F449700

General Info

Members Datasets Scaffolds Average Seq Length
466 263 932 212

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0000514|Ga0395905_0000514_49494_50195
Length 233
Sequence MMSSRSLAEVSMSDFPADIYTEPSDIDVFTLDNLGPLRRMAGVWEGRRGLDVKPKAEGPRKQAYVERIELQPVDPVTNGPQLLYGLRYHVHVVKPDQVKTYHDQVGYWLWEPATGTVIQTLAIPRGQIAMASGQAAADATSFELVATLGSQNYGICSNPFLEYGFKTVEYRIKVTINEDGTWSYDEDTVMMIKGKDEPFHHTDRNLLSKVAEPTPNPLALQWAAAKQSEKGSA

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
52 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
69 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
72 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
73 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
74 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
75 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
114 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
115 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
116 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
130 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
131 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
132 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
134 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
135 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
136 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
150 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
151 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
154 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
157 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
158 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
159 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
164 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
165 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
166 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
167 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
168 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
169 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
170 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
173 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
174 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
175 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
176 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
177 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
178 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
179 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
183 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
184 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
185 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
186 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
189 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
190 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
191 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
192 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
196 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
197 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
200 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
201 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
205 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
206 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
207 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
208 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
209 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
210 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
211 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
217 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
218 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
219 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
220 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
221 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
222 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
227 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
233 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
237 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
238 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
239 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
241 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
242 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
243 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
244 2643221638 Duganella sp. Root336D2 Isolate Unclassified
245 2643221645 Massilia sp. Root351 Isolate Unclassified
246 2643221664 Massilia sp. Root418 Isolate Unclassified
247 2738541280 Massilia sp. GV090 Isolate Unclassified
248 2738541297 Duganella sp. GV083 Isolate Unclassified
249 2738541300 Massilia sp. GV016 Isolate Unclassified
250 2738541357 Duganella sp. GV053 Isolate Unclassified
251 2738543003 Duganella sp. GV066 Isolate Unclassified
252 2738543018 Massilia sp. GV045 Isolate Unclassified
253 2738543026 Duganella sp. GV089 Isolate Unclassified
254 2738543029 Duganella sp. GV039 Isolate Unclassified
255 2738543030 Massilia sp. GV097 Isolate Unclassified
256 2821131069 Duganella sp. 1224 Isolate Unclassified
257 2842711865 Duganella sp. R-73148 Isolate Unclassified
258 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
259 2857558681 Duganella sp. R-74565 Isolate Unclassified
260 2857564685 Duganella sp. R-74599 Isolate Unclassified
261 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
262 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
263 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.06
Metatranscriptomes 0
Isolates 4.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.32
Nodule 0.43
Rhizoplane 1.5
Rhizosphere 65.24
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0000514 3300037471 Bacteria 52950
2 JGI25158J39367_1000433 3300002739 Bacteria 8676
3 JGI25158J39367_1000642 3300002739 Bacteria 6890
4 JGI25152J39213_1000105 3300002773 Bacteria 58863
5 JGI25150J39212_1000374 3300002774 Bacteria 21577
6 JGI25150J39212_1004353 3300002774 Bacteria 3162
7 JGI25159J45721_1000762 3300002987 Bacteria 13974
8 JGI25159J45721_1001061 3300002987 Bacteria 11738
9 JGI25159J45721_1001736 3300002987 Bacteria 8781
10 JGI25160J50197_1001081 3300003354 Bacteria 13974
11 JGI25161J50226_1000453 3300003374 Bacteria 19004
12 JGI25161J50226_1000724 3300003374 Bacteria 12794
13 Ga0055529_1000842 3300003763 Bacteria 18017
14 Ga0055526_1000001 3300003771 Bacteria 669703
15 Ga0055526_1000044 3300003771 Bacteria 123028
16 Ga0055526_1000121 3300003771 Bacteria 68852
17 Ga0055526_1005778 3300003771 Bacteria 6973
18 Ga0055537_1000179 3300003773 Bacteria 47132
19 Ga0055537_1002355 3300003773 Bacteria 6417
20 Ga0055537_1009830 3300003773 Bacteria 2069
21 Ga0055537_1013095 3300003773 Bacteria 1576
22 Ga0055524_1000008 3300003775 Bacteria 297761
23 Ga0055524_1003549 3300003775 Bacteria 7533
24 Ga0055524_1007473 3300003775 Bacteria 4633
25 Ga0055524_1022867 3300003775 Bacteria 2028
26 Ga0055524_1030376 3300003775 Bacteria 1577
27 Ga0055534_1000495 3300003784 Bacteria 21714
28 Ga0055534_1002232 3300003784 Bacteria 6854
29 Ga0055528_1000119 3300003790 Bacteria 62428
30 Ga0055530_10001373 3300003791 Bacteria 18061
31 Ga0055530_10002288 3300003791 Bacteria 12570
32 Ga0055530_10002362 3300003791 Bacteria 12255
33 Ga0055530_10044085 3300003791 Bacteria 1072
34 Ga0055531_10000001 3300003794 Bacteria 543586
35 Ga0055531_10000577 3300003794 Bacteria 31960
36 Ga0055531_10034459 3300003794 Bacteria 1606
37 Ga0055543_1000915 3300004625 Bacteria 13778
38 Ga0055543_1005198 3300004625 Bacteria 3368
39 Ga0065165_1000039 3300005262 Bacteria 208372
40 Ga0065165_1001994 3300005262 Bacteria 19150
41 Ga0065165_1019521 3300005262 Bacteria 2416
42 Ga0070677_10097995 3300005333 Bacteria 1287
43 Ga0068869_100264229 3300005334 Bacteria 1378
44 Ga0070680_100263286 3300005336 Bacteria 1459
45 Ga0068868_100027338 3300005338 Bacteria 4352
46 Ga0070675_100282177 3300005354 Unclassified 1460
47 Ga0070688_100109151 3300005365 Bacteria 1837
48 Ga0070659_100224779 3300005366 Bacteria 1550
49 Ga0070711_100061192 3300005439 Bacteria 2620
50 Ga0070711_100193944 3300005439 Bacteria 1563
51 Ga0070711_100319379 3300005439 Bacteria 1240
52 Ga0070708_100028362 3300005445 Bacteria 4817
53 Ga0070708_100051280 3300005445 Bacteria 3656
54 Ga0070708_100102743 3300005445 Bacteria 2619
55 Ga0070708_100567122 3300005445 Bacteria 1070
56 Ga0070685_10398007 3300005466 Bacteria 953
57 Ga0070706_100012860 3300005467 Bacteria 7747
58 Ga0070706_100109660 3300005467 Bacteria 2568
59 Ga0070706_100366306 3300005467 Bacteria 1343
60 Ga0070707_100117646 3300005468 Bacteria 2579
61 Ga0070707_100132263 3300005468 Bacteria 2426
62 Ga0070699_100028026 3300005518 Bacteria 4857
63 Ga0070699_100218664 3300005518 Bacteria 1697
64 Ga0070684_100368097 3300005535 Bacteria 1323
65 Ga0070697_100088421 3300005536 Bacteria 2558
66 Ga0070697_100116978 3300005536 Bacteria 2227
67 Ga0070697_100810016 3300005536 Bacteria 829
68 Ga0068853_100001996 3300005539 Bacteria 15071
69 Ga0068855_100074210 3300005563 Bacteria 3951
70 Ga0070664_100193046 3300005564 Bacteria 1815
71 Ga0068857_100019597 3300005577 Bacteria 5942
72 Ga0068857_100433342 3300005577 Bacteria 1227
73 Ga0068856_100074508 3300005614 Bacteria 3361
74 Ga0068859_100453382 3300005617 Bacteria 1379
75 Ga0068861_100148602 3300005719 Bacteria 1920
76 Ga0068863_100075810 3300005841 Bacteria 3182
77 Ga0068860_100493470 3300005843 Bacteria 1222
78 Ga0075364_10033118 3300006051 Bacteria 3325
79 Ga0070715_10008599 3300006163 Bacteria 3564
80 Ga0070716_100174065 3300006173 Bacteria 1407
81 Ga0075366_10017778 3300006195 Bacteria 4099
82 Ga0075366_10024860 3300006195 Bacteria 3494
83 Ga0075366_10277437 3300006195 Bacteria 1024
84 Ga0097621_100214579 3300006237 Bacteria 1675
85 Ga0075370_10001791 3300006353 Bacteria 9601
86 Ga0075370_10011909 3300006353 Bacteria 4582
87 Ga0075370_10117740 3300006353 Bacteria 1545
88 Ga0075433_10144710 3300006852 Bacteria 2113
89 Ga0075434_100105972 3300006871 Bacteria 2821
90 Ga0097620_100453389 3300006931 Bacteria 1379
91 Ga0099826_10000001 3300006948 Bacteria 1155201
92 Ga0105244_10012653 3300009036 Bacteria 4976
93 Ga0105240_10013078 3300009093 Bacteria 11423
94 Ga0114129_11162059 3300009147 Bacteria 963
95 Ga0105242_10032773 3300009176 Bacteria 4156
96 Ga0105248_10063055 3300009177 Bacteria 4160
97 Ga0105237_10170343 3300009545 Bacteria 2177
98 Ga0105238_10342593 3300009551 Bacteria 1483
99 Ga0105249_10221386 3300009553 Bacteria 1862
100 Ga0105239_10082983 3300010375 Bacteria 3529
101 Ga0157374_10100375 3300013296 Bacteria 2774
102 Ga0157378_10319146 3300013297 Bacteria 1509
103 Ga0163162_10599300 3300013306 Bacteria 1228
104 Ga0157375_10080510 3300013308 Bacteria 3295
105 Ga0157375_10346020 3300013308 Bacteria 1652
106 Ga0157375_10959511 3300013308 Bacteria 996
107 Ga0157379_10002612 3300014968 Bacteria 15142
108 Ga0163161_10054909 3300017792 Bacteria 2891
109 Ga0213872_10000001 3300021361 Bacteria 662532
110 Ga0213872_10000298 3300021361 Bacteria 42359
111 Ga0213872_10011901 3300021361 Bacteria 4108
112 Ga0213872_10014015 3300021361 Bacteria 3747
113 Ga0213872_10017423 3300021361 Bacteria 3320
114 Ga0209436_100049 3300025208 Bacteria 66162
115 Ga0209436_100093 3300025208 Bacteria 44019
116 Ga0209672_105915 3300025228 Bacteria 2048
117 Ga0209258_107918 3300025242 Bacteria 1538
118 Ga0207425_1000001 3300025245 Bacteria 2525432
119 Ga0207425_1000033 3300025245 Bacteria 245540
120 Ga0207425_1000159 3300025245 Bacteria 57245
121 Ga0207425_1018671 3300025245 Bacteria 1502
122 Ga0209646_1000054 3300025246 Bacteria 279447
123 Ga0209026_1003541 3300025250 Bacteria 5059
124 Ga0209026_1010849 3300025250 Bacteria 1675
125 Ga0209129_1000003 3300025258 Bacteria 903689
126 Ga0209129_1002851 3300025258 Bacteria 7988
127 Ga0209565_1000003 3300025263 Bacteria 1099648
128 Ga0209565_1000162 3300025263 Bacteria 89049
129 Ga0209565_1000383 3300025263 Bacteria 37599
130 Ga0209565_1000474 3300025263 Bacteria 29679
131 Ga0209565_1003186 3300025263 Bacteria 5440
132 Ga0209565_1005728 3300025263 Bacteria 3577
133 Ga0209455_1000359 3300025272 Bacteria 42537
134 Ga0209673_1000003 3300025273 Bacteria 980859
135 Ga0209673_1023046 3300025273 Bacteria 2131
136 Ga0209130_1000084 3300025284 Bacteria 160070
137 Ga0209130_1000438 3300025284 Bacteria 44389
138 Ga0209130_1001623 3300025284 Bacteria 13881
139 Ga0209675_1000003 3300025291 Bacteria 1003982
140 Ga0209675_1000713 3300025291 Bacteria 22701
141 Ga0209675_1002356 3300025291 Bacteria 9756
142 Ga0209675_1003385 3300025291 Bacteria 7601
143 Ga0209675_1032517 3300025291 Bacteria 1220
144 Ga0209025_1009036 3300025294 Bacteria 7030
145 Ga0209564_1000002 3300025295 Bacteria 1636803
146 Ga0209564_1000011 3300025295 Bacteria 822327
147 Ga0209564_1000012 3300025295 Bacteria 792078
148 Ga0209564_1000095 3300025295 Bacteria 237896
149 Ga0209564_1005141 3300025295 Bacteria 7602
150 Ga0209564_1019883 3300025295 Bacteria 2487
151 Ga0209758_1000041 3300025297 Bacteria 410328
152 Ga0209050_1000011 3300025298 Bacteria 914037
153 Ga0209050_1000138 3300025298 Bacteria 173923
154 Ga0209050_1002638 3300025298 Bacteria 14724
155 Ga0209050_1009076 3300025298 Bacteria 5165
156 Ga0209256_1000005 3300025299 Bacteria 1315082
157 Ga0209256_1000068 3300025299 Bacteria 246064
158 Ga0209256_1000255 3300025299 Bacteria 94783
159 Ga0209256_1000295 3300025299 Bacteria 87239
160 Ga0209256_1002521 3300025299 Bacteria 14711
161 Ga0207426_1001590 3300025302 Bacteria 18203
162 Ga0209051_1008980 3300025303 Bacteria 5210
163 Ga0209257_1000003 3300025304 Bacteria 1702593
164 Ga0209257_1000033 3300025304 Bacteria 671006
165 Ga0209257_1006932 3300025304 Bacteria 7080
166 Ga0207696_1000087 3300025711 Bacteria 194367
167 Ga0207655_1068463 3300025728 Bacteria 1331
168 Ga0207692_10206639 3300025898 Bacteria 1157
169 Ga0207685_10010561 3300025905 Bacteria 2734
170 Ga0207684_10090914 3300025910 Bacteria 2601
171 Ga0207707_10121990 3300025912 Bacteria 2279
172 Ga0207671_10240207 3300025914 Bacteria 1423
173 Ga0207663_10168196 3300025916 Bacteria 1555
174 Ga0207663_10373219 3300025916 Bacteria 1085
175 Ga0207660_10161505 3300025917 Bacteria 1729
176 Ga0207646_10028340 3300025922 Bacteria 5099
177 Ga0207694_10223349 3300025924 Bacteria 1537
178 Ga0207690_10182794 3300025932 Bacteria 1580
179 Ga0207690_10244337 3300025932 Bacteria 1384
180 Ga0207689_10281307 3300025942 Bacteria 1378
181 Ga0207679_10330457 3300025945 Bacteria 1323
182 Ga0207677_10019953 3300026023 Bacteria 4059
183 Ga0207678_10160721 3300026067 Bacteria 1919
184 Ga0207708_10040618 3300026075 Bacteria 3546
185 Ga0207702_10113087 3300026078 Bacteria 2417
186 Ga0207641_10058824 3300026088 Bacteria 3272
187 Ga0207674_10221187 3300026116 Bacteria 1841
188 Ga0207675_100194386 3300026118 Bacteria 1947
189 Ga0209282_1000001 3300027666 Bacteria 2450367
190 Ga0268264_10259586 3300028381 Bacteria 1618
191 Ga0268264_10455138 3300028381 Bacteria 1241
192 Ga0265334_10000014 3300028573 Bacteria 154345
193 Ga0307515_10000067 3300028794 Bacteria 242978
194 Ga0307512_10038200 3300030522 Bacteria 4044
195 Ga0265330_10001738 3300031235 Bacteria 12261
196 Ga0265332_10001673 3300031238 Bacteria 12110
197 Ga0265328_10036141 3300031239 Unclassified 1825
198 Ga0265325_10003555 3300031241 Bacteria 10116
199 Ga0265329_10001775 3300031242 Bacteria 10254
200 Ga0265339_10072486 3300031249 Bacteria 1833
201 Ga0265331_10000810 3300031250 Bacteria 25854
202 Ga0265327_10003804 3300031251 Bacteria 13966
203 Ga0265327_10215604 3300031251 Bacteria 865
204 Ga0265316_10010782 3300031344 Bacteria 8303
205 Ga0307509_10214868 3300031507 Bacteria 1743
206 Ga0307408_100000530 3300031548 Bacteria 32976
207 Ga0307408_100003385 3300031548 Bacteria 10939
208 Ga0307408_100004073 3300031548 Bacteria 9969
209 Ga0307408_100004781 3300031548 Bacteria 9123
210 Ga0307408_100024052 3300031548 Bacteria 4155
211 Ga0307508_10176305 3300031616 Bacteria 1741
212 Ga0265314_10009258 3300031711 Bacteria 8342
213 Ga0265314_10015698 3300031711 Bacteria 6001
214 Ga0265342_10018868 3300031712 Bacteria 4459
215 Ga0307416_101104943 3300032002 Bacteria 897
216 Ga0307507_10226368 3300033179 Bacteria 1248
217 Ga0307510_10017896 3300033180 Bacteria 8348
218 Ga0307510_10068909 3300033180 Bacteria 3546
219 Ga0373934_0068843 3300035086 Bacteria 1414
220 Ga0373936_0003796 3300035113 Bacteria 5689
221 Ga0373945_0012638 3300035116 Bacteria 2807
222 Ga0373954_0000706 3300035118 Bacteria 12839
223 Ga0373956_0024794 3300035119 Bacteria 2588
224 Ga0373957_0066808 3300035120 Bacteria 1401
225 Ga0373955_0029396 3300035172 Bacteria 2857
226 Ga0373924_0131683 3300035410 Bacteria 1088
227 Ga0373927_0132516 3300035695 Bacteria 1628
228 Ga0373933_0008677 3300035724 Bacteria 5542
229 Ga0373933_0041605 3300035724 Bacteria 2713
230 Ga0373947_0001397 3300035725 Bacteria 14855
231 Ga0373937_0000660 3300036401 Bacteria 30186
232 Ga0373937_0001017 3300036401 Bacteria 23732
233 Ga0373925_0014609 3300037068 Bacteria 5673
234 Ga0373925_0053797 3300037068 Bacteria 3010
235 Ga0395899_0141163 3300037312 Bacteria 1714
236 Ga0395899_0459747 3300037312 Bacteria 832
237 Ga0395900_0038443 3300037418 Bacteria 4932
238 Ga0395900_0283430 3300037418 Bacteria 1648
239 Ga0395905_0434657 3300037471 Bacteria 1209
240 Ga0395901_0262586 3300038443 Bacteria 1797
241 Ga0436361_0067060 3300039447 Bacteria 222217
242 Ga0436361_0091769 3300039447 Bacteria 18361
243 Ga0436361_0099372 3300039447 Bacteria 18108
244 Ga0436361_0159469 3300039447 Bacteria 12975
245 Ga0436361_0419752 3300039447 Bacteria 7578
246 Ga0436361_0529332 3300039447 Bacteria 100222
247 Ga0436361_0598612 3300039447 Bacteria 13813
248 Ga0436361_1116767 3300039447 Bacteria 1978
249 Ga0436363_0593543 3300039450 Bacteria 1341
250 Ga0451841_0465944 3300041498 Bacteria 3937
251 Ga0451853_1171350 3300041512 Bacteria 3416
252 Ga0439445_0008088 3300042004 Bacteria 2455
253 Ga0451577_0270933 3300042876 Bacteria 1538
254 Ga0466972_0034955 3300044658 Bacteria 2460
255 Ga0453683_0203827 3300044673 Bacteria 1256
256 Ga0466965_0000219 3300044683 Bacteria 18114
257 Ga0466964_0011297 3300044706 Bacteria 3372
258 Ga0466968_0004158 3300044735 Bacteria 5393
259 Ga0466968_0217749 3300044735 Bacteria 898
260 Ga0495617_000013 3300046452 Bacteria 290031
261 Ga0495617_002208 3300046452 Bacteria 7931
262 Ga0495617_004094 3300046452 Bacteria 5354
263 Ga0495590_0000034 3300046457 Bacteria 129910
264 Ga0495629_0397499 3300046459 Bacteria 937
265 Ga0495638_0000072 3300046460 Bacteria 164926
266 Ga0495638_0007854 3300046460 Bacteria 7611
267 Ga0495638_0012638 3300046460 Bacteria 5777
268 Ga0495638_0019940 3300046460 Bacteria 4433
269 Ga0495638_0043576 3300046460 Bacteria 2830
270 Ga0495653_0000005 3300046463 Bacteria 367438
271 Ga0495650_0000061 3300046471 Bacteria 283347
272 Ga0495650_0000170 3300046471 Bacteria 143177
273 Ga0495650_0000772 3300046471 Bacteria 39497
274 Ga0495650_0001945 3300046471 Bacteria 18267
275 Ga0495650_0003034 3300046471 Bacteria 12673
276 Ga0495650_0011244 3300046471 Bacteria 4918
277 Ga0495580_0001555 3300046472 Bacteria 20191
278 Ga0495605_0000107 3300046474 Bacteria 105085
279 Ga0495605_0024852 3300046474 Bacteria 3129
280 Ga0495639_0004145 3300046475 Bacteria 6212
281 Ga0495584_0004777 3300046491 Bacteria 7245
282 Ga0495584_0005863 3300046491 Bacteria 6475
283 Ga0495585_0003823 3300046492 Bacteria 10031
284 Ga0495585_0030136 3300046492 Bacteria 3086
285 Ga0495585_0050860 3300046492 Bacteria 2297
286 Ga0495607_0001028 3300046501 Bacteria 25612
287 Ga0495607_0003458 3300046501 Bacteria 12092
288 Ga0495607_0024992 3300046501 Bacteria 3719
289 Ga0495607_0068564 3300046501 Bacteria 1989
290 Ga0495607_0288384 3300046501 Bacteria 776
291 Ga0495583_0000021 3300046506 Bacteria 287046
292 Ga0495583_0000148 3300046506 Bacteria 118749
293 Ga0495583_0026289 3300046506 Bacteria 2889
294 Ga0495606_0000118 3300046507 Bacteria 134504
295 Ga0495606_0000380 3300046507 Bacteria 75389
296 Ga0495606_0000449 3300046507 Bacteria 67234
297 Ga0495606_0000460 3300046507 Bacteria 66820
298 Ga0495606_0001824 3300046507 Bacteria 26988
299 Ga0495606_0002357 3300046507 Bacteria 22177
300 Ga0495606_0008229 3300046507 Bacteria 9110
301 Ga0495606_0023481 3300046507 Bacteria 4466
302 Ga0495610_0000012 3300046512 Bacteria 517442
303 Ga0495610_0001017 3300046512 Bacteria 25842
304 Ga0495610_0003766 3300046512 Bacteria 11594
305 Ga0495610_0057271 3300046512 Bacteria 1869
306 Ga0495616_0004047 3300046513 Bacteria 9315
307 Ga0495616_0022274 3300046513 Bacteria 3421
308 Ga0495637_0000462 3300046520 Bacteria 29660
309 Ga0495643_0000135 3300046522 Bacteria 118587
310 Ga0495643_0000193 3300046522 Bacteria 96406
311 Ga0495644_0000347 3300046523 Bacteria 21047
312 Ga0495644_0003305 3300046523 Bacteria 6375
313 Ga0495648_0000037 3300046524 Bacteria 195401
314 Ga0495648_0001316 3300046524 Bacteria 24609
315 Ga0495648_0003262 3300046524 Bacteria 14373
316 Ga0495648_0007313 3300046524 Bacteria 8851
317 Ga0495648_0020024 3300046524 Bacteria 4680
318 Ga0495642_0001077 3300046528 Bacteria 12620
319 Ga0495654_0000011 3300046530 Bacteria 363172
320 Ga0495654_0110796 3300046530 Bacteria 1253
321 Ga0495586_0006624 3300046535 Bacteria 6186
322 Ga0495586_0085135 3300046535 Bacteria 1741
323 Ga0495587_0075979 3300046536 Bacteria 1951
324 Ga0495609_0000250 3300046538 Bacteria 50865
325 Ga0495609_0005829 3300046538 Bacteria 6389
326 Ga0495609_0056754 3300046538 Bacteria 1734
327 Ga0495597_0000093 3300046542 Bacteria 79411
328 Ga0495597_0000156 3300046542 Bacteria 60520
329 Ga0495597_0023058 3300046542 Bacteria 2881
330 Ga0495597_0087239 3300046542 Bacteria 1328
331 Ga0495622_0000010 3300046557 Bacteria 212375
332 Ga0495622_0000040 3300046557 Bacteria 118542
333 Ga0495622_0178831 3300046557 Bacteria 952
334 Ga0495633_0000258 3300046558 Bacteria 62715
335 Ga0495633_0000270 3300046558 Bacteria 60861
336 Ga0495633_0000653 3300046558 Bacteria 32049
337 Ga0495633_0007124 3300046558 Bacteria 6495
338 Ga0495633_0016028 3300046558 Bacteria 3876
339 Ga0495633_0038389 3300046558 Bacteria 2287
340 Ga0495656_0028905 3300046615 Bacteria 2227
341 Ga0495668_0000137 3300046616 Bacteria 111150
342 Ga0495668_0000404 3300046616 Bacteria 56317
343 Ga0495668_0000967 3300046616 Bacteria 31810
344 Ga0495668_0002114 3300046616 Bacteria 17155
345 Ga0495611_0002250 3300046648 Bacteria 8956
346 Ga0495611_0002414 3300046648 Bacteria 8564
347 Ga0495625_0000023 3300046660 Bacteria 274067
348 Ga0495625_0001530 3300046660 Bacteria 27635
349 Ga0495625_0003570 3300046660 Bacteria 15339
350 Ga0495625_0005246 3300046660 Bacteria 11921
351 Ga0495625_0011630 3300046660 Bacteria 7160
352 Ga0495625_0148774 3300046660 Bacteria 1575
353 Ga0495659_0000008 3300046664 Bacteria 102082
354 Ga0495659_0000414 3300046664 Bacteria 16287
355 Ga0495659_0001006 3300046664 Bacteria 9846
356 Ga0495659_0277095 3300046664 Bacteria 704
357 Ga0495661_0006196 3300046665 Bacteria 8420
358 Ga0495661_0016554 3300046665 Bacteria 4884
359 Ga0495647_0002132 3300046681 Bacteria 6186
360 Ga0495647_0057737 3300046681 Bacteria 1524
361 Ga0495658_0013530 3300046683 Bacteria 4154
362 Ga0495658_0411564 3300046683 Bacteria 862
363 Ga0495669_0019092 3300046684 Bacteria 2956
364 Ga0495670_0001607 3300046691 Bacteria 11065
365 Ga0495670_0022608 3300046691 Bacteria 3105
366 Ga0495670_0116504 3300046691 Bacteria 1386
367 Ga0495671_0000006 3300046692 Bacteria 500471
368 Ga0495671_0000155 3300046692 Bacteria 59986
369 Ga0495671_0038447 3300046692 Bacteria 2418
370 Ga0495649_0003104 3300046694 Bacteria 11372
371 Ga0495649_0011035 3300046694 Bacteria 5323
372 Ga0495600_0251573 3300046809 Bacteria 1124
373 Ga0495660_0000339 3300046810 Bacteria 41484
374 Ga0495660_0017047 3300046810 Bacteria 4183
375 Ga0495636_0003359 3300047318 Bacteria 6201
376 Ga0495636_0009053 3300047318 Bacteria 3914
377 Ga0495672_0000030 3300047320 Bacteria 305021
378 Ga0495672_0000169 3300047320 Bacteria 94803
379 Ga0495672_0040006 3300047320 Bacteria 2846
380 Ga0495676_0046404 3300047321 Bacteria 3526
381 Ga0495680_0009388 3300047322 Bacteria 8801
382 Ga0495683_0039608 3300047323 Bacteria 2381
383 Ga0495687_000245 3300047443 Bacteria 73990
384 Ga0495687_007467 3300047443 Bacteria 6429
385 Ga0495687_053497 3300047443 Bacteria 1699
386 Ga0495677_0002637 3300047445 Bacteria 7014
387 Ga0495677_0009174 3300047445 Bacteria 3656
388 Ga0495685_000290 3300047447 Bacteria 16765
389 Ga0495673_0000003 3300047469 Bacteria 1491337
390 Ga0495673_0000015 3300047469 Bacteria 598766
391 Ga0495673_0000044 3300047469 Bacteria 283033
392 Ga0495673_0007387 3300047469 Bacteria 6325
393 Ga0495681_0019522 3300047470 Bacteria 3698
394 Ga0495686_0004973 3300047472 Bacteria 10688
395 Ga0495686_0008183 3300047472 Bacteria 7717
396 Ga0495626_0071817 3300048091 Bacteria 1554
397 Ga0496106_0393393 3300048909 Bacteria 1114
398 Ga0496106_0642582 3300048909 Bacteria 848
399 Ga0496107_0183017 3300048910 Bacteria 1556
400 Ga0496109_0043746 3300048912 Bacteria 4060
401 Ga0496110_0087193 3300048913 Bacteria 2788
402 Ga0496110_0294806 3300048913 Bacteria 1477
403 Ga0496117_0000001 3300048920 Bacteria 2526244
404 Ga0496118_0000008 3300048921 Bacteria 644537
405 Ga0496119_0175959 3300048922 Bacteria 1126
406 Ga0496120_0086510 3300048923 Bacteria 1685
407 Ga0496121_0004699 3300048924 Bacteria 18091
408 Ga0496121_0006539 3300048924 Bacteria 14404
409 Ga0496122_0001158 3300048925 Bacteria 45121
410 Ga0496123_0003745 3300048926 Bacteria 16673
411 Ga0496124_0050836 3300048927 Bacteria 3529
412 Ga0496124_0055699 3300048927 Bacteria 3340
413 Ga0496124_0070986 3300048927 Bacteria 2888
414 Ga0496124_0098109 3300048927 Bacteria 2378
415 Ga0496125_0003980 3300048928 Bacteria 17384
416 Ga0496125_0046805 3300048928 Bacteria 3625
417 Ga0496125_0064800 3300048928 Bacteria 2900
418 Ga0496125_0082343 3300048928 Bacteria 2453
419 Ga0496126_0016494 3300048929 Bacteria 7382
420 Ga0495678_000115 3300049459 Bacteria 96173
421 Ga0495678_003880 3300049459 Bacteria 8969
422 Ga0495678_004932 3300049459 Bacteria 7535
423 Ga0495682_0000370 3300049460 Bacteria 32590
424 Ga0495682_0001292 3300049460 Bacteria 13948
425 Ga0495682_0002330 3300049460 Bacteria 9037
426 Ga0495682_0042770 3300049460 Bacteria 1660
427 Ga0501033_0472155 3300049570 Bacteria 870
428 Ga0501071_0680136 3300049587 Bacteria 792
429 Ga0501035_0012832 3300049822 Bacteria 7738
430 Ga0501044_0000183 3300049823 Bacteria 77954
431 nmdc:mga0k408_12627_c1 3300050493 Bacteria 4617
432 nmdc:mga0k408_2102_c1 3300050493 Bacteria 10664
433 nmdc:mga0k408_28436_c1 3300050493 Bacteria 3178
434 nmdc:mga07m45_501_c1 3300050496 Bacteria 16602
435 nmdc:mga0n895_322648_c1 3300050512 Bacteria 1565
436 nmdc:mga0a205_1043580_c1 3300050515 Bacteria 664
437 nmdc:mga0a205_177520_c1 3300050515 Bacteria 2025
438 nmdc:mga0a205_64512_c1 3300050515 Bacteria 3537
439 Ga0500594_0041852 3300053118 Bacteria 1256
440 Ga0500618_000091 3300053125 Bacteria 73830
441 Ga0500586_003593 3300053145 Bacteria 3688
442 Ga0500622_0003630 3300053156 Bacteria 10143
443 Ga0530510_0799209 3300061734 Bacteria 720
444 2601670731 2600255292 Bacteria 6300551
445 2643787911 2643221554 Bacteria 6603920
446 2644026719 2643221603 Bacteria 6147767
447 2644212041 2643221638 Bacteria 6579467
448 2644253189 2643221645 Bacteria 7207331
449 2644355760 2643221664 Bacteria 7272945
450 2738742179 2738541280 Bacteria 6630198
451 2738828341 2738541297 Bacteria 6549566
452 2738841343 2738541300 Bacteria 6675882
453 2739152137 2738541357 Bacteria 6549408
454 2739193842 2738543003 Bacteria 6549560
455 2739272213 2738543018 Bacteria 6718814
456 2739320533 2738543026 Bacteria 6549408
457 2739338559 2738543029 Bacteria 6549249
458 2739341257 2738543030 Bacteria 6719714
459 2821132405 2821131069 Bacteria 6108407
460 2842713292 2842711865 Bacteria 7155354
461 2857552625 2857547612 Bacteria 6179999
462 2857562752 2857558681 Bacteria 6617694
463 2857569894 2857564685 Bacteria 6290584
464 2885085726 2885080285 Bacteria 6355622
465 2932414938 2932410948 Bacteria 6312192
466 2932419624 2932416698 Bacteria 6315112
467 Ga0395905_0000514
468 JGI25158J39367_1000433
469 JGI25158J39367_1000642
470 JGI25152J39213_1000105
471 JGI25150J39212_1000374
472 JGI25150J39212_1004353
473 JGI25159J45721_1000762
474 JGI25159J45721_1001061
475 JGI25159J45721_1001736
476 JGI25160J50197_1001081
477 JGI25161J50226_1000453
478 JGI25161J50226_1000724
479 Ga0055529_1000842
480 Ga0055526_1000001
481 Ga0055526_1000044
482 Ga0055526_1000121
483 Ga0055526_1005778
484 Ga0055537_1000179
485 Ga0055537_1002355
486 Ga0055537_1009830
487 Ga0055537_1013095
488 Ga0055524_1000008
489 Ga0055524_1003549
490 Ga0055524_1007473
491 Ga0055524_1022867
492 Ga0055524_1030376
493 Ga0055534_1000495
494 Ga0055534_1002232
495 Ga0055528_1000119
496 Ga0055530_10001373
497 Ga0055530_10002288
498 Ga0055530_10002362
499 Ga0055530_10044085
500 Ga0055531_10000001
501 Ga0055531_10000577
502 Ga0055531_10034459
503 Ga0055543_1000915
504 Ga0055543_1005198
505 Ga0065165_1000039
506 Ga0065165_1001994
507 Ga0065165_1019521
508 Ga0070677_10097995
509 Ga0068869_100264229
510 Ga0070680_100263286
511 Ga0068868_100027338
512 Ga0070675_100282177
513 Ga0070688_100109151
514 Ga0070659_100224779
515 Ga0070711_100061192
516 Ga0070711_100193944
517 Ga0070711_100319379
518 Ga0070708_100028362
519 Ga0070708_100051280
520 Ga0070708_100102743
521 Ga0070708_100567122
522 Ga0070685_10398007
523 Ga0070706_100012860
524 Ga0070706_100109660
525 Ga0070706_100366306
526 Ga0070707_100117646
527 Ga0070707_100132263
528 Ga0070699_100028026
529 Ga0070699_100218664
530 Ga0070684_100368097
531 Ga0070697_100088421
532 Ga0070697_100116978
533 Ga0070697_100810016
534 Ga0068853_100001996
535 Ga0068855_100074210
536 Ga0070664_100193046
537 Ga0068857_100019597
538 Ga0068857_100433342
539 Ga0068856_100074508
540 Ga0068859_100453382
541 Ga0068861_100148602
542 Ga0068863_100075810
543 Ga0068860_100493470
544 Ga0075364_10033118
545 Ga0070715_10008599
546 Ga0070716_100174065
547 Ga0075366_10017778
548 Ga0075366_10024860
549 Ga0075366_10277437
550 Ga0097621_100214579
551 Ga0075370_10001791
552 Ga0075370_10011909
553 Ga0075370_10117740
554 Ga0075433_10144710
555 Ga0075434_100105972
556 Ga0097620_100453389
557 Ga0099826_10000001
558 Ga0105244_10012653
559 Ga0105240_10013078
560 Ga0114129_11162059
561 Ga0105242_10032773
562 Ga0105248_10063055
563 Ga0105237_10170343
564 Ga0105238_10342593
565 Ga0105249_10221386
566 Ga0105239_10082983
567 Ga0157374_10100375
568 Ga0157378_10319146
569 Ga0163162_10599300
570 Ga0157375_10080510
571 Ga0157375_10346020
572 Ga0157375_10959511
573 Ga0157379_10002612
574 Ga0163161_10054909
575 Ga0213872_10000001
576 Ga0213872_10000298
577 Ga0213872_10011901
578 Ga0213872_10014015
579 Ga0213872_10017423
580 Ga0209436_100049
581 Ga0209436_100093
582 Ga0209672_105915
583 Ga0209258_107918
584 Ga0207425_1000001
585 Ga0207425_1000033
586 Ga0207425_1000159
587 Ga0207425_1018671
588 Ga0209646_1000054
589 Ga0209026_1003541
590 Ga0209026_1010849
591 Ga0209129_1000003
592 Ga0209129_1002851
593 Ga0209565_1000003
594 Ga0209565_1000162
595 Ga0209565_1000383
596 Ga0209565_1000474
597 Ga0209565_1003186
598 Ga0209565_1005728
599 Ga0209455_1000359
600 Ga0209673_1000003
601 Ga0209673_1023046
602 Ga0209130_1000084
603 Ga0209130_1000438
604 Ga0209130_1001623
605 Ga0209675_1000003
606 Ga0209675_1000713
607 Ga0209675_1002356
608 Ga0209675_1003385
609 Ga0209675_1032517
610 Ga0209025_1009036
611 Ga0209564_1000002
612 Ga0209564_1000011
613 Ga0209564_1000012
614 Ga0209564_1000095
615 Ga0209564_1005141
616 Ga0209564_1019883
617 Ga0209758_1000041
618 Ga0209050_1000011
619 Ga0209050_1000138
620 Ga0209050_1002638
621 Ga0209050_1009076
622 Ga0209256_1000005
623 Ga0209256_1000068
624 Ga0209256_1000255
625 Ga0209256_1000295
626 Ga0209256_1002521
627 Ga0207426_1001590
628 Ga0209051_1008980
629 Ga0209257_1000003
630 Ga0209257_1000033
631 Ga0209257_1006932
632 Ga0207696_1000087
633 Ga0207655_1068463
634 Ga0207692_10206639
635 Ga0207685_10010561
636 Ga0207684_10090914
637 Ga0207707_10121990
638 Ga0207671_10240207
639 Ga0207663_10168196
640 Ga0207663_10373219
641 Ga0207660_10161505
642 Ga0207646_10028340
643 Ga0207694_10223349
644 Ga0207690_10182794
645 Ga0207690_10244337
646 Ga0207689_10281307
647 Ga0207679_10330457
648 Ga0207677_10019953
649 Ga0207678_10160721
650 Ga0207708_10040618
651 Ga0207702_10113087
652 Ga0207641_10058824
653 Ga0207674_10221187
654 Ga0207675_100194386
655 Ga0209282_1000001
656 Ga0268264_10259586
657 Ga0268264_10455138
658 Ga0265334_10000014
659 Ga0307515_10000067
660 Ga0307512_10038200
661 Ga0265330_10001738
662 Ga0265332_10001673
663 Ga0265328_10036141
664 Ga0265325_10003555
665 Ga0265329_10001775
666 Ga0265339_10072486
667 Ga0265331_10000810
668 Ga0265327_10003804
669 Ga0265327_10215604
670 Ga0265316_10010782
671 Ga0307509_10214868
672 Ga0307408_100000530
673 Ga0307408_100003385
674 Ga0307408_100004073
675 Ga0307408_100004781
676 Ga0307408_100024052
677 Ga0307508_10176305
678 Ga0265314_10009258
679 Ga0265314_10015698
680 Ga0265342_10018868
681 Ga0307416_101104943
682 Ga0307507_10226368
683 Ga0307510_10017896
684 Ga0307510_10068909
685 Ga0373934_0068843
686 Ga0373936_0003796
687 Ga0373945_0012638
688 Ga0373954_0000706
689 Ga0373956_0024794
690 Ga0373957_0066808
691 Ga0373955_0029396
692 Ga0373924_0131683
693 Ga0373927_0132516
694 Ga0373933_0008677
695 Ga0373933_0041605
696 Ga0373947_0001397
697 Ga0373937_0000660
698 Ga0373937_0001017
699 Ga0373925_0014609
700 Ga0373925_0053797
701 Ga0395899_0141163
702 Ga0395899_0459747
703 Ga0395900_0038443
704 Ga0395900_0283430
705 Ga0395905_0434657
706 Ga0395901_0262586
707 Ga0436361_0067060
708 Ga0436361_0091769
709 Ga0436361_0099372
710 Ga0436361_0159469
711 Ga0436361_0419752
712 Ga0436361_0529332
713 Ga0436361_0598612
714 Ga0436361_1116767
715 Ga0436363_0593543
716 Ga0451841_0465944
717 Ga0451853_1171350
718 Ga0439445_0008088
719 Ga0451577_0270933
720 Ga0466972_0034955
721 Ga0453683_0203827
722 Ga0466965_0000219
723 Ga0466964_0011297
724 Ga0466968_0004158
725 Ga0466968_0217749
726 Ga0495617_000013
727 Ga0495617_002208
728 Ga0495617_004094
729 Ga0495590_0000034
730 Ga0495629_0397499
731 Ga0495638_0000072
732 Ga0495638_0007854
733 Ga0495638_0012638
734 Ga0495638_0019940
735 Ga0495638_0043576
736 Ga0495653_0000005
737 Ga0495650_0000061
738 Ga0495650_0000170
739 Ga0495650_0000772
740 Ga0495650_0001945
741 Ga0495650_0003034
742 Ga0495650_0011244
743 Ga0495580_0001555
744 Ga0495605_0000107
745 Ga0495605_0024852
746 Ga0495639_0004145
747 Ga0495584_0004777
748 Ga0495584_0005863
749 Ga0495585_0003823
750 Ga0495585_0030136
751 Ga0495585_0050860
752 Ga0495607_0001028
753 Ga0495607_0003458
754 Ga0495607_0024992
755 Ga0495607_0068564
756 Ga0495607_0288384
757 Ga0495583_0000021
758 Ga0495583_0000148
759 Ga0495583_0026289
760 Ga0495606_0000118
761 Ga0495606_0000380
762 Ga0495606_0000449
763 Ga0495606_0000460
764 Ga0495606_0001824
765 Ga0495606_0002357
766 Ga0495606_0008229
767 Ga0495606_0023481
768 Ga0495610_0000012
769 Ga0495610_0001017
770 Ga0495610_0003766
771 Ga0495610_0057271
772 Ga0495616_0004047
773 Ga0495616_0022274
774 Ga0495637_0000462
775 Ga0495643_0000135
776 Ga0495643_0000193
777 Ga0495644_0000347
778 Ga0495644_0003305
779 Ga0495648_0000037
780 Ga0495648_0001316
781 Ga0495648_0003262
782 Ga0495648_0007313
783 Ga0495648_0020024
784 Ga0495642_0001077
785 Ga0495654_0000011
786 Ga0495654_0110796
787 Ga0495586_0006624
788 Ga0495586_0085135
789 Ga0495587_0075979
790 Ga0495609_0000250
791 Ga0495609_0005829
792 Ga0495609_0056754
793 Ga0495597_0000093
794 Ga0495597_0000156
795 Ga0495597_0023058
796 Ga0495597_0087239
797 Ga0495622_0000010
798 Ga0495622_0000040
799 Ga0495622_0178831
800 Ga0495633_0000258
801 Ga0495633_0000270
802 Ga0495633_0000653
803 Ga0495633_0007124
804 Ga0495633_0016028
805 Ga0495633_0038389
806 Ga0495656_0028905
807 Ga0495668_0000137
808 Ga0495668_0000404
809 Ga0495668_0000967
810 Ga0495668_0002114
811 Ga0495611_0002250
812 Ga0495611_0002414
813 Ga0495625_0000023
814 Ga0495625_0001530
815 Ga0495625_0003570
816 Ga0495625_0005246
817 Ga0495625_0011630
818 Ga0495625_0148774
819 Ga0495659_0000008
820 Ga0495659_0000414
821 Ga0495659_0001006
822 Ga0495659_0277095
823 Ga0495661_0006196
824 Ga0495661_0016554
825 Ga0495647_0002132
826 Ga0495647_0057737
827 Ga0495658_0013530
828 Ga0495658_0411564
829 Ga0495669_0019092
830 Ga0495670_0001607
831 Ga0495670_0022608
832 Ga0495670_0116504
833 Ga0495671_0000006
834 Ga0495671_0000155
835 Ga0495671_0038447
836 Ga0495649_0003104
837 Ga0495649_0011035
838 Ga0495600_0251573
839 Ga0495660_0000339
840 Ga0495660_0017047
841 Ga0495636_0003359
842 Ga0495636_0009053
843 Ga0495672_0000030
844 Ga0495672_0000169
845 Ga0495672_0040006
846 Ga0495676_0046404
847 Ga0495680_0009388
848 Ga0495683_0039608
849 Ga0495687_000245
850 Ga0495687_007467
851 Ga0495687_053497
852 Ga0495677_0002637
853 Ga0495677_0009174
854 Ga0495685_000290
855 Ga0495673_0000003
856 Ga0495673_0000015
857 Ga0495673_0000044
858 Ga0495673_0007387
859 Ga0495681_0019522
860 Ga0495686_0004973
861 Ga0495686_0008183
862 Ga0495626_0071817
863 Ga0496106_0393393
864 Ga0496106_0642582
865 Ga0496107_0183017
866 Ga0496109_0043746
867 Ga0496110_0087193
868 Ga0496110_0294806
869 Ga0496117_0000001
870 Ga0496118_0000008
871 Ga0496119_0175959
872 Ga0496120_0086510
873 Ga0496121_0004699
874 Ga0496121_0006539
875 Ga0496122_0001158
876 Ga0496123_0003745
877 Ga0496124_0050836
878 Ga0496124_0055699
879 Ga0496124_0070986
880 Ga0496124_0098109
881 Ga0496125_0003980
882 Ga0496125_0046805
883 Ga0496125_0064800
884 Ga0496125_0082343
885 Ga0496126_0016494
886 Ga0495678_000115
887 Ga0495678_003880
888 Ga0495678_004932
889 Ga0495682_0000370
890 Ga0495682_0001292
891 Ga0495682_0002330
892 Ga0495682_0042770
893 Ga0501033_0472155
894 Ga0501071_0680136
895 Ga0501035_0012832
896 Ga0501044_0000183
897 nmdc:mga0k408_12627_c1
898 nmdc:mga0k408_2102_c1
899 nmdc:mga0k408_28436_c1
900 nmdc:mga07m45_501_c1
901 nmdc:mga0n895_322648_c1
902 nmdc:mga0a205_1043580_c1
903 nmdc:mga0a205_177520_c1
904 nmdc:mga0a205_64512_c1
905 Ga0500594_0041852
906 Ga0500618_000091
907 Ga0500586_003593
908 Ga0500622_0003630
909 Ga0530510_0799209
910 2601670731
911 2643787911
912 2644026719
913 2644212041
914 2644253189
915 2644355760
916 2738742179
917 2738828341
918 2738841343
919 2739152137
920 2739193842
921 2739272213
922 2739320533
923 2739338559
924 2739341257
925 2821132405
926 2842713292
927 2857552625
928 2857562752
929 2857569894
930 2885085726
931 2932414938
932 2932419624

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08768

THAP4_heme-bd

THAP4-like, heme-binding beta-barrel domain

33

209

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wje-assembly1.cif.gz_A crystal structure of mutant nitrobindin m75w/h76l/q96c/m148l/h158l (nb6) from arabidopsis thaliana 0.823 15 200
3wje-assembly1.cif.gz_A crystal structure of mutant nitrobindin m75w/h76l/q96c/m148l/h158l (nb6) from arabidopsis thaliana 0.818 15 200
3ia8-assembly1.cif.gz_A the structure of the c-terminal heme nitrobindin domain of thap domain-containing protein 4 from homo sapiens 0.8108 16 200
2a13-assembly1.cif.gz_A x-ray structure of protein from arabidopsis thaliana at1g79260 0.7954 22 200
3ia8-assembly1.cif.gz_A the structure of the c-terminal heme nitrobindin domain of thap domain-containing protein 4 from homo sapiens 0.7926 16 200
ID Description Score Start End Superfamily
3ia8B00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.8483 23 200 2.40.128.20
3wjeB00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.8184 22 200 2.40.128.20
3ia8B00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.8079 23 200 2.40.128.20
af_Q22857_66_227_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.807 22 200 2.40.128.20
af_Q18793_24_191_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7966 25 200 2.40.128.20
ID Description Score Start End GO Terms
AF-A0A3P1XIV0-F1-model_v4 deleted 0.9953 4 210
AF-A0A7Y7IB24-F1-model_v4 THAP4-like heme-binding beta-barrel domain-containing protein 0.9946 4 210
AF-A0A381EA63-F1-model_v4 Uncharacterized conserved protein 0.9935 4 210
AF-A0A366FDZ7-F1-model_v4 THAP4-like heme-binding beta-barrel domain-containing protein 0.9932 1 210
AF-A0A562IKF3-F1-model_v4 THAP4-like heme-binding beta-barrel domain-containing protein 0.993 1 210

Map