F449725

General Info

Members Datasets Scaffolds Average Seq Length
466 271 932 260

Family's Representative Sequence

Representative Sequence 3300046528|Ga0495642_0047390|Ga0495642_0047390_669_1562
Length 297
Sequence VQHFPTRQLRFFLTAPSPCPYLPDRFERKVFAHLPLSEGASVNDSLTQVGFRRSQNIAYRPACEACTACVSARIPAEDYIFSRSERRTLARNDDLERHLVEAEATMEQFDLLRRYLTTRHADGGMAEMTWPDFVAMVEDTAVRTHLIEYRLRSKDGGPGDLIACALVDLMSDGLSLVYSFYDPTMGRRSLGSYVILDHVIQACLTNLPYVYLGYWVRGSMKMDYKVRFSPIELLKPEGWTLLSARDNEAGAIPTRGRGQSVRPQHSRLRSSTAASVLARLAGVFPMAGQGVWPDSCG

Samples

Sample ID Description Type Environment
1 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
2 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
66 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
67 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
116 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
117 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
123 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
124 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
146 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
147 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
148 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
157 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
158 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
159 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
160 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
161 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
162 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
163 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
164 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
165 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
166 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
167 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
168 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
175 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
176 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
177 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
178 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
188 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
189 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
204 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
205 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
206 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
207 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
208 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
209 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
210 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
211 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
212 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
213 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
214 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
215 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
216 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
217 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
218 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
219 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
220 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
221 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
222 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
223 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
224 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
225 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
226 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
227 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
228 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
229 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
230 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
231 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
232 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
233 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
234 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
235 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
236 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
237 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
238 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
239 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
240 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
241 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
242 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
243 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
244 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
245 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
246 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
247 2643221583 Caulobacter sp. Root655 Isolate Unclassified
248 2643221584 Caulobacter sp. Root656 Isolate Unclassified
249 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
250 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
251 2643221640 Caulobacter sp. Root342 Isolate Unclassified
252 2643221642 Caulobacter sp. Root343 Isolate Unclassified
253 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
254 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
255 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
256 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
257 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
258 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
259 2818991435 Caulobacter henricii 536 Isolate Unclassified
260 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
261 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
262 2849560528 Caulobacter zeae 410 Isolate Unclassified
263 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
264 2851153111 Caulobacter radicis 736 Isolate Unclassified
265 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
266 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
267 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
268 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
269 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
270 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
271 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.92
Metatranscriptomes 0
Isolates 7.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.24
Nodule 0
Rhizoplane 2.36
Rhizosphere 67.81
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495642_0047390 3300046528 Bacteria 1760
2 Ga0055537_1002613 3300003773 Bacteria 5897
3 Ga0055536_1000689 3300003781 Bacteria 22680
4 Ga0055536_1000750 3300003781 Bacteria 21664
5 Ga0055528_1006429 3300003790 Bacteria 5329
6 Ga0055530_10005161 3300003791 Bacteria 6364
7 Ga0055530_10015291 3300003791 Bacteria 2513
8 Ga0055531_10000307 3300003794 Bacteria 48396
9 Ga0055531_10003562 3300003794 Bacteria 9886
10 Ga0055531_10005109 3300003794 Bacteria 7751
11 Ga0055531_10008569 3300003794 Bacteria 5367
12 Ga0065165_1004073 3300005262 Bacteria 9473
13 Ga0070658_10042597 3300005327 Bacteria 3667
14 Ga0070658_10134358 3300005327 Bacteria 2063
15 Ga0070670_100263779 3300005331 Bacteria 1502
16 Ga0070666_10026098 3300005335 Bacteria 3814
17 Ga0070680_100003919 3300005336 Bacteria 11125
18 Ga0070680_100028058 3300005336 Bacteria 4513
19 Ga0070660_100006139 3300005339 Bacteria 8312
20 Ga0070660_100115582 3300005339 Bacteria 2139
21 Ga0070691_10002909 3300005341 Bacteria 7679
22 Ga0070668_100001314 3300005347 Bacteria 17796
23 Ga0070668_100002513 3300005347 Bacteria 13506
24 Ga0070668_100003794 3300005347 Bacteria 11167
25 Ga0070669_100310191 3300005353 Bacteria 1271
26 Ga0070671_100000153 3300005355 Bacteria 45037
27 Ga0070671_100180578 3300005355 Bacteria 1786
28 Ga0070673_100301168 3300005364 Bacteria 1411
29 Ga0070659_100103099 3300005366 Bacteria 2297
30 Ga0070667_100000164 3300005367 Bacteria 82930
31 Ga0070667_100010779 3300005367 Bacteria 7553
32 Ga0070667_100030589 3300005367 Bacteria 4490
33 Ga0070667_100621948 3300005367 Bacteria 996
34 Ga0070663_100184566 3300005455 Bacteria 1620
35 Ga0070663_100277774 3300005455 Bacteria 1334
36 Ga0070662_100104822 3300005457 Bacteria 2146
37 Ga0070681_10006236 3300005458 Bacteria 11594
38 Ga0070681_10008777 3300005458 Bacteria 9922
39 Ga0070698_100187674 3300005471 Bacteria 2005
40 Ga0070679_100007723 3300005530 Bacteria 10071
41 Ga0070679_100018512 3300005530 Bacteria 6760
42 Ga0068853_100253714 3300005539 Bacteria 1615
43 Ga0068853_100290302 3300005539 Bacteria 1510
44 Ga0070665_100000327 3300005548 Bacteria 73382
45 Ga0070665_100000435 3300005548 Bacteria 60967
46 Ga0070665_100000489 3300005548 Bacteria 56677
47 Ga0070665_100065040 3300005548 Bacteria 3659
48 Ga0068855_100010643 3300005563 Bacteria 11094
49 Ga0068855_100222206 3300005563 Bacteria 2117
50 Ga0068855_100305905 3300005563 Bacteria 1760
51 Ga0070664_100014357 3300005564 Bacteria 6458
52 Ga0070664_100197692 3300005564 Bacteria 1793
53 Ga0068854_100452923 3300005578 Bacteria 1072
54 Ga0068856_100409386 3300005614 Bacteria 1376
55 Ga0068852_100022666 3300005616 Bacteria 5041
56 Ga0068859_100028356 3300005617 Bacteria 5612
57 Ga0068859_100081503 3300005617 Bacteria 3278
58 Ga0068859_100124405 3300005617 Bacteria 2647
59 Ga0068864_100000068 3300005618 Bacteria 115507
60 Ga0068864_100028069 3300005618 Bacteria 4756
61 Ga0068864_100044149 3300005618 Bacteria 3819
62 Ga0068864_100266967 3300005618 Bacteria 1593
63 Ga0068861_100054639 3300005719 Bacteria 3043
64 Ga0068861_100274876 3300005719 Bacteria 1448
65 Ga0068863_100000036 3300005841 Bacteria 164593
66 Ga0068863_100006128 3300005841 Bacteria 11793
67 Ga0068863_100047211 3300005841 Bacteria 4086
68 Ga0068863_100161659 3300005841 Bacteria 2146
69 Ga0068863_100182443 3300005841 Bacteria 2015
70 Ga0068858_100000030 3300005842 Bacteria 144357
71 Ga0068858_100013333 3300005842 Bacteria 7754
72 Ga0068858_100015350 3300005842 Bacteria 7204
73 Ga0068858_100206843 3300005842 Bacteria 1857
74 Ga0068860_100000625 3300005843 Bacteria 41833
75 Ga0068860_100111096 3300005843 Bacteria 2620
76 Ga0068862_100014236 3300005844 Bacteria 6597
77 Ga0068862_100057559 3300005844 Bacteria 3334
78 Ga0068862_100070631 3300005844 Bacteria 3014
79 Ga0068862_100141605 3300005844 Bacteria 2135
80 Ga0070717_10211147 3300006028 Bacteria 1703
81 Ga0075365_10297554 3300006038 Bacteria 1135
82 Ga0075363_100192315 3300006048 Bacteria 1164
83 Ga0075364_10002360 3300006051 Bacteria 10606
84 Ga0075367_10009950 3300006178 Bacteria 4983
85 Ga0075369_10008571 3300006186 Bacteria 3939
86 Ga0075369_10108666 3300006186 Bacteria 1249
87 Ga0068865_100001535 3300006881 Bacteria 13468
88 Ga0097620_100028357 3300006931 Bacteria 5612
89 Ga0097620_100081509 3300006931 Bacteria 3278
90 Ga0097620_100124402 3300006931 Bacteria 2647
91 Ga0105250_10086630 3300009092 Bacteria 1272
92 Ga0105240_10003668 3300009093 Bacteria 23753
93 Ga0105240_10053244 3300009093 Bacteria 5082
94 Ga0105240_10061003 3300009093 Bacteria 4701
95 Ga0105240_10075728 3300009093 Bacteria 4150
96 Ga0105240_10300397 3300009093 Bacteria 1837
97 Ga0105248_10000335 3300009177 Bacteria 55396
98 Ga0105248_10002814 3300009177 Bacteria 19315
99 Ga0105248_10007227 3300009177 Bacteria 12181
100 Ga0105248_10278223 3300009177 Bacteria 1884
101 Ga0105237_10396359 3300009545 Bacteria 1385
102 Ga0105238_10041512 3300009551 Bacteria 4658
103 Ga0105238_10270735 3300009551 Bacteria 1679
104 Ga0105238_10705269 3300009551 Bacteria 1021
105 Ga0105249_10005313 3300009553 Bacteria 11117
106 Ga0105249_10260535 3300009553 Bacteria 1723
107 Ga0105239_10623687 3300010375 Bacteria 1231
108 Ga0157373_10006647 3300013100 Bacteria 8614
109 Ga0157370_10087240 3300013104 Bacteria 2931
110 Ga0157369_10122069 3300013105 Bacteria 2763
111 Ga0157369_11018101 3300013105 Bacteria 848
112 Ga0157374_10586004 3300013296 Bacteria 1125
113 Ga0163162_10048692 3300013306 Bacteria 4247
114 Ga0157372_10056415 3300013307 Bacteria 4389
115 Ga0157375_10396527 3300013308 Bacteria 1547
116 Ga0163163_10000698 3300014325 Bacteria 28545
117 Ga0163163_10056830 3300014325 Bacteria 3868
118 Ga0163163_10089961 3300014325 Bacteria 3083
119 Ga0163163_10096786 3300014325 Bacteria 2972
120 Ga0163163_10173294 3300014325 Bacteria 2204
121 Ga0163163_10275445 3300014325 Bacteria 1734
122 Ga0157380_11142772 3300014326 Bacteria 820
123 Ga0157379_10000956 3300014968 Bacteria 23412
124 Ga0157379_10031414 3300014968 Bacteria 4730
125 Ga0157379_10217580 3300014968 Bacteria 1730
126 Ga0163161_10217141 3300017792 Bacteria 1479
127 Ga0163161_10420839 3300017792 Bacteria 1075
128 Ga0213872_10144069 3300021361 Bacteria 1044
129 Ga0209026_1000780 3300025250 Bacteria 17661
130 Ga0209148_1009461 3300025254 Bacteria 1896
131 Ga0209565_1000354 3300025263 Bacteria 40069
132 Ga0209673_1000961 3300025273 Bacteria 35930
133 Ga0209675_1010151 3300025291 Bacteria 3244
134 Ga0209676_1000061 3300025292 Bacteria 332674
135 Ga0209676_1000136 3300025292 Bacteria 181860
136 Ga0209676_1000200 3300025292 Bacteria 133793
137 Ga0209676_1007843 3300025292 Bacteria 4908
138 Ga0209564_1000667 3300025295 Bacteria 50734
139 Ga0209564_1011737 3300025295 Bacteria 3893
140 Ga0209758_1002676 3300025297 Bacteria 17601
141 Ga0209758_1002962 3300025297 Bacteria 16286
142 Ga0209050_1000057 3300025298 Bacteria 326289
143 Ga0209050_1000431 3300025298 Bacteria 76895
144 Ga0209050_1000568 3300025298 Bacteria 59952
145 Ga0209256_1000707 3300025299 Bacteria 44360
146 Ga0209051_1000836 3300025303 Bacteria 31706
147 Ga0209257_1000142 3300025304 Bacteria 200756
148 Ga0209257_1000199 3300025304 Bacteria 148045
149 Ga0209257_1000572 3300025304 Bacteria 61910
150 Ga0209257_1001049 3300025304 Bacteria 36732
151 Ga0209257_1001182 3300025304 Bacteria 33003
152 Ga0207696_1045901 3300025711 Bacteria 1262
153 Ga0207680_10025240 3300025903 Bacteria 3276
154 Ga0207680_10031558 3300025903 Bacteria 3002
155 Ga0207680_10068851 3300025903 Bacteria 2185
156 Ga0207680_10285878 3300025903 Bacteria 1147
157 Ga0207705_10003443 3300025909 Bacteria 12038
158 Ga0207707_10012872 3300025912 Bacteria 7280
159 Ga0207707_10161144 3300025912 Bacteria 1961
160 Ga0207707_10265571 3300025912 Bacteria 1488
161 Ga0207707_10526731 3300025912 Bacteria 1006
162 Ga0207695_10001303 3300025913 Bacteria 42365
163 Ga0207695_10002836 3300025913 Bacteria 25176
164 Ga0207695_10507412 3300025913 Bacteria 1088
165 Ga0207660_10000845 3300025917 Bacteria 20177
166 Ga0207660_10260103 3300025917 Bacteria 1372
167 Ga0207657_10041777 3300025919 Bacteria 4051
168 Ga0207649_10378057 3300025920 Bacteria 1055
169 Ga0207652_10009166 3300025921 Bacteria 7964
170 Ga0207652_10032089 3300025921 Bacteria 4412
171 Ga0207681_10459108 3300025923 Bacteria 1037
172 Ga0207694_10022208 3300025924 Bacteria 4812
173 Ga0207694_10037811 3300025924 Bacteria 3710
174 Ga0207694_10038387 3300025924 Bacteria 3682
175 Ga0207694_10046695 3300025924 Bacteria 3347
176 Ga0207694_10507595 3300025924 Bacteria 1010
177 Ga0207650_10000161 3300025925 Bacteria 81097
178 Ga0207650_10014204 3300025925 Bacteria 5532
179 Ga0207644_10026310 3300025931 Bacteria 4007
180 Ga0207644_10038670 3300025931 Bacteria 3363
181 Ga0207690_10000294 3300025932 Bacteria 35162
182 Ga0207690_10008516 3300025932 Bacteria 6084
183 Ga0207690_10008700 3300025932 Bacteria 6023
184 Ga0207706_10043661 3300025933 Bacteria 3972
185 Ga0207704_10000963 3300025938 Bacteria 12727
186 Ga0207711_10004279 3300025941 Bacteria 12197
187 Ga0207711_10005573 3300025941 Bacteria 10646
188 Ga0207679_10105197 3300025945 Bacteria 2216
189 Ga0207667_10013715 3300025949 Bacteria 9263
190 Ga0207667_10034504 3300025949 Bacteria 5432
191 Ga0207667_10117223 3300025949 Bacteria 2744
192 Ga0207667_10137058 3300025949 Bacteria 2520
193 Ga0207667_10141677 3300025949 Bacteria 2475
194 Ga0207712_10002765 3300025961 Bacteria 11217
195 Ga0207712_10226134 3300025961 Bacteria 1499
196 Ga0207668_10000180 3300025972 Bacteria 42714
197 Ga0207668_10000413 3300025972 Bacteria 26960
198 Ga0207668_10002455 3300025972 Bacteria 10825
199 Ga0207668_10018561 3300025972 Bacteria 4380
200 Ga0207668_10028229 3300025972 Bacteria 3666
201 Ga0207668_10028977 3300025972 Bacteria 3626
202 Ga0207640_10326373 3300025981 Bacteria 1224
203 Ga0207658_10000106 3300025986 Bacteria 90920
204 Ga0207658_10007897 3300025986 Bacteria 7247
205 Ga0207658_10389759 3300025986 Bacteria 1222
206 Ga0207703_10000037 3300026035 Bacteria 176167
207 Ga0207703_10015822 3300026035 Bacteria 5884
208 Ga0207703_10059485 3300026035 Bacteria 3121
209 Ga0207703_10147924 3300026035 Bacteria 2045
210 Ga0207639_10138716 3300026041 Bacteria 2023
211 Ga0207639_10483401 3300026041 Bacteria 1129
212 Ga0207678_10124641 3300026067 Bacteria 2198
213 Ga0207702_10112636 3300026078 Bacteria 2422
214 Ga0207702_10447228 3300026078 Bacteria 1253
215 Ga0207641_10000055 3300026088 Bacteria 170796
216 Ga0207641_10001659 3300026088 Bacteria 21728
217 Ga0207641_10011195 3300026088 Bacteria 7358
218 Ga0207641_10139115 3300026088 Bacteria 2188
219 Ga0207641_10179342 3300026088 Bacteria 1939
220 Ga0207676_10000744 3300026095 Bacteria 25497
221 Ga0207676_10013576 3300026095 Bacteria 5846
222 Ga0207676_10031259 3300026095 Bacteria 4003
223 Ga0207676_10033928 3300026095 Bacteria 3861
224 Ga0207676_10219785 3300026095 Bacteria 1691
225 Ga0207675_100457078 3300026118 Bacteria 1266
226 Ga0207683_10386087 3300026121 Bacteria 1287
227 Ga0207698_10367715 3300026142 Bacteria 1364
228 Ga0209999_1002881 3300027543 Bacteria 3052
229 Ga0209813_10006607 3300027866 Bacteria 2871
230 Ga0268266_10000064 3300028379 Bacteria 249533
231 Ga0268266_10000450 3300028379 Bacteria 60987
232 Ga0268266_10014856 3300028379 Bacteria 6685
233 Ga0268266_10096731 3300028379 Bacteria 2596
234 Ga0268266_10125697 3300028379 Bacteria 2288
235 Ga0268265_10003333 3300028380 Bacteria 11616
236 Ga0268265_10005595 3300028380 Bacteria 8580
237 Ga0268265_10014106 3300028380 Bacteria 5446
238 Ga0268265_10106024 3300028380 Bacteria 2282
239 Ga0268264_10000046 3300028381 Bacteria 364597
240 Ga0268264_10000059 3300028381 Bacteria 306927
241 Ga0268264_10004827 3300028381 Bacteria 11425
242 Ga0268264_10286504 3300028381 Bacteria 1545
243 Ga0265319_1070912 3300028563 Bacteria 1117
244 Ga0265334_10017019 3300028573 Bacteria 3007
245 Ga0307517_10005270 3300028786 Bacteria 19547
246 Ga0307515_10081295 3300028794 Bacteria 4211
247 Ga0265338_10000869 3300028800 Bacteria 51220
248 Ga0265338_10063642 3300028800 Bacteria 3215
249 Ga0307511_10089687 3300030521 Bacteria 2093
250 Ga0265325_10000112 3300031241 Bacteria 55792
251 Ga0265340_10051745 3300031247 Bacteria 1988
252 Ga0265339_10002509 3300031249 Bacteria 13109
253 Ga0265331_10017250 3300031250 Bacteria 3771
254 Ga0265327_10123206 3300031251 Bacteria 1226
255 Ga0307513_10000181 3300031456 Bacteria 91264
256 Ga0307513_10001560 3300031456 Bacteria 32859
257 Ga0307513_10003287 3300031456 Bacteria 22017
258 Ga0265313_10001297 3300031595 Bacteria 23643
259 Ga0307508_10211268 3300031616 Bacteria 1541
260 Ga0265314_10109031 3300031711 Unclassified 1763
261 Ga0265342_10011516 3300031712 Bacteria 6047
262 Ga0307516_10000004 3300031730 Bacteria 367451
263 Ga0307412_10004337 3300031911 Bacteria 7910
264 Ga0307414_10021457 3300032004 Bacteria 4053
265 Ga0307510_10056419 3300033180 Bacteria 4091
266 Ga0373936_0011279 3300035113 Bacteria 3381
267 Ga0373937_0739815 3300036401 Bacteria 931
268 Ga0395899_0000013 3300037312 Bacteria 510397
269 Ga0395899_0000100 3300037312 Bacteria 151710
270 Ga0395899_0174440 3300037312 Bacteria 1512
271 Ga0395900_0000009 3300037418 Bacteria 476249
272 Ga0395900_0108643 3300037418 Bacteria 2850
273 Ga0395900_0237558 3300037418 Bacteria 1829
274 Ga0395898_0012235 3300037466 Bacteria 8870
275 Ga0395898_0157714 3300037466 Bacteria 2170
276 Ga0395905_0000983 3300037471 Bacteria 36562
277 Ga0395905_0008702 3300037471 Bacteria 9990
278 Ga0395905_0064704 3300037471 Bacteria 3423
279 Ga0395901_0000014 3300038443 Bacteria 375100
280 Ga0395901_0235762 3300038443 Bacteria 1909
281 Ga0436365_1271125 3300039437 Bacteria 3300
282 Ga0436365_1884511 3300039437 Bacteria 98004
283 Ga0436360_0503204 3300039438 Bacteria 893
284 Ga0436361_0107954 3300039447 Bacteria 6055
285 Ga0436361_0722808 3300039447 Bacteria 1849
286 Ga0436363_0806815 3300039450 Bacteria 1405
287 Ga0439465_0046730 3300041413 Bacteria 1410
288 Ga0439445_0054865 3300042004 Bacteria 1081
289 Ga0439459_0010785 3300042438 Bacteria 1600
290 Ga0466966_0053850 3300044684 Bacteria 2552
291 Ga0466963_0501821 3300044694 Bacteria 857
292 Ga0466959_0110805 3300045049 Bacteria 1959
293 Ga0495627_000679 3300046453 Bacteria 26196
294 Ga0495629_0014901 3300046459 Bacteria 5590
295 Ga0495638_0000462 3300046460 Bacteria 48757
296 Ga0495638_0001280 3300046460 Bacteria 23445
297 Ga0495638_0001418 3300046460 Bacteria 21760
298 Ga0495638_0004552 3300046460 Bacteria 10504
299 Ga0495650_0000020 3300046471 Bacteria 533839
300 Ga0495650_0049728 3300046471 Bacteria 1739
301 Ga0495605_0142625 3300046474 Bacteria 1074
302 Ga0495583_0000069 3300046506 Bacteria 186863
303 Ga0495583_0118346 3300046506 Bacteria 1117
304 Ga0495606_0001454 3300046507 Bacteria 31699
305 Ga0495606_0030642 3300046507 Bacteria 3755
306 Ga0495610_0000731 3300046512 Bacteria 31166
307 Ga0495610_0001496 3300046512 Bacteria 20535
308 Ga0495616_0000112 3300046513 Bacteria 71263
309 Ga0495620_0082249 3300046515 Bacteria 1301
310 Ga0495631_0002719 3300046518 Bacteria 9813
311 Ga0495637_0006460 3300046520 Bacteria 5880
312 Ga0495637_0015178 3300046520 Bacteria 3617
313 Ga0495637_0018684 3300046520 Bacteria 3212
314 Ga0495644_0173645 3300046523 Bacteria 828
315 Ga0495648_0000724 3300046524 Bacteria 35198
316 Ga0495648_0118179 3300046524 Bacteria 1430
317 Ga0495642_0098134 3300046528 Bacteria 1245
318 Ga0495654_0000018 3300046530 Bacteria 293124
319 Ga0495621_0094318 3300046539 Bacteria 1132
320 Ga0495597_0001857 3300046542 Bacteria 14445
321 Ga0495622_0007388 3300046557 Bacteria 5097
322 Ga0495668_0000014 3300046616 Bacteria 442055
323 Ga0495668_0003909 3300046616 Bacteria 10886
324 Ga0495668_0064959 3300046616 Bacteria 2008
325 Ga0495668_0065019 3300046616 Bacteria 2008
326 Ga0495668_0076512 3300046616 Bacteria 1837
327 Ga0495668_0085178 3300046616 Bacteria 1733
328 Ga0495668_0110935 3300046616 Bacteria 1500
329 Ga0495625_0000271 3300046660 Bacteria 80817
330 Ga0495625_0114117 3300046660 Bacteria 1844
331 Ga0495625_0372752 3300046660 Bacteria 897
332 Ga0495669_0000001 3300046684 Bacteria 291866
333 Ga0495669_0000172 3300046684 Bacteria 40888
334 Ga0495669_0061104 3300046684 Bacteria 1705
335 Ga0495670_0029256 3300046691 Bacteria 2734
336 Ga0495589_0006610 3300046794 Bacteria 6109
337 Ga0495687_021405 3300047443 Bacteria 3129
338 Ga0495677_0016491 3300047445 Bacteria 2681
339 Ga0495677_0031816 3300047445 Bacteria 1921
340 Ga0495679_041712 3300047446 Bacteria 1419
341 Ga0495673_0000094 3300047469 Bacteria 183868
342 Ga0495673_0000296 3300047469 Bacteria 66691
343 Ga0495686_0001837 3300047472 Bacteria 21314
344 Ga0495686_0028790 3300047472 Bacteria 3616
345 Ga0495602_0481463 3300048088 Bacteria 871
346 Ga0496102_0045101 3300048905 Bacteria 4002
347 Ga0496102_0093292 3300048905 Bacteria 2789
348 Ga0496105_0301157 3300048908 Bacteria 1289
349 Ga0496106_0046083 3300048909 Bacteria 3276
350 Ga0496107_0000037 3300048910 Bacteria 78089
351 Ga0496112_0264109 3300048915 Bacteria 1670
352 Ga0496115_0027080 3300048918 Bacteria 4480
353 Ga0496115_0061583 3300048918 Bacteria 3025
354 Ga0496115_0125262 3300048918 Bacteria 2116
355 Ga0496115_0374369 3300048918 Bacteria 1159
356 Ga0496116_0042290 3300048919 Bacteria 3117
357 Ga0496117_0018687 3300048920 Bacteria 5729
358 Ga0496118_0015808 3300048921 Bacteria 6961
359 Ga0496121_0000852 3300048924 Bacteria 55246
360 Ga0496121_0001466 3300048924 Bacteria 39744
361 Ga0496125_0000598 3300048928 Bacteria 61438
362 Ga0496126_0001922 3300048929 Bacteria 29774
363 Ga0501033_0231077 3300049570 Bacteria 1314
364 Ga0501034_0242998 3300049571 Bacteria 1746
365 Ga0501034_0444437 3300049571 Bacteria 1215
366 Ga0501047_0002694 3300049581 Bacteria 16915
367 Ga0501047_0047893 3300049581 Bacteria 4129
368 Ga0501048_0239040 3300049582 Bacteria 1289
369 Ga0501070_0395497 3300049586 Bacteria 1118
370 Ga0501257_016545 3300049686 Bacteria 1711
371 Ga0501035_0468041 3300049822 Bacteria 1041
372 Ga0501044_0181710 3300049823 Bacteria 2070
373 Ga0501044_0295235 3300049823 Bacteria 1551
374 Ga0501044_0764128 3300049823 Bacteria 848
375 nmdc:mga00v17_2041_c1 3300050491 Bacteria 10398
376 nmdc:mga0k408_35168_c1 3300050493 Bacteria 2872
377 nmdc:mga06z11_201740_c1 3300050494 Bacteria 1156
378 nmdc:mga04h51_3583_c1 3300050495 Bacteria 3785
379 nmdc:mga0sz30_15618_c1 3300050516 Bacteria 3003
380 Ga0500578_0000035 3300053086 Bacteria 136406
381 Ga0500578_0171824 3300053086 Bacteria 1340
382 Ga0500643_004968 3300053087 Bacteria 5846
383 Ga0500643_010684 3300053087 Bacteria 3398
384 Ga0500643_013486 3300053087 Bacteria 2884
385 Ga0500643_014449 3300053087 Bacteria 2744
386 Ga0500644_0000508 3300053088 Bacteria 16629
387 Ga0500644_0032355 3300053088 Bacteria 1671
388 Ga0500583_0098638 3300053092 Bacteria 1429
389 Ga0500651_0034928 3300053093 Bacteria 3169
390 Ga0500651_0152875 3300053093 Bacteria 1385
391 Ga0500641_0000388 3300053096 Bacteria 16338
392 Ga0500641_0002268 3300053096 Bacteria 6817
393 Ga0500650_0046477 3300053098 Bacteria 2012
394 Ga0500554_052120 3300053102 Bacteria 1290
395 Ga0500556_0000111 3300053104 Bacteria 72589
396 Ga0500562_000185 3300053108 Bacteria 16837
397 Ga0500562_000418 3300053108 Bacteria 10340
398 Ga0500562_001174 3300053108 Bacteria 6457
399 Ga0500569_010992 3300053109 Bacteria 2149
400 Ga0500572_051725 3300053111 Bacteria 1226
401 Ga0500594_0000176 3300053118 Bacteria 16254
402 Ga0500595_007953 3300053119 Bacteria 4358
403 Ga0500595_009858 3300053119 Bacteria 3832
404 Ga0500608_000093 3300053122 Bacteria 36398
405 Ga0500608_001039 3300053122 Bacteria 9934
406 Ga0500614_002421 3300053123 Bacteria 4167
407 Ga0500614_013724 3300053123 Bacteria 1784
408 Ga0500618_000209 3300053125 Bacteria 46358
409 Ga0500652_145909 3300053131 Bacteria 983
410 Ga0500658_0002416 3300053134 Bacteria 7230
411 Ga0500559_0000101 3300053136 Bacteria 67160
412 Ga0500559_0007831 3300053136 Bacteria 4717
413 Ga0500559_0016575 3300053136 Bacteria 3112
414 Ga0500559_0120974 3300053136 Bacteria 1217
415 Ga0500564_004773 3300053138 Bacteria 5469
416 Ga0500577_0042015 3300053142 Bacteria 1671
417 Ga0500603_044635 3300053150 Bacteria 1194
418 Ga0500616_0019140 3300053153 Bacteria 3862
419 Ga0500622_0000180 3300053156 Bacteria 68052
420 Ga0500622_0004073 3300053156 Bacteria 9385
421 Ga0500622_0011345 3300053156 Bacteria 4857
422 Ga0500627_0070624 3300053158 Bacteria 1546
423 Ga0500638_167673 3300053162 Bacteria 960
424 Ga0500637_0002023 3300053178 Bacteria 8845
425 Ga0500637_0055416 3300053178 Bacteria 2264
426 Ga0500625_025584 3300053729 Bacteria 2792
427 Ga0500645_000433 3300053730 Bacteria 28666
428 Ga0500645_000457 3300053730 Bacteria 28069
429 Ga0500645_002058 3300053730 Bacteria 9334
430 Ga0500645_020526 3300053730 Bacteria 2048
431 Ga0500609_008612 3300053731 Bacteria 1376
432 Ga0500596_000136 3300053735 Bacteria 10927
433 Ga0500601_002672 3300053737 Bacteria 1916
434 2511124622 2510917020 Bacteria 5657507
435 2561466115 2558860983 Bacteria 4133860
436 2585149171 2582581279 Bacteria 4980720
437 2585154709 2582581280 Bacteria 5994497
438 2585198225 2582581293 Bacteria 5907401
439 2587919704 2585428106 Bacteria 5179711
440 2643750711 2643221545 Bacteria 5083237
441 2643782012 2643221552 Bacteria 5708754
442 2643926166 2643221583 Bacteria 5218014
443 2643927902 2643221584 Bacteria 5511711
444 2644000034 2643221598 Bacteria 4578346
445 2644085059 2643221614 Bacteria 4260023
446 2644226362 2643221640 Bacteria 5258820
447 2644235850 2643221642 Bacteria 5357871
448 2644342611 2643221661 Bacteria 4267604
449 2644352079 2643221663 Bacteria 3425771
450 2644365911 2643221666 Bacteria 4265935
451 2644509785 2643221691 Bacteria 5093099
452 2644548209 2643221699 Bacteria 5731501
453 2792459455 2791355048 Bacteria 5832535
454 2819537932 2818991435 Bacteria 5433759
455 2819648715 2818991454 Bacteria 5563326
456 2843747207 2843744320 Bacteria 5659202
457 2849560744 2849560528 Bacteria 5393480
458 2849574265 2849573788 Bacteria 5421256
459 2851158109 2851153111 Bacteria 5542585
460 2857506673 2857504554 Bacteria 5369913
461 2884963941 2884960567 Bacteria 5437054
462 2898330953 2898329390 Bacteria 5168154
463 2928534511 2928531327 Bacteria 5101314
464 2928974917 2928972540 Bacteria 3058286
465 2941488521 2941485952 Bacteria 3591484
466 2977242039 2977240413 Bacteria 3191065
467 Ga0495642_0047390
468 Ga0055537_1002613
469 Ga0055536_1000689
470 Ga0055536_1000750
471 Ga0055528_1006429
472 Ga0055530_10005161
473 Ga0055530_10015291
474 Ga0055531_10000307
475 Ga0055531_10003562
476 Ga0055531_10005109
477 Ga0055531_10008569
478 Ga0065165_1004073
479 Ga0070658_10042597
480 Ga0070658_10134358
481 Ga0070670_100263779
482 Ga0070666_10026098
483 Ga0070680_100003919
484 Ga0070680_100028058
485 Ga0070660_100006139
486 Ga0070660_100115582
487 Ga0070691_10002909
488 Ga0070668_100001314
489 Ga0070668_100002513
490 Ga0070668_100003794
491 Ga0070669_100310191
492 Ga0070671_100000153
493 Ga0070671_100180578
494 Ga0070673_100301168
495 Ga0070659_100103099
496 Ga0070667_100000164
497 Ga0070667_100010779
498 Ga0070667_100030589
499 Ga0070667_100621948
500 Ga0070663_100184566
501 Ga0070663_100277774
502 Ga0070662_100104822
503 Ga0070681_10006236
504 Ga0070681_10008777
505 Ga0070698_100187674
506 Ga0070679_100007723
507 Ga0070679_100018512
508 Ga0068853_100253714
509 Ga0068853_100290302
510 Ga0070665_100000327
511 Ga0070665_100000435
512 Ga0070665_100000489
513 Ga0070665_100065040
514 Ga0068855_100010643
515 Ga0068855_100222206
516 Ga0068855_100305905
517 Ga0070664_100014357
518 Ga0070664_100197692
519 Ga0068854_100452923
520 Ga0068856_100409386
521 Ga0068852_100022666
522 Ga0068859_100028356
523 Ga0068859_100081503
524 Ga0068859_100124405
525 Ga0068864_100000068
526 Ga0068864_100028069
527 Ga0068864_100044149
528 Ga0068864_100266967
529 Ga0068861_100054639
530 Ga0068861_100274876
531 Ga0068863_100000036
532 Ga0068863_100006128
533 Ga0068863_100047211
534 Ga0068863_100161659
535 Ga0068863_100182443
536 Ga0068858_100000030
537 Ga0068858_100013333
538 Ga0068858_100015350
539 Ga0068858_100206843
540 Ga0068860_100000625
541 Ga0068860_100111096
542 Ga0068862_100014236
543 Ga0068862_100057559
544 Ga0068862_100070631
545 Ga0068862_100141605
546 Ga0070717_10211147
547 Ga0075365_10297554
548 Ga0075363_100192315
549 Ga0075364_10002360
550 Ga0075367_10009950
551 Ga0075369_10008571
552 Ga0075369_10108666
553 Ga0068865_100001535
554 Ga0097620_100028357
555 Ga0097620_100081509
556 Ga0097620_100124402
557 Ga0105250_10086630
558 Ga0105240_10003668
559 Ga0105240_10053244
560 Ga0105240_10061003
561 Ga0105240_10075728
562 Ga0105240_10300397
563 Ga0105248_10000335
564 Ga0105248_10002814
565 Ga0105248_10007227
566 Ga0105248_10278223
567 Ga0105237_10396359
568 Ga0105238_10041512
569 Ga0105238_10270735
570 Ga0105238_10705269
571 Ga0105249_10005313
572 Ga0105249_10260535
573 Ga0105239_10623687
574 Ga0157373_10006647
575 Ga0157370_10087240
576 Ga0157369_10122069
577 Ga0157369_11018101
578 Ga0157374_10586004
579 Ga0163162_10048692
580 Ga0157372_10056415
581 Ga0157375_10396527
582 Ga0163163_10000698
583 Ga0163163_10056830
584 Ga0163163_10089961
585 Ga0163163_10096786
586 Ga0163163_10173294
587 Ga0163163_10275445
588 Ga0157380_11142772
589 Ga0157379_10000956
590 Ga0157379_10031414
591 Ga0157379_10217580
592 Ga0163161_10217141
593 Ga0163161_10420839
594 Ga0213872_10144069
595 Ga0209026_1000780
596 Ga0209148_1009461
597 Ga0209565_1000354
598 Ga0209673_1000961
599 Ga0209675_1010151
600 Ga0209676_1000061
601 Ga0209676_1000136
602 Ga0209676_1000200
603 Ga0209676_1007843
604 Ga0209564_1000667
605 Ga0209564_1011737
606 Ga0209758_1002676
607 Ga0209758_1002962
608 Ga0209050_1000057
609 Ga0209050_1000431
610 Ga0209050_1000568
611 Ga0209256_1000707
612 Ga0209051_1000836
613 Ga0209257_1000142
614 Ga0209257_1000199
615 Ga0209257_1000572
616 Ga0209257_1001049
617 Ga0209257_1001182
618 Ga0207696_1045901
619 Ga0207680_10025240
620 Ga0207680_10031558
621 Ga0207680_10068851
622 Ga0207680_10285878
623 Ga0207705_10003443
624 Ga0207707_10012872
625 Ga0207707_10161144
626 Ga0207707_10265571
627 Ga0207707_10526731
628 Ga0207695_10001303
629 Ga0207695_10002836
630 Ga0207695_10507412
631 Ga0207660_10000845
632 Ga0207660_10260103
633 Ga0207657_10041777
634 Ga0207649_10378057
635 Ga0207652_10009166
636 Ga0207652_10032089
637 Ga0207681_10459108
638 Ga0207694_10022208
639 Ga0207694_10037811
640 Ga0207694_10038387
641 Ga0207694_10046695
642 Ga0207694_10507595
643 Ga0207650_10000161
644 Ga0207650_10014204
645 Ga0207644_10026310
646 Ga0207644_10038670
647 Ga0207690_10000294
648 Ga0207690_10008516
649 Ga0207690_10008700
650 Ga0207706_10043661
651 Ga0207704_10000963
652 Ga0207711_10004279
653 Ga0207711_10005573
654 Ga0207679_10105197
655 Ga0207667_10013715
656 Ga0207667_10034504
657 Ga0207667_10117223
658 Ga0207667_10137058
659 Ga0207667_10141677
660 Ga0207712_10002765
661 Ga0207712_10226134
662 Ga0207668_10000180
663 Ga0207668_10000413
664 Ga0207668_10002455
665 Ga0207668_10018561
666 Ga0207668_10028229
667 Ga0207668_10028977
668 Ga0207640_10326373
669 Ga0207658_10000106
670 Ga0207658_10007897
671 Ga0207658_10389759
672 Ga0207703_10000037
673 Ga0207703_10015822
674 Ga0207703_10059485
675 Ga0207703_10147924
676 Ga0207639_10138716
677 Ga0207639_10483401
678 Ga0207678_10124641
679 Ga0207702_10112636
680 Ga0207702_10447228
681 Ga0207641_10000055
682 Ga0207641_10001659
683 Ga0207641_10011195
684 Ga0207641_10139115
685 Ga0207641_10179342
686 Ga0207676_10000744
687 Ga0207676_10013576
688 Ga0207676_10031259
689 Ga0207676_10033928
690 Ga0207676_10219785
691 Ga0207675_100457078
692 Ga0207683_10386087
693 Ga0207698_10367715
694 Ga0209999_1002881
695 Ga0209813_10006607
696 Ga0268266_10000064
697 Ga0268266_10000450
698 Ga0268266_10014856
699 Ga0268266_10096731
700 Ga0268266_10125697
701 Ga0268265_10003333
702 Ga0268265_10005595
703 Ga0268265_10014106
704 Ga0268265_10106024
705 Ga0268264_10000046
706 Ga0268264_10000059
707 Ga0268264_10004827
708 Ga0268264_10286504
709 Ga0265319_1070912
710 Ga0265334_10017019
711 Ga0307517_10005270
712 Ga0307515_10081295
713 Ga0265338_10000869
714 Ga0265338_10063642
715 Ga0307511_10089687
716 Ga0265325_10000112
717 Ga0265340_10051745
718 Ga0265339_10002509
719 Ga0265331_10017250
720 Ga0265327_10123206
721 Ga0307513_10000181
722 Ga0307513_10001560
723 Ga0307513_10003287
724 Ga0265313_10001297
725 Ga0307508_10211268
726 Ga0265314_10109031
727 Ga0265342_10011516
728 Ga0307516_10000004
729 Ga0307412_10004337
730 Ga0307414_10021457
731 Ga0307510_10056419
732 Ga0373936_0011279
733 Ga0373937_0739815
734 Ga0395899_0000013
735 Ga0395899_0000100
736 Ga0395899_0174440
737 Ga0395900_0000009
738 Ga0395900_0108643
739 Ga0395900_0237558
740 Ga0395898_0012235
741 Ga0395898_0157714
742 Ga0395905_0000983
743 Ga0395905_0008702
744 Ga0395905_0064704
745 Ga0395901_0000014
746 Ga0395901_0235762
747 Ga0436365_1271125
748 Ga0436365_1884511
749 Ga0436360_0503204
750 Ga0436361_0107954
751 Ga0436361_0722808
752 Ga0436363_0806815
753 Ga0439465_0046730
754 Ga0439445_0054865
755 Ga0439459_0010785
756 Ga0466966_0053850
757 Ga0466963_0501821
758 Ga0466959_0110805
759 Ga0495627_000679
760 Ga0495629_0014901
761 Ga0495638_0000462
762 Ga0495638_0001280
763 Ga0495638_0001418
764 Ga0495638_0004552
765 Ga0495650_0000020
766 Ga0495650_0049728
767 Ga0495605_0142625
768 Ga0495583_0000069
769 Ga0495583_0118346
770 Ga0495606_0001454
771 Ga0495606_0030642
772 Ga0495610_0000731
773 Ga0495610_0001496
774 Ga0495616_0000112
775 Ga0495620_0082249
776 Ga0495631_0002719
777 Ga0495637_0006460
778 Ga0495637_0015178
779 Ga0495637_0018684
780 Ga0495644_0173645
781 Ga0495648_0000724
782 Ga0495648_0118179
783 Ga0495642_0098134
784 Ga0495654_0000018
785 Ga0495621_0094318
786 Ga0495597_0001857
787 Ga0495622_0007388
788 Ga0495668_0000014
789 Ga0495668_0003909
790 Ga0495668_0064959
791 Ga0495668_0065019
792 Ga0495668_0076512
793 Ga0495668_0085178
794 Ga0495668_0110935
795 Ga0495625_0000271
796 Ga0495625_0114117
797 Ga0495625_0372752
798 Ga0495669_0000001
799 Ga0495669_0000172
800 Ga0495669_0061104
801 Ga0495670_0029256
802 Ga0495589_0006610
803 Ga0495687_021405
804 Ga0495677_0016491
805 Ga0495677_0031816
806 Ga0495679_041712
807 Ga0495673_0000094
808 Ga0495673_0000296
809 Ga0495686_0001837
810 Ga0495686_0028790
811 Ga0495602_0481463
812 Ga0496102_0045101
813 Ga0496102_0093292
814 Ga0496105_0301157
815 Ga0496106_0046083
816 Ga0496107_0000037
817 Ga0496112_0264109
818 Ga0496115_0027080
819 Ga0496115_0061583
820 Ga0496115_0125262
821 Ga0496115_0374369
822 Ga0496116_0042290
823 Ga0496117_0018687
824 Ga0496118_0015808
825 Ga0496121_0000852
826 Ga0496121_0001466
827 Ga0496125_0000598
828 Ga0496126_0001922
829 Ga0501033_0231077
830 Ga0501034_0242998
831 Ga0501034_0444437
832 Ga0501047_0002694
833 Ga0501047_0047893
834 Ga0501048_0239040
835 Ga0501070_0395497
836 Ga0501257_016545
837 Ga0501035_0468041
838 Ga0501044_0181710
839 Ga0501044_0295235
840 Ga0501044_0764128
841 nmdc:mga00v17_2041_c1
842 nmdc:mga0k408_35168_c1
843 nmdc:mga06z11_201740_c1
844 nmdc:mga04h51_3583_c1
845 nmdc:mga0sz30_15618_c1
846 Ga0500578_0000035
847 Ga0500578_0171824
848 Ga0500643_004968
849 Ga0500643_010684
850 Ga0500643_013486
851 Ga0500643_014449
852 Ga0500644_0000508
853 Ga0500644_0032355
854 Ga0500583_0098638
855 Ga0500651_0034928
856 Ga0500651_0152875
857 Ga0500641_0000388
858 Ga0500641_0002268
859 Ga0500650_0046477
860 Ga0500554_052120
861 Ga0500556_0000111
862 Ga0500562_000185
863 Ga0500562_000418
864 Ga0500562_001174
865 Ga0500569_010992
866 Ga0500572_051725
867 Ga0500594_0000176
868 Ga0500595_007953
869 Ga0500595_009858
870 Ga0500608_000093
871 Ga0500608_001039
872 Ga0500614_002421
873 Ga0500614_013724
874 Ga0500618_000209
875 Ga0500652_145909
876 Ga0500658_0002416
877 Ga0500559_0000101
878 Ga0500559_0007831
879 Ga0500559_0016575
880 Ga0500559_0120974
881 Ga0500564_004773
882 Ga0500577_0042015
883 Ga0500603_044635
884 Ga0500616_0019140
885 Ga0500622_0000180
886 Ga0500622_0004073
887 Ga0500622_0011345
888 Ga0500627_0070624
889 Ga0500638_167673
890 Ga0500637_0002023
891 Ga0500637_0055416
892 Ga0500625_025584
893 Ga0500645_000433
894 Ga0500645_000457
895 Ga0500645_002058
896 Ga0500645_020526
897 Ga0500609_008612
898 Ga0500596_000136
899 Ga0500601_002672
900 2511124622
901 2561466115
902 2585149171
903 2585154709
904 2585198225
905 2587919704
906 2643750711
907 2643782012
908 2643926166
909 2643927902
910 2644000034
911 2644085059
912 2644226362
913 2644235850
914 2644342611
915 2644352079
916 2644365911
917 2644509785
918 2644548209
919 2792459455
920 2819537932
921 2819648715
922 2843747207
923 2849560744
924 2849574265
925 2851158109
926 2857506673
927 2884963941
928 2898330953
929 2928534511
930 2928974917
931 2941488521
932 2977242039

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04376

ATE_N

Arginine-tRNA-protein transferase, N terminus

17

87

0.98

PF04377

ATE_C

Arginine-tRNA-protein transferase, C terminus

107

235

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wg2-assembly1.cif.gz_A evaa-klate1 0.8512 27 234
7wg1-assembly1.cif.gz_A dvaa-klate1 0.8506 27 234
7wg4-assembly1.cif.gz_A dvaa-klate1 0.8482 27 234
7wg1-assembly2.cif.gz_B dvaa-klate1 0.8397 27 234
7wfx-assembly2.cif.gz_B evaa-klate1 0.8359 22 241
ID Description Score Start End Superfamily
af_P90914_254_388_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7871 109 230 3.40.630.30
af_O14133_140_264_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7853 110 230 3.40.50.1820
af_Q9C776_322_467_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.774 109 230 3.40.630.30
af_Q09518_10_141_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7571 156 213 3.40.630.30
af_A0A1D8PG12_149_290_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7569 110 228 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A653RRE2-F1-model_v4 Aspartate/glutamate leucyltransferase (EC 2.3.2.29) 0.9934 15 244 GO:0004057
GO:0005737
GO:0008914
GO:0071596
AF-A0A3G9G8I3-F1-model_v4 Arginine-tRNA-protein transferase (EC 2.3.2.8) 0.9822 32 242 GO:0004057
GO:0005737
GO:0008914
GO:0071596
AF-A0A653RRE2-F1-model_v4 Aspartate/glutamate leucyltransferase (EC 2.3.2.29) 0.9807 15 244 GO:0004057
GO:0005737
GO:0008914
GO:0071596
AF-A0A7W7F826-F1-model_v4 Aspartate/glutamate leucyltransferase (EC 2.3.2.29) 0.9766 28 243 GO:0004057
GO:0005737
GO:0008914
GO:0071596
AF-A0A4Q3YJK2-F1-model_v4 Arginyltransferase (EC 2.3.2.8) 0.9756 28 243 GO:0004057
GO:0005737
GO:0008914
GO:0071596

Map