
472 Ga0058692_1027150
473 Ga0065704_10002155
474 Ga0065704_10072533
475 Ga0065704_10077141
476 Ga0065712_10067763
477 Ga0070658_10002863
478 Ga0070658_10007304
479 Ga0070670_100045945
480 Ga0068869_100106867
481 Ga0070660_100218506
482 Ga0070661_100261212
483 Ga0070675_100004952
484 Ga0070675_100033916
485 Ga0070713_100000385
486 Ga0070707_100023744
487 Ga0070698_100130477
488 Ga0070679_100057650
489 Ga0070665_100001966
490 Ga0068857_100001205
491 Ga0068857_100261302
492 Ga0068859_100328816
493 Ga0068863_100070135
494 Ga0068858_100032486
495 Ga0068860_100063111
496 Ga0068862_100162134
497 Ga0068862_100256772
498 Ga0075364_10107915
499 Ga0075431_100000337
500 Ga0075433_10014495
501 Ga0075433_10017621
502 Ga0075434_100019704
503 Ga0075429_100017595
504 Ga0075429_100095627
505 Ga0097620_100328836
506 Ga0079104_1000166
507 Ga0079104_1000174
508 Ga0079104_1000192
509 Ga0079104_1000578
510 Ga0079104_1001233
511 Ga0079104_1004622
512 Ga0079104_1004766
513 Ga0079104_1029048
514 Ga0075435_100053804
515 Ga0075435_100083623
516 Ga0105251_10000073
517 Ga0105251_10000254
518 Ga0105251_10000582
519 Ga0105251_10000945
520 Ga0105251_10001093
521 Ga0105251_10002540
522 Ga0105251_10002927
523 Ga0105244_10000041
524 Ga0105244_10000105
525 Ga0105244_10000315
526 Ga0105244_10000393
527 Ga0105244_10001332
528 Ga0105244_10008026
529 Ga0105244_10008717
530 Ga0105244_10014896
531 Ga0105250_10000052
532 Ga0105250_10000150
533 Ga0105250_10001806
534 Ga0105250_10001924
535 Ga0105240_10233930
536 Ga0111539_10007018
537 Ga0111539_10007070
538 Ga0105247_10000191
539 Ga0114129_10198228
540 Ga0105243_10008113
541 Ga0105241_10000004
542 Ga0105248_10116986
543 Ga0105237_10020561
544 Ga0105237_10130987
545 Ga0105238_10243555
546 Ga0105249_10063309
547 Ga0105239_10095578
548 Ga0157373_10014395
549 Ga0157371_10001405
550 Ga0157371_10181645
551 Ga0157370_10002956
552 Ga0157370_10644254
553 Ga0157369_10025595
554 Ga0157372_10110465
555 Ga0157372_10413971
556 Ga0157375_10043734
557 Ga0182008_10003637
558 Ga0157377_10014009
559 Ga0157379_10002070
560 Ga0182006_1000020
561 Ga0183366_1001
562 Ga0183370_1001
563 Ga0183369_1001
564 Ga0183368_1001
565 Ga0163161_10000004
566 Ga0163161_10105637
567 Ga0213876_10000025
568 Ga0209129_1000015
569 Ga0207696_1000003
570 Ga0207696_1000007
571 Ga0207696_1000033
572 Ga0207696_1000420
573 Ga0207696_1001427
574 Ga0207696_1004377
575 Ga0207655_1000001
576 Ga0207655_1000011
577 Ga0207655_1000087
578 Ga0207655_1000121
579 Ga0207655_1000226
580 Ga0207655_1000404
581 Ga0207655_1003806
582 Ga0207655_1005258
583 Ga0207655_1008424
584 Ga0207655_1012604
585 Ga0207713_1000005
586 Ga0207713_1000038
587 Ga0207713_1000065
588 Ga0207713_1000108
589 Ga0207713_1000155
590 Ga0207713_1001646
591 Ga0207713_1003616
592 Ga0207713_1006190
593 Ga0207710_10000016
594 Ga0207688_10161114
595 Ga0207680_10012051
596 Ga0207654_10000006
597 Ga0207654_10237666
598 Ga0207671_10018012
599 Ga0207657_10028108
600 Ga0207652_10038954
601 Ga0207646_10022560
602 Ga0207694_10172761
603 Ga0207659_10020135
604 Ga0207659_10024594
605 Ga0207700_10000031
606 Ga0207709_10004933
607 Ga0207691_10382275
608 Ga0207711_10016847
609 Ga0207667_10066530
610 Ga0207667_10178835
611 Ga0207712_10016559
612 Ga0207658_10055294
613 Ga0207658_10079321
614 Ga0207703_10015669
615 Ga0207641_10023728
616 Ga0207674_10000067
617 Ga0207674_10084902
618 Ga0209281_1000001
619 Ga0209281_1000008
620 Ga0209281_1000021
621 Ga0209281_1000075
622 Ga0209281_1000093
623 Ga0209281_1000232
624 Ga0209281_1000254
625 Ga0209281_1000480
626 Ga0209281_1000492
627 Ga0209281_1000907
628 Ga0209281_1001298
629 Ga0209281_1010341
630 Ga0209371_1000001
631 Ga0209371_1000026
632 Ga0209371_1000104
633 Ga0209371_1001037
634 Ga0209371_1001081
635 Ga0209371_1001301
636 Ga0209371_1001890
637 Ga0209371_1002344
638 Ga0209371_1006582
639 Ga0207428_10071014
640 Ga0207428_10281272
641 Ga0268266_10000165
642 Ga0268266_10000531
643 Ga0268264_10063432
644 Ga0268256_1000001
645 Ga0268256_1000003
646 Ga0268256_1000017
647 Ga0268256_1000746
648 Ga0268256_1000822
649 Ga0268256_1001360
650 Ga0268256_1002923
651 Ga0268256_1006585
652 Ga0268256_1033004
653 Ga0265316_10137983
654 Ga0316579_10067366
655 Ga0307410_10147092
656 Ga0316574_0133240
657 Ga0373937_0347475
658 Ga0436365_1279401
659 Ga0439438_000020
660 Ga0439438_000284
661 Ga0439447_000561
662 Ga0451853_0338586
663 Ga0439432_001067
664 Ga0439432_006169
665 Ga0439452_000003
666 Ga0439452_000038
667 Ga0439452_000040
668 Ga0439452_000362
669 Ga0439452_001669
670 Ga0450902_001901
671 Ga0439464_0008918
672 Ga0451577_0000137
673 Ga0466981_0000011
674 Ga0453684_0000014
675 Ga0453684_0054530
676 Ga0451576_0319090
677 Ga0495627_000136
678 Ga0495591_000265
679 Ga0495591_001083
680 Ga0495591_008109
681 Ga0495638_0007922
682 Ga0495650_0000033
683 Ga0495650_0000205
684 Ga0495607_0022953
685 Ga0495606_0000296
686 Ga0495616_0212932
687 Ga0495620_0003155
688 Ga0495644_0029716
689 Ga0495648_0023845
690 Ga0495654_0000020
691 Ga0495654_0000386
692 Ga0495654_0024272
693 Ga0495654_0025861
694 Ga0495597_0000053
695 Ga0495625_0008056
696 Ga0495588_0005827
697 Ga0495649_0001250
698 Ga0495649_0006867
699 Ga0495649_0013724
700 Ga0495589_0000006
701 Ga0495589_0003680
702 Ga0495660_0000011
703 Ga0495672_0000004
704 Ga0495672_0000027
705 Ga0495679_000080
706 Ga0495679_001546
707 Ga0495679_055275
708 Ga0495673_0000023
709 Ga0495673_0000513
710 Ga0495686_0006144
711 Ga0496100_0017856
712 Ga0496101_0088432
713 Ga0496103_0073716
714 Ga0496104_0000459
715 Ga0496104_0393773
716 Ga0496105_0010642
717 Ga0496105_0039231
718 Ga0496113_0020048
719 Ga0496116_0000031
720 Ga0496116_0000170
721 Ga0496116_0004763
722 Ga0496116_0006792
723 Ga0496116_0124745
724 Ga0496117_0000517
725 Ga0496117_0001239
726 Ga0496117_0001926
727 Ga0496117_0003323
728 Ga0496117_0018075
729 Ga0496117_0050640
730 Ga0496118_0000428
731 Ga0496118_0002879
732 Ga0496118_0015886
733 Ga0496118_0024858
734 Ga0496118_0145974
735 Ga0496119_0000062
736 Ga0496119_0000078
737 Ga0496119_0000280
738 Ga0496119_0001515
739 Ga0496119_0004726
740 Ga0496119_0015003
741 Ga0496119_0026063
742 Ga0496119_0131213
743 Ga0496119_0166196
744 Ga0496119_0174204
745 Ga0496120_0000009
746 Ga0496120_0000228
747 Ga0496120_0000255
748 Ga0496120_0000265
749 Ga0496120_0000460
750 Ga0496120_0003079
751 Ga0496120_0011577
752 Ga0496120_0021820
753 Ga0496120_0022517
754 Ga0496120_0038629
755 Ga0496121_0002308
756 Ga0496121_0020898
757 Ga0496121_0111423
758 Ga0496121_0181639
759 Ga0496122_0000145
760 Ga0496122_0000947
761 Ga0496122_0001097
762 Ga0496122_0003898
763 Ga0496122_0013052
764 Ga0496122_0114689
765 Ga0496122_0185362
766 Ga0496123_0000171
767 Ga0496123_0000281
768 Ga0496123_0001333
769 Ga0496123_0002196
770 Ga0496123_0015399
771 Ga0496123_0035640
772 Ga0496123_0113000
773 Ga0496123_0150522
774 Ga0496124_0000122
775 Ga0496124_0000217
776 Ga0496124_0000465
777 Ga0496124_0001237
778 Ga0496124_0026357
779 Ga0496124_0031879
780 Ga0496124_0037293
781 Ga0496125_0000413
782 Ga0496125_0001559
783 Ga0496125_0011587
784 Ga0496125_0011939
785 Ga0496125_0157668
786 Ga0496126_0041517
787 Ga0496126_0041603
788 Ga0496126_0102729
789 Ga0496126_0184789
790 Ga0496126_0335787
791 Ga0496126_0405062
792 Ga0495678_000422
793 Ga0495682_0000004
794 Ga0501036_0096084
795 Ga0501038_0017403
796 Ga0501040_0036787
797 Ga0501042_0004793
798 Ga0501074_0027145
799 Ga0501075_0008310
800 Ga0501076_0024876
801 Ga0501081_0016022
802 Ga0501045_0125713
803 nmdc:mga00v17_37449_c1
804 nmdc:mga0k408_220418_c1
805 nmdc:mga09592_112824_c1
806 nmdc:mga09592_190299_c1
807 nmdc:mga0qj67_21647_c1
808 nmdc:mga06r32_107243_c1
809 nmdc:mga08y16_112955_c1
810 nmdc:mga08y16_16217_c1
811 nmdc:mga08y16_52175_c1
812 nmdc:mga0n895_21927_c1
813 nmdc:mga0rr50_101203_c1
814 nmdc:mga0rr50_72863_c1
815 nmdc:mga0a205_30583_c1
816 nmdc:mga0a205_43292_c1
817 Ga0500621_000001
818 Ga0501084_0023541
819 2506577003
820 2506582141
821 2508850975
822 2547697560
823 2555259502
824 2562466206
825 2599412083
826 2601525261
827 2601530448
828 2601531657
829 2601537029
830 2601616948
831 2601621705
832 2601644883
833 2601650571
834 2601655029
835 2601660304
836 2601665147
837 2601697762
838 2601703150
839 2601708151
840 2601713244
841 2601718588
842 2601723311
843 2601728179
844 2601733536
845 2601738163
846 2601742286
847 2601753500
848 2601755375
849 2601760742
850 2602020113
851 2603639214
852 2603643653
853 2603661943
854 2603666841
855 2603700236
856 2603704226
857 2603840649
858 2603845689
859 2603850762
860 2603855866
861 2603866390
862 2603873447
863 2603877503
864 2606050591
865 2606071273
866 2606148275
867 2606178516
868 2609912554
869 2637226831
870 2656279374
871 2671102135
872 2671585279
873 2676407017
874 2681995987
875 2682009006
876 2689443405
877 2712470614
878 2715498742
879 2753854835
880 2765587700
881 2772437532
882 2775541900
883 2777022555
884 2792313626
885 2793406626
886 2807179769
887 2813730258
888 2814697848
889 2821118615
890 2823377184
891 2847088814
892 2852103465
893 2855021100
894 2869552815
895 2884090148
896 2888367551
897 2891672998
898 2904515098
899 2908671344
900 2919109942
901 2923638250
902 2927835313
903 2932407475
904 2935629630
905 2937542809
906 2937972065
907 2939570801
908 2939574970
909 2939579385
910 2939610858
911 2939622498
912 2939644907
913 2945879416
914 2969083815
915 2971825284
916 2974313369
917 2974437267
918 2984560919
919 2984598993
920 3000380228
921 640936555
922 8004594234
923 8018224037
924 8018406590
925 8019508702
926 8054848792
927 8054849356
928 8055090153
929 8055096407
930 8055101419
931 8055697127
932 8057306347

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00480

ROK

ROK family

31

331

0.99

PF02685

Glucokinase

Glucokinase

32

275

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oqb-assembly1.cif.gz_B crystal structure of the n-terminal domain of coactivator-associated methyltransferase 1 (carm1) 0.9116 3 29
7p9l-assembly1.cif.gz_BBB n-acetylglucosamine kinase from plesiomonas shigelloides compexed with alpha-n-acetylglucosamine-6-phosphate 0.8781 2 285
3vgk-assembly2.cif.gz_B crystal structure of a rok family glucokinase from streptomyces griseus 0.8646 1 282
3vov-assembly1.cif.gz_B crystal structure of rok hexokinase from thermus thermophilus 0.8625 2 285
6ea8-assembly5.cif.gz_I-4 structure of vacv poxin in pre-reactive state with nonhydrolyzable 2'3' cgamp 0.8602 5 29
ID Description Score Start End Superfamily
af_P23917_1_103_1.10.520.10 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1; 1.001 1 103 1.10.520.10
af_P23917_1_103_1.10.520.10 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1; 0.9914 1 103 1.10.520.10
af_P23917_121_283_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9857 128 270 3.30.420.40
af_P23917_104_294_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9813 104 280 3.30.420.40
af_K7VRG2_61_286_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9516 3 30 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A3D5M815-F1-model_v4 deleted 1.006 1 101
AF-A0A2N4Z0S0-F1-model_v4 Fructokinase (EC 2.7.1.4) 1.001 1 92 GO:0008865
AF-A0A381QKT4-F1-model_v4 ROK family protein 0.9973 1 103
AF-A0A081RUE6-F1-model_v4 Transcriptional regulator/sugar kinase 0.997 2 106 GO:0004396
AF-A0A509CR97-F1-model_v4 deleted 0.9958 1 104

Map